(data stored in ACNUC7421 zone)

EMBL: CP000312

ID   CP000312; SV 1; circular; genomic DNA; STD; PRO; 2897393 BP.
XX
AC   CP000312;
XX
PR   Project:PRJNA12521;
XX
DT   27-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Clostridium perfringens SM101, complete genome.
XX
KW   .
XX
OS   Clostridium perfringens SM101
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-2897393
RX   DOI; 10.1101/gr.5238106.
RX   PUBMED; 16825665.
RA   Myers G.S., Rasko D.A., Cheung J.K., Ravel J., Seshadri R., Deboy R.T.,
RA   Ren Q., Varga J., Awad M.M., Brinkac L.M., Daugherty S.C., Haft D.H.,
RA   Dodson R.J., Madupu R., Nelson W.C., Rosovitz M.J., Sullivan S.A.,
RA   Khouri H., Dimitrov G.I., Watkins K.L., Mulligan S., Benton J., Radune D.,
RA   Fisher D.J., Atkins H.S., Hiscox T., Jost B.H., Billington S.J.,
RA   Songer J.G., McClane B.A., Titball R.W., Rood J.I., Melville S.B.,
RA   Paulsen I.T.;
RT   "Skewed genomic variability in strains of the toxigenic bacterial pathogen,
RT   Clostridium perfringens";
RL   Genome Res. 16(8):1031-1040(2006).
XX
RN   [2]
RP   1-2897393
RA   Myers G.S., Rasko D.A., Cheung J.K., Ravel J., Seshadri R., DeBoy R.T.,
RA   Ren Q., Varga J., Awad M.M., Brinkac L.M., Daugherty S.C., Haft D.H.,
RA   Dodson R.J., Madupu R., Nelson W.C., Rosovitz M., Sullivan S.A.,
RA   Khouri H.M., Dimitrov G., Watkins K.L., Mulligan S., Benton J.L.,
RA   Fisher D.J., Atkins H.S., Hiscox T., Jost H., Billington S.J., Songer J.G.,
RA   McClane B.A., Titball R.W., Rood J.I., Melville S., Paulsen I.;
RT   ;
RL   Submitted (06-APR-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-2897393
RA   Shrivastava S., Brinkac L.M., Dodson R.J., Harkins D.M., Durkin A.S.,
RA   Sutton G.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; 13489a0de0843753a1051ffd88ae0f2a.
DR   BioSample; SAMN02604026.
DR   EnsemblGenomes-Gn; CPR_0008.
DR   EnsemblGenomes-Gn; CPR_0009.
DR   EnsemblGenomes-Gn; CPR_0016.
DR   EnsemblGenomes-Gn; CPR_0017.
DR   EnsemblGenomes-Gn; CPR_0019.
DR   EnsemblGenomes-Gn; CPR_0020.
DR   EnsemblGenomes-Gn; CPR_0031.
DR   EnsemblGenomes-Gn; CPR_0035.
DR   EnsemblGenomes-Gn; CPR_0047.
DR   EnsemblGenomes-Gn; CPR_0071.
DR   EnsemblGenomes-Gn; CPR_0077.
DR   EnsemblGenomes-Gn; CPR_0078.
DR   EnsemblGenomes-Gn; CPR_0090.
DR   EnsemblGenomes-Gn; CPR_0095.
DR   EnsemblGenomes-Gn; CPR_0191.
DR   EnsemblGenomes-Gn; CPR_0228.
DR   EnsemblGenomes-Gn; CPR_0250.
DR   EnsemblGenomes-Gn; CPR_0263.
DR   EnsemblGenomes-Gn; CPR_0473.
DR   EnsemblGenomes-Gn; CPR_0559.
DR   EnsemblGenomes-Gn; CPR_0677.
DR   EnsemblGenomes-Gn; CPR_1372.
DR   EnsemblGenomes-Gn; CPR_1834.
DR   EnsemblGenomes-Gn; CPR_1864.
DR   EnsemblGenomes-Gn; CPR_1865.
DR   EnsemblGenomes-Gn; CPR_1866.
DR   EnsemblGenomes-Gn; CPR_1867.
DR   EnsemblGenomes-Gn; CPR_1958.
DR   EnsemblGenomes-Gn; CPR_2129.
DR   EnsemblGenomes-Gn; CPR_2130.
DR   EnsemblGenomes-Gn; CPR_2146.
DR   EnsemblGenomes-Gn; CPR_2147.
DR   EnsemblGenomes-Gn; CPR_2148.
DR   EnsemblGenomes-Gn; CPR_2149.
DR   EnsemblGenomes-Gn; CPR_2150.
DR   EnsemblGenomes-Gn; CPR_2151.
DR   EnsemblGenomes-Gn; CPR_2152.
DR   EnsemblGenomes-Gn; CPR_2211.
DR   EnsemblGenomes-Gn; CPR_2212.
DR   EnsemblGenomes-Gn; CPR_2213.
DR   EnsemblGenomes-Gn; CPR_2217.
DR   EnsemblGenomes-Gn; CPR_2218.
DR   EnsemblGenomes-Gn; CPR_2219.
DR   EnsemblGenomes-Gn; CPR_2220.
DR   EnsemblGenomes-Gn; CPR_2221.
DR   EnsemblGenomes-Gn; CPR_2222.
DR   EnsemblGenomes-Gn; CPR_2223.
DR   EnsemblGenomes-Gn; CPR_2224.
DR   EnsemblGenomes-Gn; CPR_2225.
DR   EnsemblGenomes-Gn; CPR_2226.
DR   EnsemblGenomes-Gn; CPR_2227.
DR   EnsemblGenomes-Gn; CPR_2228.
DR   EnsemblGenomes-Gn; CPR_2229.
DR   EnsemblGenomes-Gn; CPR_2230.
DR   EnsemblGenomes-Gn; CPR_2231.
DR   EnsemblGenomes-Gn; CPR_2232.
DR   EnsemblGenomes-Gn; CPR_2233.
DR   EnsemblGenomes-Gn; CPR_2234.
DR   EnsemblGenomes-Gn; CPR_2235.
DR   EnsemblGenomes-Gn; CPR_2236.
DR   EnsemblGenomes-Gn; CPR_2237.
DR   EnsemblGenomes-Gn; CPR_2305.
DR   EnsemblGenomes-Gn; CPR_2306.
DR   EnsemblGenomes-Gn; CPR_2307.
DR   EnsemblGenomes-Gn; CPR_2308.
DR   EnsemblGenomes-Gn; CPR_2312.
DR   EnsemblGenomes-Gn; CPR_2313.
DR   EnsemblGenomes-Gn; CPR_2314.
DR   EnsemblGenomes-Gn; CPR_2315.
DR   EnsemblGenomes-Gn; CPR_2316.
DR   EnsemblGenomes-Gn; CPR_2417.
DR   EnsemblGenomes-Gn; CPR_2454.
DR   EnsemblGenomes-Gn; CPR_2455.
DR   EnsemblGenomes-Gn; CPR_2458.
DR   EnsemblGenomes-Gn; CPR_2459.
DR   EnsemblGenomes-Gn; CPR_2460.
DR   EnsemblGenomes-Gn; CPR_2466.
DR   EnsemblGenomes-Gn; CPR_2476.
DR   EnsemblGenomes-Gn; CPR_2477.
DR   EnsemblGenomes-Gn; CPR_2478.
DR   EnsemblGenomes-Gn; CPR_2479.
DR   EnsemblGenomes-Gn; CPR_2480.
DR   EnsemblGenomes-Gn; CPR_2481.
DR   EnsemblGenomes-Gn; CPR_2482.
DR   EnsemblGenomes-Gn; CPR_2624.
DR   EnsemblGenomes-Gn; CPR_2625.
DR   EnsemblGenomes-Gn; CPR_2626.
DR   EnsemblGenomes-Gn; CPR_2627.
DR   EnsemblGenomes-Gn; CPR_2628.
DR   EnsemblGenomes-Gn; CPR_2629.
DR   EnsemblGenomes-Gn; CPR_2630.
DR   EnsemblGenomes-Gn; CPR_2631.
DR   EnsemblGenomes-Gn; CPR_2632.
DR   EnsemblGenomes-Gn; CPR_2633.
DR   EnsemblGenomes-Gn; EBG00001466522.
DR   EnsemblGenomes-Gn; EBG00001466523.
DR   EnsemblGenomes-Gn; EBG00001466524.
DR   EnsemblGenomes-Gn; EBG00001466525.
DR   EnsemblGenomes-Gn; EBG00001466526.
DR   EnsemblGenomes-Gn; EBG00001466527.
DR   EnsemblGenomes-Gn; EBG00001466528.
DR   EnsemblGenomes-Gn; EBG00001466529.
DR   EnsemblGenomes-Gn; EBG00001466530.
DR   EnsemblGenomes-Gn; EBG00001466531.
DR   EnsemblGenomes-Gn; EBG00001466532.
DR   EnsemblGenomes-Gn; EBG00001466533.
DR   EnsemblGenomes-Gn; EBG00001466534.
DR   EnsemblGenomes-Gn; EBG00001466535.
DR   EnsemblGenomes-Gn; EBG00001466536.
DR   EnsemblGenomes-Gn; EBG00001466537.
DR   EnsemblGenomes-Gn; EBG00001466538.
DR   EnsemblGenomes-Gn; EBG00001466539.
DR   EnsemblGenomes-Gn; EBG00001466540.
DR   EnsemblGenomes-Gn; EBG00001466541.
DR   EnsemblGenomes-Gn; EBG00001466542.
DR   EnsemblGenomes-Gn; EBG00001466543.
DR   EnsemblGenomes-Gn; EBG00001466544.
DR   EnsemblGenomes-Gn; EBG00001466545.
DR   EnsemblGenomes-Gn; EBG00001466546.
DR   EnsemblGenomes-Gn; EBG00001466547.
DR   EnsemblGenomes-Gn; EBG00001466548.
DR   EnsemblGenomes-Gn; EBG00001466549.
DR   EnsemblGenomes-Gn; EBG00001466550.
DR   EnsemblGenomes-Gn; EBG00001466551.
DR   EnsemblGenomes-Gn; EBG00001466552.
DR   EnsemblGenomes-Gn; EBG00001466553.
DR   EnsemblGenomes-Gn; EBG00001466554.
DR   EnsemblGenomes-Gn; EBG00001466555.
DR   EnsemblGenomes-Gn; EBG00001466556.
DR   EnsemblGenomes-Gn; EBG00001466557.
DR   EnsemblGenomes-Gn; EBG00001466558.
DR   EnsemblGenomes-Gn; EBG00001466559.
DR   EnsemblGenomes-Gn; EBG00001466560.
DR   EnsemblGenomes-Gn; EBG00001466561.
DR   EnsemblGenomes-Gn; EBG00001466562.
DR   EnsemblGenomes-Gn; EBG00001466563.
DR   EnsemblGenomes-Gn; EBG00001466564.
DR   EnsemblGenomes-Gn; EBG00001466565.
DR   EnsemblGenomes-Gn; EBG00001466566.
DR   EnsemblGenomes-Gn; EBG00001466567.
DR   EnsemblGenomes-Gn; EBG00001466568.
DR   EnsemblGenomes-Gn; EBG00001466569.
DR   EnsemblGenomes-Gn; EBG00001466570.
DR   EnsemblGenomes-Gn; EBG00001466571.
DR   EnsemblGenomes-Gn; EBG00001466572.
DR   EnsemblGenomes-Gn; EBG00001466573.
DR   EnsemblGenomes-Gn; EBG00001466574.
DR   EnsemblGenomes-Gn; EBG00001466575.
DR   EnsemblGenomes-Gn; EBG00001466576.
DR   EnsemblGenomes-Gn; EBG00001466577.
DR   EnsemblGenomes-Gn; EBG00001466578.
DR   EnsemblGenomes-Gn; EBG00001466579.
DR   EnsemblGenomes-Gn; EBG00001466580.
DR   EnsemblGenomes-Gn; EBG00001466581.
DR   EnsemblGenomes-Gn; EBG00001466582.
DR   EnsemblGenomes-Gn; EBG00001466583.
DR   EnsemblGenomes-Gn; EBG00001466584.
DR   EnsemblGenomes-Gn; EBG00001466585.
DR   EnsemblGenomes-Gn; EBG00001466586.
DR   EnsemblGenomes-Gn; EBG00001466587.
DR   EnsemblGenomes-Gn; EBG00001466588.
DR   EnsemblGenomes-Gn; EBG00001466589.
DR   EnsemblGenomes-Gn; EBG00001466590.
DR   EnsemblGenomes-Gn; EBG00001466591.
DR   EnsemblGenomes-Gn; EBG00001466592.
DR   EnsemblGenomes-Gn; EBG00001466593.
DR   EnsemblGenomes-Gn; EBG00001466594.
DR   EnsemblGenomes-Gn; EBG00001466595.
DR   EnsemblGenomes-Gn; EBG00001466596.
DR   EnsemblGenomes-Gn; EBG00001466597.
DR   EnsemblGenomes-Gn; EBG00001466598.
DR   EnsemblGenomes-Gn; EBG00001466599.
DR   EnsemblGenomes-Gn; EBG00001466600.
DR   EnsemblGenomes-Gn; EBG00001466601.
DR   EnsemblGenomes-Gn; EBG00001466602.
DR   EnsemblGenomes-Gn; EBG00001466603.
DR   EnsemblGenomes-Gn; EBG00001466604.
DR   EnsemblGenomes-Gn; EBG00001466605.
DR   EnsemblGenomes-Gn; EBG00001466606.
DR   EnsemblGenomes-Gn; EBG00001466607.
DR   EnsemblGenomes-Gn; EBG00001466608.
DR   EnsemblGenomes-Gn; EBG00001466609.
DR   EnsemblGenomes-Gn; EBG00001466610.
DR   EnsemblGenomes-Gn; EBG00001466611.
DR   EnsemblGenomes-Gn; EBG00001466612.
DR   EnsemblGenomes-Gn; EBG00001466613.
DR   EnsemblGenomes-Gn; EBG00001466614.
DR   EnsemblGenomes-Gn; EBG00001466615.
DR   EnsemblGenomes-Gn; EBG00001466616.
DR   EnsemblGenomes-Gn; EBG00001466617.
DR   EnsemblGenomes-Gn; EBG00001466618.
DR   EnsemblGenomes-Gn; EBG00001466619.
DR   EnsemblGenomes-Gn; EBG00001466620.
DR   EnsemblGenomes-Gn; EBG00001466621.
DR   EnsemblGenomes-Gn; EBG00001466622.
DR   EnsemblGenomes-Gn; EBG00001466623.
DR   EnsemblGenomes-Gn; EBG00001466624.
DR   EnsemblGenomes-Gn; EBG00001466625.
DR   EnsemblGenomes-Gn; EBG00001466626.
DR   EnsemblGenomes-Gn; EBG00001466627.
DR   EnsemblGenomes-Gn; EBG00001466628.
DR   EnsemblGenomes-Gn; EBG00001466629.
DR   EnsemblGenomes-Gn; EBG00001466630.
DR   EnsemblGenomes-Gn; EBG00001466631.
DR   EnsemblGenomes-Gn; EBG00001466632.
DR   EnsemblGenomes-Gn; EBG00001466633.
DR   EnsemblGenomes-Gn; EBG00001466634.
DR   EnsemblGenomes-Gn; EBG00001466635.
DR   EnsemblGenomes-Gn; EBG00001466636.
DR   EnsemblGenomes-Gn; EBG00001466637.
DR   EnsemblGenomes-Gn; EBG00001466638.
DR   EnsemblGenomes-Gn; EBG00001466639.
DR   EnsemblGenomes-Gn; EBG00001466640.
DR   EnsemblGenomes-Gn; EBG00001466641.
DR   EnsemblGenomes-Gn; EBG00001466642.
DR   EnsemblGenomes-Gn; EBG00001466643.
DR   EnsemblGenomes-Gn; EBG00001466644.
DR   EnsemblGenomes-Gn; EBG00001466645.
DR   EnsemblGenomes-Gn; EBG00001466646.
DR   EnsemblGenomes-Gn; EBG00001466647.
DR   EnsemblGenomes-Gn; EBG00001466648.
DR   EnsemblGenomes-Gn; EBG00001466649.
DR   EnsemblGenomes-Gn; EBG00001466650.
DR   EnsemblGenomes-Gn; EBG00001466651.
DR   EnsemblGenomes-Gn; EBG00001466652.
DR   EnsemblGenomes-Gn; EBG00001466653.
DR   EnsemblGenomes-Gn; EBG00001466654.
DR   EnsemblGenomes-Gn; EBG00001466655.
DR   EnsemblGenomes-Gn; EBG00001466656.
DR   EnsemblGenomes-Gn; EBG00001466657.
DR   EnsemblGenomes-Gn; EBG00001466658.
DR   EnsemblGenomes-Gn; EBG00001466659.
DR   EnsemblGenomes-Gn; EBG00001466660.
DR   EnsemblGenomes-Gn; EBG00001466661.
DR   EnsemblGenomes-Gn; EBG00001466662.
DR   EnsemblGenomes-Gn; EBG00001466663.
DR   EnsemblGenomes-Gn; EBG00001466664.
DR   EnsemblGenomes-Gn; EBG00001466665.
DR   EnsemblGenomes-Gn; EBG00001466666.
DR   EnsemblGenomes-Gn; EBG00001466667.
DR   EnsemblGenomes-Gn; EBG00001466668.
DR   EnsemblGenomes-Gn; EBG00001466669.
DR   EnsemblGenomes-Gn; EBG00001466670.
DR   EnsemblGenomes-Gn; EBG00001466671.
DR   EnsemblGenomes-Gn; EBG00001466672.
DR   EnsemblGenomes-Tr; CPR_0008-1.
DR   EnsemblGenomes-Tr; CPR_0009-1.
DR   EnsemblGenomes-Tr; CPR_0016-1.
DR   EnsemblGenomes-Tr; CPR_0017-1.
DR   EnsemblGenomes-Tr; CPR_0019-1.
DR   EnsemblGenomes-Tr; CPR_0020-1.
DR   EnsemblGenomes-Tr; CPR_0031-1.
DR   EnsemblGenomes-Tr; CPR_0035-1.
DR   EnsemblGenomes-Tr; CPR_0047-1.
DR   EnsemblGenomes-Tr; CPR_0071-1.
DR   EnsemblGenomes-Tr; CPR_0077-1.
DR   EnsemblGenomes-Tr; CPR_0078-1.
DR   EnsemblGenomes-Tr; CPR_0090-1.
DR   EnsemblGenomes-Tr; CPR_0095-1.
DR   EnsemblGenomes-Tr; CPR_0191-1.
DR   EnsemblGenomes-Tr; CPR_0228-1.
DR   EnsemblGenomes-Tr; CPR_0250-1.
DR   EnsemblGenomes-Tr; CPR_0263-1.
DR   EnsemblGenomes-Tr; CPR_0473-1.
DR   EnsemblGenomes-Tr; CPR_0559-1.
DR   EnsemblGenomes-Tr; CPR_0677-1.
DR   EnsemblGenomes-Tr; CPR_1372-1.
DR   EnsemblGenomes-Tr; CPR_1834-1.
DR   EnsemblGenomes-Tr; CPR_1864-1.
DR   EnsemblGenomes-Tr; CPR_1865-1.
DR   EnsemblGenomes-Tr; CPR_1866-1.
DR   EnsemblGenomes-Tr; CPR_1867-1.
DR   EnsemblGenomes-Tr; CPR_1958-1.
DR   EnsemblGenomes-Tr; CPR_2129-1.
DR   EnsemblGenomes-Tr; CPR_2130-1.
DR   EnsemblGenomes-Tr; CPR_2146-1.
DR   EnsemblGenomes-Tr; CPR_2147-1.
DR   EnsemblGenomes-Tr; CPR_2148-1.
DR   EnsemblGenomes-Tr; CPR_2149-1.
DR   EnsemblGenomes-Tr; CPR_2150-1.
DR   EnsemblGenomes-Tr; CPR_2151-1.
DR   EnsemblGenomes-Tr; CPR_2152-1.
DR   EnsemblGenomes-Tr; CPR_2211-1.
DR   EnsemblGenomes-Tr; CPR_2212-1.
DR   EnsemblGenomes-Tr; CPR_2213-1.
DR   EnsemblGenomes-Tr; CPR_2217-1.
DR   EnsemblGenomes-Tr; CPR_2218-1.
DR   EnsemblGenomes-Tr; CPR_2219-1.
DR   EnsemblGenomes-Tr; CPR_2220-1.
DR   EnsemblGenomes-Tr; CPR_2221-1.
DR   EnsemblGenomes-Tr; CPR_2222-1.
DR   EnsemblGenomes-Tr; CPR_2223-1.
DR   EnsemblGenomes-Tr; CPR_2224-1.
DR   EnsemblGenomes-Tr; CPR_2225-1.
DR   EnsemblGenomes-Tr; CPR_2226-1.
DR   EnsemblGenomes-Tr; CPR_2227-1.
DR   EnsemblGenomes-Tr; CPR_2228-1.
DR   EnsemblGenomes-Tr; CPR_2229-1.
DR   EnsemblGenomes-Tr; CPR_2230-1.
DR   EnsemblGenomes-Tr; CPR_2231-1.
DR   EnsemblGenomes-Tr; CPR_2232-1.
DR   EnsemblGenomes-Tr; CPR_2233-1.
DR   EnsemblGenomes-Tr; CPR_2234-1.
DR   EnsemblGenomes-Tr; CPR_2235-1.
DR   EnsemblGenomes-Tr; CPR_2236-1.
DR   EnsemblGenomes-Tr; CPR_2237-1.
DR   EnsemblGenomes-Tr; CPR_2305-1.
DR   EnsemblGenomes-Tr; CPR_2306-1.
DR   EnsemblGenomes-Tr; CPR_2307-1.
DR   EnsemblGenomes-Tr; CPR_2308-1.
DR   EnsemblGenomes-Tr; CPR_2312-1.
DR   EnsemblGenomes-Tr; CPR_2313-1.
DR   EnsemblGenomes-Tr; CPR_2314-1.
DR   EnsemblGenomes-Tr; CPR_2315-1.
DR   EnsemblGenomes-Tr; CPR_2316-1.
DR   EnsemblGenomes-Tr; CPR_2417-1.
DR   EnsemblGenomes-Tr; CPR_2454-1.
DR   EnsemblGenomes-Tr; CPR_2455-1.
DR   EnsemblGenomes-Tr; CPR_2458-1.
DR   EnsemblGenomes-Tr; CPR_2459-1.
DR   EnsemblGenomes-Tr; CPR_2460-1.
DR   EnsemblGenomes-Tr; CPR_2466-1.
DR   EnsemblGenomes-Tr; CPR_2476-1.
DR   EnsemblGenomes-Tr; CPR_2477-1.
DR   EnsemblGenomes-Tr; CPR_2478-1.
DR   EnsemblGenomes-Tr; CPR_2479-1.
DR   EnsemblGenomes-Tr; CPR_2480-1.
DR   EnsemblGenomes-Tr; CPR_2481-1.
DR   EnsemblGenomes-Tr; CPR_2482-1.
DR   EnsemblGenomes-Tr; CPR_2624-1.
DR   EnsemblGenomes-Tr; CPR_2625-1.
DR   EnsemblGenomes-Tr; CPR_2626-1.
DR   EnsemblGenomes-Tr; CPR_2627-1.
DR   EnsemblGenomes-Tr; CPR_2628-1.
DR   EnsemblGenomes-Tr; CPR_2629-1.
DR   EnsemblGenomes-Tr; CPR_2630-1.
DR   EnsemblGenomes-Tr; CPR_2631-1.
DR   EnsemblGenomes-Tr; CPR_2632-1.
DR   EnsemblGenomes-Tr; CPR_2633-1.
DR   EnsemblGenomes-Tr; EBT00001620434.
DR   EnsemblGenomes-Tr; EBT00001620435.
DR   EnsemblGenomes-Tr; EBT00001620437.
DR   EnsemblGenomes-Tr; EBT00001620438.
DR   EnsemblGenomes-Tr; EBT00001620439.
DR   EnsemblGenomes-Tr; EBT00001620440.
DR   EnsemblGenomes-Tr; EBT00001620442.
DR   EnsemblGenomes-Tr; EBT00001620443.
DR   EnsemblGenomes-Tr; EBT00001620445.
DR   EnsemblGenomes-Tr; EBT00001620446.
DR   EnsemblGenomes-Tr; EBT00001620447.
DR   EnsemblGenomes-Tr; EBT00001620449.
DR   EnsemblGenomes-Tr; EBT00001620451.
DR   EnsemblGenomes-Tr; EBT00001620452.
DR   EnsemblGenomes-Tr; EBT00001620454.
DR   EnsemblGenomes-Tr; EBT00001620455.
DR   EnsemblGenomes-Tr; EBT00001620456.
DR   EnsemblGenomes-Tr; EBT00001620458.
DR   EnsemblGenomes-Tr; EBT00001620459.
DR   EnsemblGenomes-Tr; EBT00001620461.
DR   EnsemblGenomes-Tr; EBT00001620462.
DR   EnsemblGenomes-Tr; EBT00001620464.
DR   EnsemblGenomes-Tr; EBT00001620465.
DR   EnsemblGenomes-Tr; EBT00001620467.
DR   EnsemblGenomes-Tr; EBT00001620468.
DR   EnsemblGenomes-Tr; EBT00001620470.
DR   EnsemblGenomes-Tr; EBT00001620471.
DR   EnsemblGenomes-Tr; EBT00001620473.
DR   EnsemblGenomes-Tr; EBT00001620474.
DR   EnsemblGenomes-Tr; EBT00001620476.
DR   EnsemblGenomes-Tr; EBT00001620477.
DR   EnsemblGenomes-Tr; EBT00001620479.
DR   EnsemblGenomes-Tr; EBT00001620480.
DR   EnsemblGenomes-Tr; EBT00001620482.
DR   EnsemblGenomes-Tr; EBT00001620484.
DR   EnsemblGenomes-Tr; EBT00001620485.
DR   EnsemblGenomes-Tr; EBT00001620487.
DR   EnsemblGenomes-Tr; EBT00001620488.
DR   EnsemblGenomes-Tr; EBT00001620490.
DR   EnsemblGenomes-Tr; EBT00001620491.
DR   EnsemblGenomes-Tr; EBT00001620493.
DR   EnsemblGenomes-Tr; EBT00001620494.
DR   EnsemblGenomes-Tr; EBT00001620496.
DR   EnsemblGenomes-Tr; EBT00001620497.
DR   EnsemblGenomes-Tr; EBT00001620499.
DR   EnsemblGenomes-Tr; EBT00001620501.
DR   EnsemblGenomes-Tr; EBT00001620502.
DR   EnsemblGenomes-Tr; EBT00001620504.
DR   EnsemblGenomes-Tr; EBT00001620505.
DR   EnsemblGenomes-Tr; EBT00001620507.
DR   EnsemblGenomes-Tr; EBT00001620508.
DR   EnsemblGenomes-Tr; EBT00001620510.
DR   EnsemblGenomes-Tr; EBT00001620512.
DR   EnsemblGenomes-Tr; EBT00001620513.
DR   EnsemblGenomes-Tr; EBT00001620515.
DR   EnsemblGenomes-Tr; EBT00001620517.
DR   EnsemblGenomes-Tr; EBT00001620518.
DR   EnsemblGenomes-Tr; EBT00001620520.
DR   EnsemblGenomes-Tr; EBT00001620522.
DR   EnsemblGenomes-Tr; EBT00001620523.
DR   EnsemblGenomes-Tr; EBT00001620524.
DR   EnsemblGenomes-Tr; EBT00001620526.
DR   EnsemblGenomes-Tr; EBT00001620527.
DR   EnsemblGenomes-Tr; EBT00001620529.
DR   EnsemblGenomes-Tr; EBT00001620530.
DR   EnsemblGenomes-Tr; EBT00001620532.
DR   EnsemblGenomes-Tr; EBT00001620533.
DR   EnsemblGenomes-Tr; EBT00001620534.
DR   EnsemblGenomes-Tr; EBT00001620536.
DR   EnsemblGenomes-Tr; EBT00001620537.
DR   EnsemblGenomes-Tr; EBT00001620539.
DR   EnsemblGenomes-Tr; EBT00001620540.
DR   EnsemblGenomes-Tr; EBT00001620541.
DR   EnsemblGenomes-Tr; EBT00001620543.
DR   EnsemblGenomes-Tr; EBT00001620544.
DR   EnsemblGenomes-Tr; EBT00001620546.
DR   EnsemblGenomes-Tr; EBT00001620548.
DR   EnsemblGenomes-Tr; EBT00001620549.
DR   EnsemblGenomes-Tr; EBT00001620550.
DR   EnsemblGenomes-Tr; EBT00001620551.
DR   EnsemblGenomes-Tr; EBT00001620552.
DR   EnsemblGenomes-Tr; EBT00001620553.
DR   EnsemblGenomes-Tr; EBT00001620554.
DR   EnsemblGenomes-Tr; EBT00001620555.
DR   EnsemblGenomes-Tr; EBT00001620556.
DR   EnsemblGenomes-Tr; EBT00001620557.
DR   EnsemblGenomes-Tr; EBT00001620558.
DR   EnsemblGenomes-Tr; EBT00001620559.
DR   EnsemblGenomes-Tr; EBT00001620560.
DR   EnsemblGenomes-Tr; EBT00001620561.
DR   EnsemblGenomes-Tr; EBT00001620562.
DR   EnsemblGenomes-Tr; EBT00001620563.
DR   EnsemblGenomes-Tr; EBT00001620564.
DR   EnsemblGenomes-Tr; EBT00001620565.
DR   EnsemblGenomes-Tr; EBT00001620566.
DR   EnsemblGenomes-Tr; EBT00001620567.
DR   EnsemblGenomes-Tr; EBT00001620568.
DR   EnsemblGenomes-Tr; EBT00001620569.
DR   EnsemblGenomes-Tr; EBT00001620570.
DR   EnsemblGenomes-Tr; EBT00001620571.
DR   EnsemblGenomes-Tr; EBT00001620572.
DR   EnsemblGenomes-Tr; EBT00001620573.
DR   EnsemblGenomes-Tr; EBT00001620574.
DR   EnsemblGenomes-Tr; EBT00001620575.
DR   EnsemblGenomes-Tr; EBT00001620576.
DR   EnsemblGenomes-Tr; EBT00001620577.
DR   EnsemblGenomes-Tr; EBT00001620578.
DR   EnsemblGenomes-Tr; EBT00001620579.
DR   EnsemblGenomes-Tr; EBT00001620580.
DR   EnsemblGenomes-Tr; EBT00001620581.
DR   EnsemblGenomes-Tr; EBT00001620582.
DR   EnsemblGenomes-Tr; EBT00001620583.
DR   EnsemblGenomes-Tr; EBT00001620584.
DR   EnsemblGenomes-Tr; EBT00001620585.
DR   EnsemblGenomes-Tr; EBT00001620586.
DR   EnsemblGenomes-Tr; EBT00001620587.
DR   EnsemblGenomes-Tr; EBT00001620588.
DR   EnsemblGenomes-Tr; EBT00001620589.
DR   EnsemblGenomes-Tr; EBT00001620590.
DR   EnsemblGenomes-Tr; EBT00001620591.
DR   EnsemblGenomes-Tr; EBT00001620592.
DR   EnsemblGenomes-Tr; EBT00001620593.
DR   EnsemblGenomes-Tr; EBT00001620594.
DR   EnsemblGenomes-Tr; EBT00001620595.
DR   EnsemblGenomes-Tr; EBT00001620596.
DR   EnsemblGenomes-Tr; EBT00001620597.
DR   EnsemblGenomes-Tr; EBT00001620598.
DR   EnsemblGenomes-Tr; EBT00001620599.
DR   EnsemblGenomes-Tr; EBT00001620600.
DR   EnsemblGenomes-Tr; EBT00001620601.
DR   EnsemblGenomes-Tr; EBT00001620602.
DR   EnsemblGenomes-Tr; EBT00001620603.
DR   EnsemblGenomes-Tr; EBT00001620604.
DR   EnsemblGenomes-Tr; EBT00001620605.
DR   EnsemblGenomes-Tr; EBT00001620606.
DR   EnsemblGenomes-Tr; EBT00001620607.
DR   EnsemblGenomes-Tr; EBT00001620608.
DR   EnsemblGenomes-Tr; EBT00001620609.
DR   EnsemblGenomes-Tr; EBT00001620610.
DR   EnsemblGenomes-Tr; EBT00001620611.
DR   EnsemblGenomes-Tr; EBT00001620612.
DR   EnsemblGenomes-Tr; EBT00001620613.
DR   EnsemblGenomes-Tr; EBT00001620614.
DR   EnsemblGenomes-Tr; EBT00001620615.
DR   EnsemblGenomes-Tr; EBT00001620616.
DR   EnsemblGenomes-Tr; EBT00001620617.
DR   EnsemblGenomes-Tr; EBT00001620618.
DR   EnsemblGenomes-Tr; EBT00001620619.
DR   EnsemblGenomes-Tr; EBT00001620620.
DR   EnsemblGenomes-Tr; EBT00001620621.
DR   EnsemblGenomes-Tr; EBT00001620622.
DR   EuropePMC; PMC1524862; 16825665.
DR   EuropePMC; PMC2682570; 19479065.
DR   EuropePMC; PMC3457471; 22865060.
DR   EuropePMC; PMC4747519; 26859667.
DR   EuropePMC; PMC5964661; 29788909.
DR   EuropePMC; PMC6604940; 31294226.
DR   GOA; Q0SQH5.
DR   InterPro; IPR015856; ABC_transpr_CbiO/EcfA_su.
DR   InterPro; IPR030947; EcfA_1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000312.
DR   SILVA-SSU; CP000312.
DR   UniProtKB/Swiss-Prot; Q0SQH5; ECFA1_CLOPS.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2897393
FT                   /organism="Clostridium perfringens SM101"
FT                   /strain="SM101"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:289380"
FT   gene            236..1609
FT                   /gene="dnaA"
FT                   /locus_tag="CPR_0001"
FT   CDS_pept        236..1609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CPR_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P05648; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   PF08299; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87257"
FT                   /db_xref="GOA:Q0SWX6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWX6"
FT                   /protein_id="ABG87257.1"
FT                   /translation="MDAQLNNLWEQALNIIKGEISEISFNTWIKSCTPISISDNILKLS
FT                   VPNEFTKGILDTRYKDLLIQALKIVTSRKFKIEFYLESDLEEEKENEEKQKEEKKDNTN
FT                   DVDGSIVVSDEMSATLNPKYTFQSFVIGNSNRFAHAASLAVAESPAKAYNPLFIYGGVG
FT                   LGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKDDKNEEFRNKYRKVDVLLI
FT                   DDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFEWGLIAD
FT                   IQPPDFETRMAILKKKADVEGLSVPNEVMVYIATKIKSNIRELEGALIRIIAYSSLTNR
FT                   DVSVDLASEALKDIISNKESAPVTVKTIQESVANYYNLRIEDLKSQRRTRNIAYPRQIA
FT                   MYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDITKKLTQK"
FT   gene            1903..3003
FT                   /gene="dnaN"
FT                   /locus_tag="CPR_0002"
FT   CDS_pept        1903..3003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CPR_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P05649; match to
FT                   protein family HMM PF00712; match to protein family HMM
FT                   PF02767; match to protein family HMM PF02768; match to
FT                   protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86977"
FT                   /db_xref="GOA:Q0SWX7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX7"
FT                   /protein_id="ABG86977.1"
FT                   /translation="MIFTCDKNKLQESIAIAQKAITGKSTMPILEGLYIEASENIVTII
FT                   GSDKDVSIETKFEADVTEPGKLVVDAKIFGEIIRKLPNDKIKIETVSEEAIRITCQKSV
FT                   FDLLHMNAEDFPSLPKINENMIFSINQGILKNMIKGTSFAIAQDETRPILQGILFEIKD
FT                   SKLNLVALDGYRLAIRTENIDTNNTINAVIPGKTLNEVAKILEDSEEIVNITFTPNHIL
FT                   FNMGDTKVISRLLEGEFIKYDALLPKEHKLQIEVDKQTLQNGIERASLMAKEGNSNLVK
FT                   FDITDENIVITSNSQLGKVREEVTIKLQGDEIQIAFNSKYLLDVLKNMEEDKIELRMTS
FT                   SISPCIIRNKNNDLCEYLVLPVRIAR"
FT   gene            3129..3335
FT                   /locus_tag="CPR_0003"
FT   CDS_pept        3129..3335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0003"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86395"
FT                   /db_xref="GOA:Q0SWY2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY2"
FT                   /protein_id="ABG86395.1"
FT                   /translation="MQEVKINTEFIKLDSFLKWCGAVSLGSEAKMFIMDGEVLVNGEVC
FT                   TQRGKKLRVDDTVEFNGEIYKLI"
FT   gene            3391..4476
FT                   /gene="recF"
FT                   /locus_tag="CPR_0004"
FT   CDS_pept        3391..4476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CPR_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P05651; match to
FT                   protein family HMM PF02463; match to protein family HMM
FT                   TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86190"
FT                   /db_xref="GOA:Q0SWY1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWY1"
FT                   /protein_id="ABG86190.1"
FT                   /translation="MYIKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIYY
FT                   CGFAKSHRTNRDKELIEWNKDRAFIRLDVHKDRLDKIIDVNILKDGKKAISINSIKISK
FT                   IGELIGTFNVVMFSPEDLKIVKESPGIRRRFIDMELSQLNKRYYHNLVQYNKVLHERNL
FT                   VLKNKNINEEMLDIYDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKEITSGKEEIEFKY
FT                   ISTVKDLDNIKDSMIKLLEQNRKKDIDKRATSIGPHRDDFNIYLNNIDAKIYGSQGQQR
FT                   TSVLTIKFASLKIIKEITGEYPVLLLDDVLSELDFNRKRYVLTSIKNIQTVITCTGIED
FT                   LTSYLDENSKVFRVINGRIQC"
FT   gene            4490..4750
FT                   /locus_tag="CPR_0005"
FT   CDS_pept        4490..4750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E96900"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86345"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY0"
FT                   /protein_id="ABG86345.1"
FT                   /translation="MFLHLGENVVVPVKDVIGIFDIQTAMYSSDTIQFLRMAEEDGFVE
FT                   RITDEKPKSFVIAEIDKMSKVYLSPISSSTLTKRTDINYNP"
FT   gene            4987..6903
FT                   /gene="gyrB"
FT                   /locus_tag="CPR_0006"
FT   CDS_pept        4987..6903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CPR_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P05652; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87564"
FT                   /db_xref="GOA:Q0SWX9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX9"
FT                   /protein_id="ABG87564.1"
FT                   /translation="MLEQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYE
FT                   IVDNSIDEALAGYCKNIKVYIHKDNSITVVDDGRGMPVGIHPKMGKPTVEVIMTVLHAG
FT                   GKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLEKIGEA
FT                   EGSGTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEEVYHY
FT                   EGGIKSFVSYLNRNKEVLHDEPIYVEGLKDGIAVEVSLQYHDGFNENIFTFANNIDTVE
FT                   GGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISEPQFEGQT
FT                   KTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRARELTRKS
FT                   VLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEK
FT                   QRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFY
FT                   RYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDSSVNVQRYKGL
FT                   GEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRREFIQKNAKNVSN
FT                   LDI"
FT   gene            6925..9444
FT                   /gene="gyrA"
FT                   /locus_tag="CPR_0007"
FT   CDS_pept        6925..9444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CPR_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P05653; match to
FT                   protein family HMM PF00521; match to protein family HMM
FT                   PF03989; match to protein family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85405"
FT                   /db_xref="GOA:Q0SWX8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX8"
FT                   /protein_id="ABG85405.1"
FT                   /translation="MSLNEGKVIPIDINKEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMQELGLYPERGYRKCARIVGEVLGKYHPHGDSSVYDALVRMAQDFSLRYMLVD
FT                   GHGNFGSVDGDSAAAMRYTEAKMNKIASEMLRDINKNTVDFTPNFDGEEKEPVVLPSRY
FT                   PNLLVNGSSGIAVGMATNIPPHNLGEVIDGTIALIDNPELTSLELMTYIKGPDFPTAGI
FT                   IMGKSGIRAAYETGKGRIVVRAKAEIEEENGRHKIIVTELPYQVNKAKLIEYIADLVKD
FT                   KKITGISDLRDESDREGMRMVIELKRDANPNVTLNLLYKHTKMQDTFGVIMLALVDNQP
FT                   QILNLKQVLVHYINFQKDVITRRTQFELNKAKERAHILEGLIIALDNIDEVINIIRSSK
FT                   TSEIAKNTLIERFSLSEKQAAAILEMRLRRLTGLERDKIENEYNELMKLIDYLNAILAS
FT                   EERLLEVIKEELLEIKSKYSDERRTQIEKQENEIDIEDLIQEEDVVITLTHTGYIKRIS
FT                   SDVYSAQKRGGKGIQAMTTKEDDFVENVLVTSTHSNLLFFTTKGKVYKIKAYEVPDAGR
FT                   TAKGTNLVNILPLEADEKIQTVLSFKDVQEDGYLFMGTKLGIVKKTPLKDFKNIRKNGL
FT                   IALNLREGDELLRAKITYGDADIIFVTQDGNAIRFNETDVRPMGRTASGVKAISLREGD
FT                   VAVCMDIAVEDEKLLVVSENGYGKRTNLDEYKVQNRGGIGLITYKVSDKTGKVVGATVC
FT                   KEDDELMLINNQGVAIRINVSDISVTSRSAMGVKLMRTLEDEAVVTIAKISGDTNEEEE
FT                   EMTLLDEPEDTNIIVEEVATEVKDEEN"
FT   gene            14815..14891
FT                   /locus_tag="CPR_0008"
FT   tRNA            14815..14891
FT                   /locus_tag="CPR_0008"
FT                   /product="tRNA-Met"
FT   gene            14898..14973
FT                   /locus_tag="CPR_0009"
FT   tRNA            14898..14973
FT                   /locus_tag="CPR_0009"
FT                   /product="tRNA-Ala"
FT   gene            15246..15749
FT                   /locus_tag="CPR_0010"
FT   CDS_pept        15246..15749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34741.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85416"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX3"
FT                   /protein_id="ABG85416.1"
FT                   /translation="MSYRIKQFLWSISANFKELDYSYVRSILNDYEFSLFQRLKKGEQL
FT                   HSIKVSKDCVNLAKSKGINSESELKIFSKLGLLHDIGKLYYPLNIMTKSFLVLGKKISK
FT                   NRISKFQNIKPIYIYYNHGDKAFDYLREDDYDKEFVEAIRGHHSIKSSKNILLCILKEA
FT                   DDMN"
FT   gene            16163..18919
FT                   /locus_tag="CPR_0011"
FT   CDS_pept        16163..18919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0011"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:Q97N28; match to
FT                   protein family HMM PF03699"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86032"
FT                   /db_xref="GOA:Q0SWX2"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWX2"
FT                   /protein_id="ABG86032.1"
FT                   /translation="MKNKILNTVLISILLLVVVFFVSTNFIINVQWFKEVGYLNVFFTK
FT                   LIAICKLFVPIFILYFCVIAIYLFTLRKSIRSLVGDTKFKSVKKYFLLSNLVISILGAG
FT                   ATATTQWYKILQFTNAVPFGEVDPIFNKDISFYVFKLPLVQSLFSTAISLIIILVLITV
FT                   IIYLALGFKDKIYQNKDNVININSKTYGIRKFAGKQLAVLASVLSLLIGCSYLLKSYNL
FT                   VYSTRGVSYGAGYTDVKITMIFYKVIAIACVISSIVVFISILKLKFRPIIISIASIAVL
FT                   IVLEPVVAIFTQQFVVKPNEMELEKPYISYSIDATKKAFNIDEIEVKEMEPNENITSEK
FT                   LEDNKDIIENLKVNSTGPLLSFYQQVQLIKNYYEFNDADTDRYNINGKYTQVFVSPREI
FT                   NREAMTTWQNKHLRYTHGYGLAMSRVNSVTEFGQPDFVMKDIPTVNTTDINLENPRIYF
FT                   GESDNDYVIVNTEGGEFDYPTGDTENTFNYNGTGGLKMTPFNRVLFSIYERNPKILMSS
FT                   SITSESRIILNRNIVKRVQEIAPFLTYDSDPYIVVHDGRLVWMMNAYTSTDKYPFSEPH
FT                   EGVNYIRNSVKVVVDAFNGNVDFYVTDENDPIINCYLKIYKGLFKPLSEMPEDLKEHFR
FT                   YPQDLFELQSKVLTKYHVDDPIKLFTEEDLWDRSLDVVKHGGENLSQGDEGKEESILNK
FT                   AKENKNNEAENEGLYLMTKLPDEENVEMMLLDYFNMRGKQSMVALLGARMDGDNYGELV
FT                   MYKFPPQRTIYSPILFKNRIQQDPNISKEISLWAGKGSEVIYGDIIIVPIEDSLLYLNT
FT                   IYLKANSENSMPEMKRVILSNGDKIVIEENIEKALLKLFNYNSFEENKNSNKDETSNTE
FT                   ITSDNSGVKEAADLFNKAIEAQKNGDWATYGEFINKLGDVLNKMSHD"
FT   gene            19126..20520
FT                   /locus_tag="CPR_0012"
FT   CDS_pept        19126..20520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0012"
FT                   /product="BFD-like 2Fe-2S binding domain protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87215"
FT                   /db_xref="GOA:Q0SWX1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX1"
FT                   /protein_id="ABG87215.1"
FT                   /translation="MDYDVLILGGGIIGCSVAYELSKYNLNIALIEKDFDIADDVSFVN
FT                   TAIVYDGSECKDNLMSYLENMGNMMLPEITKKLNVPFKRVGHLTIADNDETVKIIEENY
FT                   KRAKSRGINNIYLIDEKRAREIEPNYKGEIKKAMYSENIAVTSPYDLAIGFAEIAYDNG
FT                   VSFRLEEIVLDIQSIAKGFKVTTNKNKFTCRFVINTTPGEHYTIDQDKDYEQKNALKTY
FT                   YLLLNDEIKEKTSNIVVKLKNEEEFIIQKNTVNGDTLIGINSNNSLGFMKSLKIAKEMI
FT                   NSISRKHVKDIFYDNHNQDRLIIDDSRKNKGYIKVMGNHYGEVTIAPAVSKIICDEIID
FT                   KLNCSLNKNFVDKRREFYRFRELSNDERNELISLDKRYGKIVCLCNGISEGEIVDCIRR
FT                   PLGARTVEGVKRRTGATFGTCHGAYCISKIINILARELEKKPTEIVEDSKNSKVLASRI
FT                   KEFDRV"
FT   gene            20533..20766
FT                   /locus_tag="CPR_0013"
FT   CDS_pept        20533..20766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34736.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87799"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX0"
FT                   /protein_id="ABG87799.1"
FT                   /translation="MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLY
FT                   VGVPTKSGNVVCKNIMNTGVDIICTKNLPKDS"
FT   gene            21118..22395
FT                   /gene="serS"
FT                   /locus_tag="CPR_0014"
FT   CDS_pept        21118..22395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CPR_0014"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by similarity to SP:P95689; match to
FT                   protein family HMM PF00587; match to protein family HMM
FT                   PF02403; match to protein family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85780"
FT                   /db_xref="GOA:Q0SWW9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWW9"
FT                   /protein_id="ABG85780.1"
FT                   /translation="MLDLKKLRSNTEEVKKALSNRGEDFDVNVIDEVIALDEERRKILV
FT                   DVEALKKQRNEVSAEIPKRKKAGEDVTEVMAEMREIGDKIKADDAKVAELNDKINYIML
FT                   RIPNIPNPAVPEGETDEDNVEIKRWGEPTKFNFEPKAHWDLGTDLDLLDFERGGKIAGS
FT                   RFTVYKGMGARLERSIINYFLDKHTFENGYTEVLPPYMVNRDSMTGTGQLPKFEEDAFK
FT                   VENNGYFLIPTAEVPVTNMYRNETLEGDKLPIKHAAYSACFRAEAGSAGRDTRGLIRQH
FT                   QFNKVELVKFCKPEQSYEELDKLVQDAESVLQGLGLPYRIVRICKGDLGFTAALKYDIE
FT                   VWMPSYNRYVEISSCSNFEDFQARRANIKYKNSPKEKPQFVHTLNGSGVAIGRTVAAIL
FT                   ENYQQEDGSVVIPEALKEYMRCDLLK"
FT   gene            22575..23003
FT                   /locus_tag="CPR_0015"
FT   CDS_pept        22575..23003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86567"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX5"
FT                   /protein_id="ABG86567.1"
FT                   /translation="MDNCKYNYKYNCECNLDKYEDNCNKCRKLEKIAEELTRESAELNE
FT                   AVEEKLEGVKYIQREIDELEERLECLRKKQKSLLCEAMELDEELDKTIFEAFKHLFATV
FT                   ECYKKCKNNERPERPEKPEKPEKPGRPGCGCKYCYKDR"
FT   gene            23343..23433
FT                   /locus_tag="CPR_0016"
FT   tRNA            23343..23433
FT                   /locus_tag="CPR_0016"
FT                   /product="tRNA-Ser"
FT   gene            23467..23557
FT                   /locus_tag="CPR_0017"
FT   tRNA            23467..23557
FT                   /locus_tag="CPR_0017"
FT                   /product="tRNA-Ser"
FT   gene            23816..24082
FT                   /locus_tag="CPR_0018"
FT   CDS_pept        23816..24082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87208"
FT                   /db_xref="GOA:Q0SWX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWX4"
FT                   /protein_id="ABG87208.1"
FT                   /translation="MKGSSGPVRAKKPKRSTAYTLSLYLGWSSIFAALYFFIVGLPFSI
FT                   PGIIAGYIAFKKHNEGKLPLILNIIGFLLTVFTWVLFMKIPLK"
FT   gene            24189..24279
FT                   /locus_tag="CPR_0019"
FT   tRNA            24189..24279
FT                   /locus_tag="CPR_0019"
FT                   /product="tRNA-Ser"
FT   gene            24285..24375
FT                   /locus_tag="CPR_0020"
FT   tRNA            24285..24375
FT                   /locus_tag="CPR_0020"
FT                   /product="tRNA-Ser"
FT   gene            complement(24413..24595)
FT                   /locus_tag="CPR_0021"
FT   CDS_pept        complement(24413..24595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86300"
FT                   /db_xref="GOA:Q0SWW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWW6"
FT                   /protein_id="ABG86300.1"
FT                   /translation="MDIFFYFIFFTFILYILLKEFFKKVFKEAFIELLNEDNEKLKLFI
FT                   KECLREHDFSKRNKN"
FT   gene            24844..25725
FT                   /locus_tag="CPR_0022"
FT   CDS_pept        24844..25725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO36323.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87591"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWW5"
FT                   /protein_id="ABG87591.1"
FT                   /translation="MKVEKLNDIKNNSKEIIFNSNSKIVLFSDCHRGDGTYKDSLAPNI
FT                   NIYLSAIRYYYKNKFTYIEVGDGDELWKFKNIQEIYDMNYEIYEVLEKFKEKKRLYMIY
FT                   GNHDKDKSKIKFLRKNKRRNRFNHSASDFYSTLNIYESLVLVHEESKKDFFVIHGHQID
FT                   FLNNELAFLSKFLVRYVWAILEAFMGFKDPTSPAKSNNKRNLFDEKISKWAEENKTRVI
FT                   LGHTHKTLFPKSRNESTYFNIGCCVLPRTITAIEIERGEISLIKWTIKADEKGSLFVGR
FT                   DIIGGPIRIENY"
FT   gene            complement(25815..25979)
FT                   /locus_tag="CPR_0023"
FT   CDS_pept        complement(25815..25979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85575"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWW8"
FT                   /protein_id="ABG85575.1"
FT                   /translation="MKIGDTFKKFMDTTAEIETKLGNPMACFLEEQEREEKEKKAHHKE
FT                   VKAKGKNDN"
FT   gene            26188..29664
FT                   /gene="addB"
FT                   /locus_tag="CPR_0024"
FT   CDS_pept        26188..29664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="CPR_0024"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /note="identified by similarity to SP:P23477; match to
FT                   protein family HMM TIGR02773"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86087"
FT                   /db_xref="GOA:Q0SWW7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWW7"
FT                   /protein_id="ABG86087.1"
FT                   /translation="MGLKIIYGRAGTGKSTFCINQIKKKINNSPTNKLILLVPEQFTFQ
FT                   TENKVLNAIGERYVLNAEVLSFKRLAHNVFNECGGATRTIMGDAGKSMLIFKVLEDLGD
FT                   NMTVFKNASRQKGFIDIASKTITEFKKYNVNNEVLDLTINEIEDENLKMKMEELKDVFN
FT                   EFNSRLHEGYVDEEDQLLLLNEKLDGCSLYDGAEIWIDEFSSFTPNQLSVIGKLLKKAK
FT                   SVNITLSIDEVNSPKVESDLFVATKNTEKRLMNLIQEEGIAFNGYINLNEDIPYRFKEN
FT                   KELAHIERQLYAYPFKQYRGENNSLRLYRANNNYDEIEFVAKDILRLVREKQYRFKDIS
FT                   VICREVDNYEKVISAIFAEYEIPYYIDKKIDIASNPLIVFINSAVDIISKNWTYESMFK
FT                   YLKTGLIKEFRGIEGAELIDELENYVLAYGIKGKKWMEEWVNYSSSILKEEEISEENKQ
FT                   RLERLNDIRETIVTPLDEFNKECKGKKTLKEFAIILYEFLDSKLNIMDTIDKYVEYFKE
FT                   NDMAIEAKEYSEVRDIFIDVLEQAVDVLGNEVMDLDEFMKVLNIGLSQYEMGLIPVALD
FT                   QVNIGDITRIKSRGTKALYIIGVNDGVLPSASKEEGILSDNDREILLEKGISLASDTRT
FT                   KIFEEQFLVYTAFTIAEEYLVVTYPLADFEGKSQRPSIIVHRLKKILPNVKEESEGFKL
FT                   VNDKYDKISAKIPTLNELMIAIRKNYDGAEIDDYWKYVYDWYLREPKWKERIEYVRKGL
FT                   EYTNLENNISKEKAKKLYEDNKNKISLSVSRLERYAQCPFAYYIQYGLKAKDRKIYEFT
FT                   APDLGSFMHEILDEFTNEIKEKDLKWSDLSKENCKNIINSLVDNQVKNNKSSILNSSKR
FT                   YSYFTDRFKRILTKSVMVISEQMKRSDFEIYKNELAFGFSKDVNSIKLDLPSGESFYLN
FT                   GRIDRIDKLNLDGETYLRIIDYKTGSKKFDLNKFYNGLQMQLLVYLDALINNSENIVEN
FT                   QAMPGAILYFRIDDPILKSKGDLTEEEIKSEILKELKLEGLLLDDVKVVKAMDNTLEPG
FT                   THSLIIPANMKKAGDLGKNKALITMEQFELLRKYVNEKMVEICQNMIEGKIDIEPCKEN
FT                   KNIVCDYCNYSHICQFDSSLEDNRYKVIPKKKDEDIWKSINEKVGGEVNGD"
FT   gene            29654..33466
FT                   /gene="addA"
FT                   /locus_tag="CPR_0025"
FT   CDS_pept        29654..33466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="CPR_0025"
FT                   /product="recombination helicase AddA"
FT                   /note="identified by similarity to SP:P23478; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   TIGR02785"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86634"
FT                   /db_xref="GOA:Q0SWW4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWW4"
FT                   /protein_id="ABG86634.1"
FT                   /translation="MGTKWTEEQELAINTRKCNLLVAAAAGSGKTAVLVERIIKMITEG
FT                   ENPVDIDKLLVVTFTNAAASEMRERIGDAISKALEKDPSSEVLQRQLALLNRASITTMH
FT                   SFCLEVIKNNFHLIDLDPGFRIGDQTECELIKQDILADLFEDMYAKDDECFKDLVEAYG
FT                   GSKSDDNLNSIILKFYNFIMSGPWPESWLKDKVEEFNINSIEELEGKKWIEVLKESIIL
FT                   DLNNAYSMLTQARDIAEMGGGLEPYLVNIYPEIIQVEELRIALSEGIVKFYNKLMGASF
FT                   GRLKSVRKASVDDEKALEKTKSLRDESKKIIENLRDNVFETSLEEAVLGMKKMYPLMKC
FT                   LSGLIIEFSNRYRDKKREKDILDFNDLEHLCLEILIDKDEEGNIKPSQVALEFKDKFEE
FT                   VLVDEYQDSNTIQETIVGMVSRRDVENPNVFMVGDVKQSIYKFRQANPELFLEKYINYR
FT                   EFEDSNRKIMLYKNFRSREEIINGVNYIFKTLMSNTVGELEYDEKEALNLGASYGELNE
FT                   ENVEKEYIDEIENLKVAGDIELNILNKAGNKDYSDDELGEEEEDLDSIQLEARIIGKKI
FT                   NELMNPEDGSHYMVFDKDLGKYRKIKYKDIVILLRATKNWADTFVDELGTYGIPVYADT
FT                   GTGYFQTIEIRTILALLHIIDNPMQDIYILSSLRSPIFSFTSEEFADLRLLNKDKYFFE
FT                   IIKEVVDGIYDESISKDLKGKCKYFLDYLNKWREKAAYMPIDEFIWFLYSDTSYYGYVG
FT                   TMPNGVQRQANLRILFQRAKQYESTSFKGLFNFINFINKLKKSSGDMGSAKILGENENV
FT                   VRIMSIHKSKGLEFPVVILGGTGKQFNKMDLREDILLHETLGIGTNCIDVKKRIKYDTL
FT                   QKHAIKKKCELEVLSEEMRILYVAFTRAKEKLIITGAVSDLEKSCENWCKASASSEDNR
FT                   INPGNVLKGKSYLDWIGMALTKHKDGDAIRNVGNGDITLNLDDKSNWSFKSFDRSELLE
FT                   TNNNKKEKNNIDIFESNNWIESKKDIKEVIEIRNRLGFKYKYIESCNTPSNISVTELKR
FT                   AHQEEEFMQESYNIIDNESSEENKKEKIKRKPRFMEERQEEFSAAKKGTITHFVMQHID
FT                   LDKVTYIDEIREEVLKMVKKELLTEEEGKVVNVFKIQKFFKSELGQRMLSSYKSGKKVY
FT                   RELPFITEIPSSIIEKNLDPKIYGEEKVRLQGIIDAFFEEEDGYVLLDYKTDYVKEGEE
FT                   EAFINKYKIQINLYKDTLNKILGEEVKEAYLYSFYLEKELKISKE"
FT   gene            complement(33505..34773)
FT                   /locus_tag="CPR_0026"
FT   CDS_pept        complement(33505..34773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0026"
FT                   /product="polyA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86854"
FT                   /db_xref="GOA:Q0SWW3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWW3"
FT                   /protein_id="ABG86854.1"
FT                   /translation="MKLPNNVQYILEKFDSNGFEAFIVGGCVRDSLLNKKPQDYDITTN
FT                   AFPEKIEELFDKTIPTGIKHGTVTVLIDKTPYEVTTYRVDGEYLNNRKPKDVKFVSNIE
FT                   EDLSRRDFTINAMAYSPYLGFKDCFNGKEDLKNKLIRCVGDPDKRFSEDALRMLRAIRF
FT                   SCQLNFKIEKLTAESIRKNFKLIKNISMERIQSEFTKIILSNEPDRGLMLLRKLGFSDF
FT                   LVKEFKNLKLINCYDLYDDIHDTYGLINSLPKKLHVRLAGLFYKVFNSENAVEKCRTIL
FT                   KKLKYDNNTINDTCNLVENINSISCNMTRKKLKLLINSVGTENIFDLLDLQKSYLSYMD
FT                   EYDTECIDILKNRVSDILASKEPIFIKDLAITGNDLITELNFKPGKNIGVILNFLLENV
FT                   MQTPELNNKEDLLNLSKQFYSYN"
FT   gene            34910..35881
FT                   /locus_tag="CPR_0027"
FT   CDS_pept        34910..35881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0027"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87418"
FT                   /db_xref="GOA:Q0SWU1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU1"
FT                   /protein_id="ABG87418.1"
FT                   /translation="MEIPVKKIGEFVKGERVEGFFLLKSVTLKTTNSGGKKYLDLVLSD
FT                   KTGDILGKVWEIKPEHEELKSNTVFKIRGTVNSWQGTLQLKVEHASKVTEEDNINLDDF
FT                   VQSAPYTSDEMFNTIKDTVDNMNDIDIKNILNRVLEINKDKLMYYPAAKSNHHSIKGGL
FT                   LYHITTMLKLAENICVIYDFLNRDLVYAGVILHDMAKIKEMSSNEMGIVDEYTLEGTLL
FT                   GHITQGIKEIEVIGKEVNADSKIIMLLQHMVLSHHYEPEYGSPVKPLIPEAEMLHYLDV
FT                   MDARMYDMKKAIKETKENEFSERIWSLDSRRIYNHGMYEKNN"
FT   gene            complement(35912..37072)
FT                   /locus_tag="CPR_0028"
FT   CDS_pept        complement(35912..37072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0028"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87814"
FT                   /db_xref="GOA:Q0SWU0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU0"
FT                   /protein_id="ABG87814.1"
FT                   /translation="MKNKKLLISISLSIFLLLIIVVSYFIFSYSNNLNKFKEDLSSNNY
FT                   EDAAYCFNNGTKSIILKKTFIKSSEDIITEKLSEIENEYYSGDISEEETVKDLNGLLSL
FT                   NTSNEEIFNFKNTIPLIKDSKDSFDIGISKLDEENYLEALNYFKSVHNLSDCKAQALEC
FT                   EETCLDKIREPILETVDEYISNEKYSKGIEYLDSKINSLPDDPKLQEKRDELENLRLEH
FT                   LEAYSQENIDKATARTAPVMEYYKKLNEDTINQFDITSNTNYLVFVNIAEQKTYVYEGS
FT                   KNDWTLDKTFTCSTGIEGKETPVGIFTVQTRAPWFFSPKYGQGGKYYVQFMGNYLFHSI
FT                   PFNSDKTTVSDPTLGVPASHGCIRLSVEDSKWLYDNVQNGSKIIIY"
FT   gene            37264..38484
FT                   /gene="pepT"
FT                   /locus_tag="CPR_0029"
FT   CDS_pept        37264..38484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="CPR_0029"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01882"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87285"
FT                   /db_xref="GOA:Q0SWT9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWT9"
FT                   /protein_id="ABG87285.1"
FT                   /translation="MKKVHERFLEYVKVDTKSDETTRVTPSTKGQLELGKILAEELKKI
FT                   GVDEVRISDKGYVYACLKSNCDKDIPKIGFISHMDTAPDMSGKNVNPKIVENYDGKDIE
FT                   LGNGYTLSPSFSPELPMYKGQTLITTDGTTLLGADDKAGVAEIITAIEYLINHPEIKHG
FT                   DIKIGFTPDEEIGEGADHFDVEGFGADFAYTLDGGRIGELEYENFNAASAKVEIIGKNV
FT                   HPGSAKGKMINSILVAHEFVSMLPLNEVPEKTEGYEGFSFLLDIQGEVEKTSLSFIIRD
FT                   FDKEGFKNRKERFNEIANELNKKYGEGTVTVTLKDQYMNMKEMIEPRMHIVETAEKAMK
FT                   QCGIEPIKKPIRGGTDGARLSFMGLPTPNIFTGGENFHGRYEYISVNSMEKAVEVILNI
FT                   IKIYAEK"
FT   gene            complement(38590..39465)
FT                   /locus_tag="CPR_0030"
FT   CDS_pept        complement(38590..39465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0030"
FT                   /product="degV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87241"
FT                   /db_xref="GOA:Q0SWT8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT8"
FT                   /protein_id="ABG87241.1"
FT                   /translation="MKKFVLFTDSAADLPKSMVKDLDINYLGLICNIDNTEYIDNIDSE
FT                   LTPKAFYNKLREGIMPSTSQINSFRFVEAFEEYVKQGISILYLAFSSALSGTYNSSLIA
FT                   REELLEKYPDADIKIVDTRAACLGQGLLVYYATQMKKDGKSIDEIYSWVEENKNKLCHY
FT                   FTVDSLDHLKRGGRISSTAAAIGSLLSIKPMLYVNDAGELHNFAKAKGRKKSLKMLFQE
FT                   LEKRIVNPNEQTIFIAHSDCIEDAETLAEMIREKYPVKDILIDYIGIVIGSHTGIGTLA
FT                   VFFLGDTKEP"
FT   gene            39655..39731
FT                   /locus_tag="CPR_0031"
FT   tRNA            39655..39731
FT                   /locus_tag="CPR_0031"
FT                   /product="tRNA-Arg"
FT   gene            39903..41042
FT                   /locus_tag="CPR_0032"
FT   CDS_pept        39903..41042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87388"
FT                   /db_xref="GOA:Q0SWT7"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR015093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT7"
FT                   /protein_id="ABG87388.1"
FT                   /translation="MNYDFIITILDEHNESSILLAEKLKPKEIIYLYKKDEELKVLNSL
FT                   RQFYLNKFPNCNFSDEKLGKDTISSIEEIIKRMKSKNTAICLNQGNKKDILIMYTLALK
FT                   HNIDGFFLDIPKEELLKLNLESVQCEKCNFVDLDVEDIIDSIGASIVVDSTEISEINII
FT                   ENMTNYIASNLDLWKKYKIRLSDNSVFIHDESNPRSIKIDKELLSREEVLLLDKILNFL
FT                   EKNGQIKVKELEQCLKVTFQNEFIKGFIFKSGTWLEVLTKNIIEEIKSIDDIKSGVLFL
FT                   WNDKESRVKNELDVVAIKDSVLICVSCKDSKKYDEVALNELNVYSEQLGGENVIKILVA
FT                   THPPIKSSISKRAKEMGINLVVFDGNKKAFKEELEKIIK"
FT   gene            complement(41233..42117)
FT                   /gene="psd"
FT                   /locus_tag="CPR_0033"
FT   CDS_pept        complement(41233..42117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="CPR_0033"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by similarity to SP:P10740; match to
FT                   protein family HMM PF02666; match to protein family HMM
FT                   TIGR00163"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86791"
FT                   /db_xref="GOA:Q0SWT6"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWT6"
FT                   /protein_id="ABG86791.1"
FT                   /translation="MIKIYNRKTKAYDVEQVAGLKYINWSYASPIGKSFLELFIKKKMF
FT                   SKLYGNFCDSPLSKKKIKAFIDEFNIDMSLCNKNIDEFENFNDFFARTLTPEARPIDYS
FT                   ENILISPGDGRLSAFENIDLDKVVQIKGYTYSLKELIDDPKVAEEFEGGTCLILRLCPT
FT                   DYHRFHFVDSGTCSESKKISGFYYSVNPIALNNVSELFCKNKREWSIFTSDNFGEILHV
FT                   EVGATCVGTILQTYSPEKRVKKGEEKGYFKFGGSTTILFFKKDTIKIDSDIVEQTKLGF
FT                   ETKVNMGETIGHK"
FT   gene            42280..42849
FT                   /locus_tag="CPR_0034"
FT   CDS_pept        42280..42849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0034"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86579"
FT                   /db_xref="GOA:Q0SWV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV8"
FT                   /protein_id="ABG86579.1"
FT                   /translation="MNRTKKAIFEAAINVFATSGYNGSTVDEIASKANVAKGTLYYNFK
FT                   SKEEIFNFVISKGLEIWHEKLTDIENLEDEPIEKLKKLFKMQFELLYENRAFFKMVMSQ
FT                   LWGKETRQDELRNKITEYIEGIERILKEAISKKQIRECDISLLAHSLFGSLISTSLYEL
FT                   SRDKEFNVNKVIDEITINILDGIVIK"
FT   gene            42904..42978
FT                   /locus_tag="CPR_0035"
FT   tRNA            42904..42978
FT                   /locus_tag="CPR_0035"
FT                   /product="tRNA-Arg"
FT   gene            43123..44388
FT                   /locus_tag="CPR_0036"
FT   CDS_pept        43123..44388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0036"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85355"
FT                   /db_xref="GOA:Q0SWV4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV4"
FT                   /protein_id="ABG85355.1"
FT                   /translation="MDPYTFQIVLLIILIILSGFFSASETALMALSRIRVRHMVDEEVK
FT                   GAKLLEKLLEDPNKLLGGILIGNNIVNIGASSLASTLAFRIFGDGGVALATGVMTILVL
FT                   IFGEITPKSLAKQNAEKVSLAVAPIINIVVTVFKPLVWLFSSVSSLIVRLLGGDLNKSE
FT                   PFITEEELKTMVDVSEEEGVLEVEEKEMIFNVFEFGDLQVKDIMVQRVNVIAVNVTATY
FT                   EEVLKVIKEQQFSRIPVYNESIDDIVGILNVKDLILLDSDEENFNVTEYMREPFRTFEF
FT                   KKITELFAEMKTTRNHIAVVLDEYGGTVGIVTIEDLIEEIVGDIEDEYDERDKDIEVIK
FT                   ENEFVVDGSTRLSDLSDMIGFEIESEEFDSIGGYVIGSLGRMPKVGEEIKTNDFRVIVE
FT                   ELDRNRVKKVRVYTYKREKEES"
FT   gene            44391..44822
FT                   /locus_tag="CPR_0037"
FT   CDS_pept        44391..44822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0037"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87578"
FT                   /db_xref="GOA:Q0SWV9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV9"
FT                   /protein_id="ABG87578.1"
FT                   /translation="MLSLALEEAEKAREKGEVPVGAVIVKNGEIIARAHNLKETLKDPT
FT                   AHAEILAIREACNKLNNWRLHGCEMYVTLEPCPMCAGAILQSRLSKIYIGTFDDTTGAA
FT                   GSVVNILQNHNLNYFLEVVWENDDKCSKILTNFFKDRRG"
FT   gene            44885..45343
FT                   /locus_tag="CPR_0038"
FT   CDS_pept        44885..45343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87037"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV7"
FT                   /protein_id="ABG87037.1"
FT                   /translation="MSKLDMMVGYEMNFYEKKFEENIKKLSYYMHRCFNETIGEKVAGI
FT                   AIEENLLYAWSYYFVTIADEDPKMGDRIMMGLINHFNTLLEDENVRINGKEGAKLMIDP
FT                   SFCRVWFGTSLNVMLVKKYGEEDYKEVFNYIKDNYLQKECKIRSLKVS"
FT   gene            45652..46257
FT                   /locus_tag="CPR_0039"
FT   CDS_pept        45652..46257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35771.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85683"
FT                   /db_xref="GOA:Q0SWV6"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV6"
FT                   /protein_id="ABG85683.1"
FT                   /translation="MLTIINIDVVHVTEAQSVKIETEEDIPIVSDVFITVDDAKKWAQG
FT                   KGATKEFVELADLYWEYSNEHGDVNPALAYVQAAKETAYGNFGGVLDASYHNPCGLKTN
FT                   KGGSDKDPKAHMKFKSWNEGVKAHLDHLALYAGAEGYPKAETKDPRHFASIFGKANSVI
FT                   DLSKNWAPSPTYGEEILGMYNEMMEGAGNRDIEVMNIF"
FT   gene            complement(46356..47828)
FT                   /locus_tag="CPR_0040"
FT   CDS_pept        complement(46356..47828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS42428.1; match to
FT                   protein family HMM PF02696"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86417"
FT                   /db_xref="GOA:Q0SWV5"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWV5"
FT                   /protein_id="ABG86417.1"
FT                   /translation="MDNKNFQSKTGFNLENTYLTLPNIFFSEQNPKGSKNPKLIKFNTS
FT                   LAKELGLNEEILNSDFGLNIFAGNETFPGITPIAQAYAGHQFGHFTMLGDGRALLLGEH
FT                   VTKDGKRYDVQLKGSGRTIYSRGGDGKAALAPMLREYIISEGMHSLGIPTTRSLAVVST
FT                   GEEVLREKFEQGAILTRIASSHIRVGTFAYAAQWGTLEDLKSLADYTIKRHFPNIANSE
FT                   NKYILFLEEVINRQAELIVKWQSVGFIHGVMNTDNMVISGETIDYGPCAFMDTYDTNTV
FT                   FSSIDYAGRYAYGNQPNMALWNLARFSEALLPLLNPNLDEAVNIAKKSISSFSKLYKKY
FT                   WFNKMRAKLGLFTKKENDELLIEGLLSTMQKYEADFTNTFVSLTLNKFEDEKVFSSNEF
FT                   KTWYALWKDRLKEENRPKEEVRNLMMNNNPYIIPRNHLVEEALKNAEKGDFTFMDNLLE
FT                   ALKNPYSYSKDLEKYTKLPEKSDIPYVTYCGT"
FT   gene            48157..49353
FT                   /gene="plc"
FT                   /locus_tag="CPR_0041"
FT   CDS_pept        48157..49353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plc"
FT                   /locus_tag="CPR_0041"
FT                   /product="phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by similarity to SP:P15310; match to
FT                   protein family HMM PF00882"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86694"
FT                   /db_xref="GOA:Q0SWV3"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="InterPro:IPR036392"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV3"
FT                   /protein_id="ABG86694.1"
FT                   /translation="MKRKICKALVCATLVTSLWAGVSTKVYAWDGKIDGTGTHAMIVTQ
FT                   GVSILENDMSKNEPESVRKNLEILKDNMHELQLGSTYPDYDKNAYDLYQDHFWDPDTNN
FT                   NFSKDNSWYLAYSIPDTGESQIRKFSALARYEWQRGNYKQATFYLGEAMHYFGDIDTPY
FT                   HPANVTAVDSAGHVKFETFAEERKEQYKINTVGCKTNEDFYADILKNKDFNAWSKEYAR
FT                   GFAKTGKSIYYSHASMSHSWDDWDYAAKVTLANSQKGTAGYIYRFLHDVSEGNDPSVGN
FT                   NVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMAGSKDTYTFKLK
FT                   DENLKIDDIQNMWIRKRKYTAFPDAYKPENIKVIANGKVVVDKDINEWISGNSTYNIK"
FT   gene            49541..50467
FT                   /locus_tag="CPR_0042"
FT   CDS_pept        49541..50467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0042"
FT                   /product="CobW/P47K family protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87735"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV2"
FT                   /protein_id="ABG87735.1"
FT                   /translation="MKVDIISGFLGAGKTTLIKKLLDTLVKAEKVAIVENEYGEVGIDG
FT                   DLLKDRRIEVKEINSGCICCTIKGDFKQNILDIISNYRPDRIIIEPSGVANFSQVLESI
FT                   KEAHIEGLRINMKITMVDAQNVHMYMKNFGDFYRSQLVNANTVILTRVEKLSDKEITHV
FT                   CNEIKTINNKANIITTELSKLSPERIIQVSEKKVENLIENINIKKPKRIGLRRVSAPEF
FT                   FENWGVETPKTFEYSELVKILNEFQNNKHGEVLRAKGIIKSKDNKWFKFDFVPNDISIV
FT                   NYKSDYTGRICVIGRNLNKDSIDKLFS"
FT   gene            50487..51071
FT                   /locus_tag="CPR_0043"
FT   CDS_pept        50487..51071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35532.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85986"
FT                   /db_xref="GOA:Q0SWV1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV1"
FT                   /protein_id="ABG85986.1"
FT                   /translation="MKKCSVDLITGFLSSGKTSFINHILDDFSKEEVLVIQCERGQEEL
FT                   IDCRKNINVKKFYSMDELKEEDLIRSIKFYAPKRVFIECNGVSETKKFIDKVTNSKLKE
FT                   YLKIGIIVNLIDMTTFNMFLKNIPSMIIPKISLSNLIVLNKCNEISGNALKEYKDMIER
FT                   FNHNAHIVNCIGKEGTNMNFNKERIINRMMG"
FT   gene            51074..51967
FT                   /locus_tag="CPR_0044"
FT   CDS_pept        51074..51967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0044"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF03773"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85408"
FT                   /db_xref="GOA:Q0SWV0"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWV0"
FT                   /protein_id="ABG85408.1"
FT                   /translation="MELLNKFSIVFSSIVIEALPFILIGAVLASFMQVYISNNIFNKII
FT                   SKNKLLGSIQAGIIGVFLPVCECATVPITKGLLNKKVPLNVAITYMLAAPIVNPLVILS
FT                   TYYAFDGNIKVVLLRVGVGFSIAVIAGLLMLCLSGENNIFIDNGEGELQGKCLCGCSEI
FT                   DDNSSKPIRLLKHTSLEFYEIGKYFIVGATLAAIFQTFVPRDIIFYFENSAVLSIIILM
FT                   AFSFLISLCSEADAFVASTFMNRFSLGSITGFLIIGPMIDLKNTIMLFSIFKKSFVIKL
FT                   LFVVFSLCFIASALIF"
FT   gene            51980..52699
FT                   /locus_tag="CPR_0045"
FT   CDS_pept        51980..52699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:C97096; match to
FT                   protein family HMM PF09323"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87050"
FT                   /db_xref="GOA:Q0SWU9"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU9"
FT                   /protein_id="ABG87050.1"
FT                   /translation="MRKFNFSEFIWFLILFCFEYLIVKMFMSEKIFLIISRDMKAYVIL
FT                   AIILLFLILVIQFFNIFKTSTRRNFKGGYLIFIFALVILNIANGLNINQVSLNLKGVKL
FT                   YHDRHKESEHNHMHSNEKLNSNEALVFTEKNFHSSLEELILHIEDFVGKEISIEGLLYV
FT                   SELYEKEEFAITQIDMTCCIADSVYLGVLCKGDLPDLKNGSEIKVKGLVESKKIKNSAG
FT                   EEIEIPFINVFYTDTLQ"
FT   gene            52966..53754
FT                   /gene="lgt_1"
FT                   /locus_tag="CPR_0046"
FT   CDS_pept        52966..53754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt_1"
FT                   /locus_tag="CPR_0046"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86550"
FT                   /db_xref="GOA:Q0SWU8"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU8"
FT                   /protein_id="ABG86550.1"
FT                   /translation="MNPVAFSIGSFEVRWYGIIIALGILIAMTLVSINAKKKNLNFDVI
FT                   LDLFLWCFPFAIIGARAYYVLFEFENYHSFWDMINIRQGGLAIHGGIIGAFLTAFIYCK
FT                   VKKVDFLAYADIVAPAFILAQGIGRWGNFFNQEAHGGQVTNEFISKFPEFIQRGMYING
FT                   AYYHPTFLYESIWDIFVAILLMIILYNITDRYKGVVISAYISLYSLGRFFIEGLRTDSL
FT                   YFMNIRVAQLVSLLGIIIGIVAIIIIVSRGKEKGKGIFIN"
FT   gene            54005..54094
FT                   /locus_tag="CPR_0047"
FT   tRNA            54005..54094
FT                   /locus_tag="CPR_0047"
FT                   /product="tRNA-Ser"
FT   gene            54526..55029
FT                   /locus_tag="CPR_0048"
FT   CDS_pept        54526..55029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0048"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85874"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT5"
FT                   /protein_id="ABG85874.1"
FT                   /translation="MVRKLLVGILWVTLSLFVLGCSTSGEKNTINIPIEKSMEEEKHKD
FT                   EEEYIDKISSTIVNMSVDGSIKNMRTVFETGKLNNTMIEQLEISNNFFKCLIEDLKGVN
FT                   VPEKFASYNDDIIDNLNKAKSSLEVMKNSHDEETIKSNAKIFIESNKDVSNLVDKILVY
FT                   YAGC"
FT   gene            55466..56752
FT                   /gene="brnQ_1"
FT                   /locus_tag="CPR_0049"
FT   CDS_pept        55466..56752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ_1"
FT                   /locus_tag="CPR_0049"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86672"
FT                   /db_xref="GOA:Q0SWT4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT4"
FT                   /protein_id="ABG86672.1"
FT                   /translation="MNKKKDILVIGFALFSIFFGAGNLIFPPYIGLTSGSEWLISFLGF
FT                   IISDVGIIFLSIVAVSKAGSFQGVVGRAGKKFGLSLEILMMLCLGPILVVPRTAATTFE
FT                   MSISPLLGNINPYLFSVIFFLIVFVLTIKPNKVMDIIGKVLTPLLLISLAVLIIKGIIN
FT                   PIGELEKVNSGKLFMTGITQGYQTMDALGTGGIVALVMASFASKGYKDKKENRILTIKS
FT                   ALIACIGLAIVYGGLTFLGATSSTLYDSSISQTTLLMNITNAILGSTGTIMLAIVIGLA
FT                   CLTTAVGLTSVTAKYFEDVSNKKLKYKYIVIAICVFSALASNLGVDKIIEIAVPVLSLI
FT                   YPISILLVVMNIFEKFIPNDVVVKGATYATLLISLLTVIDSLGIKFEFVHKLPLANLGF
FT                   NWVVPAIVGGLIAGLVFRKREVVSLEENC"
FT   gene            57053..57856
FT                   /locus_tag="CPR_0050"
FT   CDS_pept        57053..57856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0050"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86282"
FT                   /db_xref="GOA:Q0SWT3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT3"
FT                   /protein_id="ABG86282.1"
FT                   /translation="MKYYFKNELKRALFGKNAIISFSITLGILIAAFMKEFGFESIKYI
FT                   SQYPTFDAIDALLIVMSSNIVIVFPLLATIIFSDSYLQEKESGFTKFIYTRMPLKKYVS
FT                   IKVIVNSISSALVAGASSLFMLIFLVVAVGIRNPQIASYTNNINGPLSYLLDSRDTRLI
FT                   YALIIILLFSIAYMVTATLALGISAWVKNRYLVLITPFFYYIFCGTIVERLGINRIFDF
FT                   HLARVISLKRSMTTLPNVVIYPLLIFIVGVALFYIGVVIKNEKDL"
FT   gene            57840..58637
FT                   /locus_tag="CPR_0051"
FT   CDS_pept        57840..58637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0051"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85898"
FT                   /db_xref="GOA:Q0SWT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT2"
FT                   /protein_id="ABG85898.1"
FT                   /translation="MKRIYNYISFKIHSTKLLIFFTILVIYQFSLLLSLIFEGKSYTVY
FT                   DFIWSNFSYLTLFYFTSLIFLIMIYNIFEKKNFYNYLSIKFASRQEMYIANILTALIFS
FT                   IIFLMAINIISILMGSFMSFNNSWSEYFFSTSSNKVNLAFAEDTIKLVTESLTPLSYVF
FT                   ITNIFVILYLVFISILFIVFNLIFKKRALSFILIIILNGINMAMDNSRFLFTNNIYILN
FT                   SKAIEVTNGTYIISRLCYWIILILLVSFIGFILTKKKDCNFGD"
FT   gene            58640..59392
FT                   /locus_tag="CPR_0052"
FT   CDS_pept        58640..59392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0052"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86491"
FT                   /db_xref="GOA:Q0SWT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT1"
FT                   /protein_id="ABG86491.1"
FT                   /translation="MKKYLNIISNNLRSIFSIKNLIFIIVIFIYVFSVKINNYDSNFSF
FT                   NEILEVIFAGPINLDNISEIFTWTFYQAFLIYIIGNYIFNELSTRSIYVIPRLGNKQYW
FT                   NICLQITCFLACIIYFTLGTFIEFIFTAILNKGFNFSNIIDTLQIVVLLSLSSYYAITV
FT                   YIFNIMVTKSHIKSFLILIVEFYVSISIGNIFNIDKFIPLNQGILSKHIIYNFSYNWSF
FT                   IFLGILIFINLVIINRLIVKRDLLDITY"
FT   gene            59420..60064
FT                   /locus_tag="CPR_0053"
FT   CDS_pept        59420..60064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0053"
FT                   /product="antibiotic ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86941"
FT                   /db_xref="GOA:Q0SWT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWT0"
FT                   /protein_id="ABG86941.1"
FT                   /translation="MGNRNVVEISNLTKDIKGTKVLNKVNLQLESGKAYGIVGRNGSGK
FT                   SMLFKAICGLINTTEGSITVFDKVIKNGSFPDDVGMIIENPGFLLQYSAFKNLKILASI
FT                   NNKISDERIKETIALVGLDPEDKKIVKKFSLGMKQRLGIAQALMENPKLLILDEPMNGL
FT                   DSEGVKQIREILLKLKSNSVTILLASHNSDDIDEICDCVYTMENGVLSARI"
FT   gene            complement(60140..60625)
FT                   /gene="folA"
FT                   /locus_tag="CPR_0054"
FT   CDS_pept        complement(60140..60625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="CPR_0054"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86846"
FT                   /db_xref="GOA:Q0SWS9"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS9"
FT                   /protein_id="ABG86846.1"
FT                   /translation="MFSIIVAKSINNIIGVNNKIPWNIPSDLKRFKELTMGKKILMGRK
FT                   TFESLPFVLPGRTHLVLTTKKDFSYNHKDVIIYNDLDKLISEYKDSMEEIFVIGGGKIY
FT                   SEFLKYASKLYITEVLKEYKGDTYFPKVDYSKWIKTYESSIYEENATKFKYVIYEIL"
FT   gene            60816..62459
FT                   /gene="dnaX"
FT                   /locus_tag="CPR_0055"
FT   CDS_pept        60816..62459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="CPR_0055"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P09122; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF06144; match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87544"
FT                   /db_xref="GOA:Q0SWS8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS8"
FT                   /protein_id="ABG87544.1"
FT                   /translation="MAYKALYREWRPQTFNDVVGQEHITTTLKNQIINERTAHAYLFCG
FT                   TRGTGKTSTAKVMAKALNCLDLKDGEPCNQCEMCKKINEGLAIDITELDAASNNGVDNI
FT                   RDIIDDVQYPPQEARFKVYIMDEVHMLSIGAVNAFLKTLEEPPKNVVFILATTDPQKLP
FT                   ITILSRCQRFDFKRISRKDITGRLRKIVTEQGIFCDDKSLDLVARVSDGAMRDSLSILD
FT                   QAISIGDGKVDYDELVSMLGLVTNDNLFKIVDSIIKRDIESAMEIIEELVLTGKDMTLF
FT                   IKDLIVHYRNLLMIKVTSNPEEVLDTAEENIEKLKVQGAKLKVEEIMRCIRIVQECDEE
FT                   AKLSKQARVYLELAVIKMCKIEYDTSKEVMLARINKLEQAIRSGNIQVNTNLEEVKSQV
FT                   SNEASNNKTLNNKQQNVIKSSNNYEVVNENSTLTPEYLRKVWKDILETFKSRGKYMVYI
FT                   ALAKGISKVSCNKGVVEFRYTYEYRHNKERLEKHDFSKIVNDIFSEVLKEPVRVVYSVE
FT                   QGTEEEKAEEADLEARLSGIMGDGLEIVEE"
FT   gene            62571..62909
FT                   /locus_tag="CPR_0056"
FT   CDS_pept        62571..62909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0056"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by similarity to SP:Q97MR5; match to
FT                   protein family HMM PF02575; match to protein family HMM
FT                   TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85359"
FT                   /db_xref="GOA:Q0SWS7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWS7"
FT                   /protein_id="ABG85359.1"
FT                   /translation="MARGGFPGGMGNMNNLMKQAQMLQKQMQSMQEEIEASEFEGSAGG
FT                   GAVVAKVNGKKELIALNIKPEVVDPDDVEMLEDLVFSAVKQALEKASEETSEKMGKLTG
FT                   GMGMPGLF"
FT   gene            63007..63603
FT                   /gene="recR"
FT                   /locus_tag="CPR_0057"
FT   CDS_pept        63007..63603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CPR_0057"
FT                   /product="recombination protein RecR"
FT                   /note="identified by similarity to SP:P24277; match to
FT                   protein family HMM PF01751; match to protein family HMM
FT                   PF02132; match to protein family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86072"
FT                   /db_xref="GOA:Q0SWS6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWS6"
FT                   /protein_id="ABG86072.1"
FT                   /translation="MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEFA
FT                   NALVKARGTIKYCSVCGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFNGL
FT                   YHVLHGTISPMQGRGPQDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKILKPL
FT                   DVKVTRIAAGIPVGGDLEYADEVTLSKALEGRTVI"
FT   gene            63829..64107
FT                   /locus_tag="CPR_0058"
FT   CDS_pept        63829..64107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM23356.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87230"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU7"
FT                   /protein_id="ABG87230.1"
FT                   /translation="MDKKKISDYLIKKIDYSNEDEEILKAIEQTILEMEVARSAFQNAC
FT                   DDKLIESLIYKEQDINARYEYLIREAKKRGIKVSMEHIFKNARISII"
FT   gene            64123..64401
FT                   /gene="bofA"
FT                   /locus_tag="CPR_0059"
FT   CDS_pept        64123..64401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="CPR_0059"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="identified by match to protein family HMM PF07441;
FT                   match to protein family HMM TIGR02862"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87673"
FT                   /db_xref="GOA:Q0SWU6"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU6"
FT                   /protein_id="ABG87673.1"
FT                   /translation="MDIGALSLDDIILLIVGVLVAILILRLIFGSIGKIIGLVINSVFG
FT                   AILLMIVNYFGAYFGITIGINLLTALIAGILGIPGVVLMILFQVFVR"
FT   gene            64677..65807
FT                   /locus_tag="CPR_0060"
FT   CDS_pept        64677..65807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85672"
FT                   /db_xref="GOA:Q0SWU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU5"
FT                   /protein_id="ABG85672.1"
FT                   /translation="MKSNNLILDKYKSRGIRGLIVLGIAYFFLMGNYSMIRYFFQAGQG
FT                   DLDISIINKCFSMGSVDKFLLFLFLVWSVGFLFQDKEKELKENLAVGEENTKKYFFSKV
FT                   ILIYGVSLIPMLINIFIKLIFYIPYRNSFSLDKLIISFLYFIALGLLFTSIIFIMNLIV
FT                   KDRMFAGVFPIFFMEGLILIFSVSELLISDKLIWVRNSLGFIGEKVLLIFNLLNLNFDT
FT                   NSFYLGRQFIFIIILVLISVLLIYLSRLILKIMNFKYLYRPYFFEIPRYFIYISMSILI
FT                   GFVFVHAVGYLIIMFIPSVSYVNGTFMVNIASLISMVLLFIFLDVLYKRKILNKDLLED
FT                   DIKVCNEIQPCIGDFVILDKTTGFLDNKTIDKEENF"
FT   gene            65971..66150
FT                   /locus_tag="CPR_0061"
FT   CDS_pept        65971..66150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0061"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU4"
FT                   /protein_id="ABG87729.1"
FT                   /translation="MAVGTSINCKYCIDFKNDRCDGTEKNCLCRLCPRNLGQCICVKYC
FT                   RETESVLFWNDEEE"
FT   gene            66219..66401
FT                   /locus_tag="CPR_0062"
FT   CDS_pept        66219..66401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU3"
FT                   /protein_id="ABG86990.1"
FT                   /translation="MAISEEFIDIAENCVDYSARYREAVSSMNSCKSCLNCNEFHSGTC
FT                   EKEMENKFNILQDMI"
FT   gene            66565..67641
FT                   /locus_tag="CPR_0063"
FT   CDS_pept        66565..67641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0063"
FT                   /product="aminotransferase, class V"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86262"
FT                   /db_xref="GOA:Q0SWU2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWU2"
FT                   /protein_id="ABG86262.1"
FT                   /translation="MHKKLFIPGPVEVREEVLEKMATPMIGHRSKEASQLQRRISDNLR
FT                   KLFFTNNEILLSTTSGSGLMEGAIRSCTLKKAAVFSVGAFGDRWYEMGISNNVPVDKFE
FT                   VPWGKSINVDLIDSVLKTGQYDLITVTHNETSTGVMNDLEAISKVIRKYPEVIFCVDAV
FT                   SSAGGSKIEVDKLNIDICITSSQKALGLPPGISICTFSEKARERAEKVKFRGTYLDLLA
FT                   LYKYIKKKDYQYPSTPSISHMYALDYQLDYILNVEGLENRFNRHIEMAKIVREWAEKYF
FT                   EIYPEKGYYSNTLTTIKNNKNIDIGALNKELGKRGFQISNGYGKLKDKTFRIAHMADCQ
FT                   VKDIKELLSNINEILELE"
FT   gene            67711..68616
FT                   /locus_tag="CPR_0064"
FT   CDS_pept        67711..68616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0064"
FT                   /product="putative D-3-phosphoglycerate dehydrogenase"
FT                   /note="identified by similarity to SP:P35136; match to
FT                   protein family HMM PF00389; match to protein family HMM
FT                   PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87689"
FT                   /db_xref="GOA:Q0SPP0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SPP0"
FT                   /protein_id="ABG87689.1"
FT                   /translation="MLRILLNDGLDKKAISNLEMLGCDVDTNHYDIEDLKEKIKEVDCI
FT                   VIRSATKIRRELIDEAIKGGKLKLIIRGGVGLDNIDVKYAEQNGIKVRNTPNASSSSVA
FT                   EIILAHMFSLARFLNQSNITMKAGLWKKKEYVGVELEGKTLGIIGMGRIGSELAKKCTA
FT                   LGMKIIYFDLMDIKNIDNNYRKVEFDELLRESDFISINISGTKSIIGSEELKKVKKGAF
FT                   IINTSRGKALDEDAIITSLNDGTLGGIGLDVFLEEPSKNLELIKHPKVSLTPHIGASTK
FT                   EAQMKIGEEVINIIKEEMYK"
FT   gene            68750..70006
FT                   /locus_tag="CPR_0065"
FT   CDS_pept        68750..70006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:H96901; match to
FT                   protein family HMM PF06245"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85811"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SPN9"
FT                   /protein_id="ABG85811.1"
FT                   /translation="MVNIKAFKALRPRKDLVEKVAALPYDVLSRNEAKEEVKNNEFSFL
FT                   NIDKAETYFPENISEYSEEVYKKAGENLEKFIQNNIFIKEEKDCLYIYELDLDGKSQRG
FT                   IVSCLSVDDYLNNTIKKHEFTRAKKEEDRVKHIKACNAQTGPIFLTYRDSEKISNIVSK
FT                   IVLKKPLYDFISDDGVLHRVWKIDDKSIIDEIIKEFKEINSIYIADGHHRLEAAVKVCL
FT                   ERREKGECLPEDECNYFLGVLFPKTELTVIDYNRVVRDLNGLSEEEFLLKLEEKFQITK
FT                   LNKEDNPKPKHKGEFGMCINGDWFKLEYKDKNEISLIEKTKIDLVKNLDASILQDNILE
FT                   PILGIKDVRNDERIDFVGGIRGLKELERRVSEDMKVAFALYPTSLEEVMKISDKGLIMP
FT                   PKSTWFEPKLRSGIFIHKI"
FT   gene            complement(70062..70757)
FT                   /gene="mtnN"
FT                   /locus_tag="CPR_0066"
FT   CDS_pept        complement(70062..70757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="CPR_0066"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by similarity to SP:O32028; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86556"
FT                   /db_xref="GOA:Q0SPN8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SPN8"
FT                   /protein_id="ABG86556.1"
FT                   /translation="MTLGIIAAMSEELEILLKDMEVKSKETKANMTFHQGTLWGQEVVA
FT                   VVCGIGKVNAAVCTQILISEYKVDKVINVGVAGGIGMEIYPGDVVIGNSLVQYDMDTSA
FT                   FGDPIGQIPRLDTFDFKCSQELVDLCEEACKENEEIKSFTGRIVTGDQFVASVEKVKWL
FT                   EEEFGASACEMEGGSIAHVCYLNNIPFLVIRSISDNANNGAHMDFAEFTAIGVKNSTSI
FT                   LKSMILKMA"
FT   gene            71133..71894
FT                   /locus_tag="CPR_0067"
FT   CDS_pept        71133..71894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0067"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="VC2311; identified by match to protein family HMM
FT                   PF00899"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87376"
FT                   /db_xref="GOA:Q0SPN7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SPN7"
FT                   /protein_id="ABG87376.1"
FT                   /translation="MLQHSLSRTELLIGKDALDKLAKSKVMVFGVGGVGSFTVEALARA
FT                   GVGNLILVDDDTVCLTNLNRQIHATYKTISKNKVEVMKERVLSVNRNCNVETIQVFVTP
FT                   DNLEEIIPDDVDYVVDAIDTVSAKIALAVYCEQKGIKLMSSMGTGNKLNPAEFKVADIY
FT                   NTKVCPLAKVMRYELRKRGVKKLKVVYSEEMPRKPKVEDVVTCKTGCVCTGGTKKCSAK
FT                   RQIPGSVSFVPPVAGMIIASEVVKDLIKEYI"
FT   gene            72186..73361
FT                   /locus_tag="CPR_0068"
FT   CDS_pept        72186..73361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0068"
FT                   /product="major facilitator family transporter"
FT                   /note="probable CC1133; identified by match to protein
FT                   family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85545"
FT                   /db_xref="GOA:Q0SPN6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SPN6"
FT                   /protein_id="ABG85545.1"
FT                   /translation="MNSKKQNYVALAFLFIMMILAAIVENTKGIFIPVFKQEFGVNDNT
FT                   ISNLLISTSAAYMVLTFIGGMLCEKFGQKKVFLAGLMVIFLSLIFLSFTKNYLMLYTGM
FT                   VISSAGIAMVAISCNTVLPILALTAQNVIMNVMHACYGLGSSIGQGLFGSLTARGVNWR
FT                   TMYFFVGLVYLAVFICFIFVKIPRTEIVKEKDKMTIIEALSNKVIVAYMLALGLYVFTE
FT                   QGISNWFVNYMKYGYNINEQKAGMYLSLFFAIFTIGRLFGGFVVEKRGYFNILYKTLII
FT                   GAALCILGLLLGRNGMVIISVSGLFFSITFPTTVLTISKVFDKNVAYITGIVITSASLV
FT                   GMILNKAIGLLNESVGPDKAFYIIPASAILSAILMFYLYLNTKKRLVKQKI"
FT   gene            73377..74315
FT                   /locus_tag="CPR_0069"
FT   CDS_pept        73377..74315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0069"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86238"
FT                   /db_xref="GOA:Q0SWY7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY7"
FT                   /protein_id="ABG86238.1"
FT                   /translation="MSFDKNVFIEAIRGNDREYVVKDKVGIILGRFFLKDLDSKNKKVD
FT                   VKFKFYKEDNYKLMKETLRKILKVLFAEKDIYKINLFVSDIKNFNAYLDLGFMLEGILS
FT                   DNVCNNGIQKDEYIMGININDFNDKVKLVQFQLNTERLALRNLTPENTEEMLDYYIRNE
FT                   EHLRQYEPTRDSSFYTYEGQKEILTESFRQFIDGTSIDLGIFKDEKLIGKIKLSNIVYG
FT                   ILRNAFVGYSIDKEHQGKGYMKEALNTVCSYAFEEMGLHRLEASTLMDNSRSQGVLKAC
FT                   GFNELGISEKYLYINGEWRDHKIFYKVNDDL"
FT   gene            74407..75018
FT                   /gene="dGK2"
FT                   /locus_tag="CPR_0070"
FT   CDS_pept        74407..75018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dGK2"
FT                   /locus_tag="CPR_0070"
FT                   /product="deoxyguanosine kinase/deoxyadenosine kinase"
FT                   /EC_number="2.7.1.113"
FT                   /EC_number="2.7.1.76"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86799"
FT                   /db_xref="GOA:Q0SWY6"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY6"
FT                   /protein_id="ABG86799.1"
FT                   /translation="MIVVDGVVGVGKSTLMNILAERGLIAYEEPVVDNPILEKFYYDRN
FT                   RYSFPLQVFFLNKRFKHIKEAGLVENSVMDRSIYGDVIFAKMLCEKGEMTVEEFELYKE
FT                   LLENMLEHVKAPKLMVYLEISVDEAMKRIQKRGRDYEQVVEREYWEKLNNEYREYFENY
FT                   NVSPILRINVDELDFENIPEDREYVLNLIDEKLSELENNK"
FT   gene            80412..80487
FT                   /locus_tag="CPR_0071"
FT   tRNA            80412..80487
FT                   /locus_tag="CPR_0071"
FT                   /product="tRNA-Lys"
FT   gene            80628..81692
FT                   /locus_tag="CPR_0072"
FT   CDS_pept        80628..81692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0072"
FT                   /product="Bacterial extracellular solute-binding protein
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86592"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY5"
FT                   /protein_id="ABG86592.1"
FT                   /translation="MKGIKKILSLGLLLVFSFSMVSCGGSKENTLEDTVVVTSKYPDEV
FT                   NSYIAEEFKKETGISVKYEVKDEIKEDDFKNSNTDIILGGNSELYKKMASDNILKGYKT
FT                   SWYSDVDDNYRDKDGYWYSIFRNPMVVAYNKANLAANLVPKSLADLKNGNLANKLLMVN
FT                   SNNDYTKYFISATASYLTKEANNDDNIGNTFLQGVKLNVATFFNNYDELFTALDTKETP
FT                   IGILPLDVLNKKIKDNANITRIDFEEGVPVITECAGILKSAPNPNASELFMEFVAGPKI
FT                   QLELAQKFNIMPTLPVAIKYSPDWIKNFKTLDIENNVVLENEDKWVQFFNGVVKPEVPA
FT                   KTTNNPVIKGKKKS"
FT   gene            complement(81767..82069)
FT                   /locus_tag="CPR_0073"
FT   CDS_pept        complement(81767..82069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0073"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY4"
FT                   /protein_id="ABG87316.1"
FT                   /translation="MLVRCIDNSLCSSLTFGKEYVVIEEGDKYYVVVDDRNKEITTKKQ
FT                   RFEVIEDSDLAKKAKATINELNFQINNEFKDIKDFKVRTNSKGEIKEVIIKFKYE"
FT   gene            complement(82188..82829)
FT                   /locus_tag="CPR_0074"
FT   CDS_pept        complement(82188..82829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0074"
FT                   /product="putative lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85795"
FT                   /db_xref="GOA:Q0SWY3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY3"
FT                   /protein_id="ABG85795.1"
FT                   /translation="MFLIIPFALVGYLVYVLANKYKDGFSKKTLLWIFMILMILDQGIK
FT                   FIIHKWFFNDHFNIIGNFLTFQPIINTDGSWLNVRFGTGLDFGFLIILNLIALIIFFEC
FT                   YRYYVHNGHKDFNADMCIVFIMAGALCSLIDKVFYGGSLDFIGISNLFIADFKDIYINL
FT                   AILFFILCIYFNDYWKDDSTSTLKDDLASVKRFFIFAKNDLLVNILKLKK"
FT   gene            83160..83963
FT                   /locus_tag="CPR_0075"
FT   CDS_pept        83160..83963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0075"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86534"
FT                   /db_xref="GOA:Q0SWW2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWW2"
FT                   /protein_id="ABG86534.1"
FT                   /translation="MTDIIREYYNKNSKNEWLRLNDPYNRLELFSTMYMIKEYFPQEGK
FT                   ILDIGSGPGRYSIELLKRGYEVSLMDLSEKSIDMAKRNIESMGLKANDYICGDALYLDF
FT                   IKDNTFDGILLMGPMYHVQSKEDRIRILENCMRILKPGGIILIAYINSLGVLKVGLSDF
FT                   PQEYKDINKIYDLFDEKGFSQEESFTETYFTVPEKAISEVNEVGFNILSRAGAESFLSG
FT                   QAFYMTKYYLEDKEIYFNLLKVATEKCEDERFRDSTEHLIIVAKK"
FT   gene            84152..84952
FT                   /locus_tag="CPR_0076"
FT   CDS_pept        84152..84952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q899P8; match to
FT                   protein family HMM PF03618"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86996"
FT                   /db_xref="GOA:Q0SWW1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWW1"
FT                   /protein_id="ABG86996.1"
FT                   /translation="MLTIFAVSDSIGETAQQVAMAAASQFKDNAEVKRIPYVKSLEDVE
FT                   DLIKTIEDCEACMIVSTIITVNVREYLTQKCIEKNINIINVLGPIINVASTILNKYPDY
FT                   NPGAMWNTDETYYKRIEAMEFAMQYDDSKDYRGLKNADVVLVGLSRTSKTPLCMYLANK
FT                   GIKAINIPLVPEVGVPEELYEIDKKKIFGLTINPLQLIEIRKRRLDKFHRISADIEYAS
FT                   DSRILEEFEFADKILRKIGCRTIDVTQRAIEDTALIIMEKLGVK"
FT   gene            90676..90752
FT                   /locus_tag="CPR_0077"
FT   tRNA            90676..90752
FT                   /locus_tag="CPR_0077"
FT                   /product="tRNA-Met"
FT   gene            90758..90833
FT                   /locus_tag="CPR_0078"
FT   tRNA            90758..90833
FT                   /locus_tag="CPR_0078"
FT                   /product="tRNA-Ala"
FT   gene            91596..92918
FT                   /locus_tag="CPR_0079"
FT   CDS_pept        91596..92918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0079"
FT                   /product="putative amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03222; match to protein
FT                   family HMM PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87294"
FT                   /db_xref="GOA:Q0SWW0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWW0"
FT                   /protein_id="ABG87294.1"
FT                   /translation="MGKPKLKKEIGLFTATALVVGNMMGSGIFMLPSSLAGVSGPGSTI
FT                   MAWLLTGLGSLILALTFANLGSKIPKTGGTYEYSRLAYGNFMGFMTAWLYWNGSWIGNA
FT                   TIFIVITTYLGEVITSLTNSSIIGFLFCSSILWICTYINIRGTKLAGRVASVITVFKVL
FT                   LFIFFIVVGLIYFDPSNLTPMFPEGKGVSTIPVAASLTLWAFMGLETASVAGGEIKDPE
FT                   KNVKRSTILGMLISTVLYILISVVAMGVMSQSELASSTAPISDIIVKVLNLKSLNFLNI
FT                   AIAISILGTAMGWLLSTARVGYAAGEDGIFPSVFAKVHPKYNTPYVALIIGSIFINIIF
FT                   LMNFTKGLAGAYSFIVVLATLSYLPIYAISTIAEIILMVKEDKKPSFKKHLGLITRCLI
FT                   GFAFAIWAIYASGAEIVMYGFILILLGVPIYGYMSIKKHFR"
FT   gene            92993..93193
FT                   /locus_tag="CPR_0080"
FT   CDS_pept        92993..93193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWZ2"
FT                   /protein_id="ABG87198.1"
FT                   /translation="MGLYYLWYRNLRGECIGMAKVEALEEELVELKLKKRNFILANKDT
FT                   KEIDNLIKKIEEEIMRIKSNN"
FT   gene            93524..95548
FT                   /gene="glgB_1"
FT                   /locus_tag="CPR_0081"
FT   CDS_pept        93524..95548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB_1"
FT                   /locus_tag="CPR_0081"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02806; match to protein
FT                   family HMM PF02922; match to protein family HMM TIGR01515"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86142"
FT                   /db_xref="GOA:Q0SWZ1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWZ1"
FT                   /protein_id="ABG86142.1"
FT                   /translation="MTLVEVKDDKLEIKPVRLRKEKYKAQLENKIFNEDELYLFHEGRN
FT                   YNAYNFMGAHFTSENRKRGVRFTLWAPRAKNIFLVGDFSNWETKEENKLNRINETGLWS
FT                   IFIPRLKEGIKYKYYIEQEDGKAVLKADPYGIYSEVRPNTASILCEKTKIRWSDKKWLN
FT                   KREATNYFESPINIYELHLGSWKRKDEDEFLSYDELSVVLPKYVKEMGYTHVEFMPLNE
FT                   HPLDASWGYQVTGYYSVTSRYGDIKGLKRLINALHKNDIGVILDWVPGHFCKDEQGLYM
FT                   FDGTPTYEYEEKWKADNKGWGTFNFDLGKPEVKSFLISNAFYFINEFHIDGLRVDAVSN
FT                   MLYLNYGRNHGEWIPNIYGGNENLEAIQFIKELNEAIKTYSKGVITIAEESTSWPNVTN
FT                   DTEYGGLGFDFKWNMGWMNDTLEYNELDPIYRKYHHNKLTFPMMYNHSEKFILPISHDE
FT                   VVHGKKSLIDKMQGDYWNKFSNLRAYMAYMYGHPGKKLMFMGCEFGQFIEWREYEELEW
FT                   KLIDKFDMHRKTHNFFKDLNNFYKNNSELWELDYDGDGFQWIDADNNEQSIYIFIRKSK
FT                   NIEKYKIFVCNFTPMVYYDFNIGVPEKGVYREIFNTDKKEYGGSGQVIKGNLFSRKGWC
FT                   HNQPYTLTIKVPPMAVSVFERIIEENKTEEKIVKEDKYI"
FT   gene            95591..97024
FT                   /locus_tag="CPR_0082"
FT   CDS_pept        95591..97024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0082"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="identified by match to protein family HMM PF00534;
FT                   match to protein family HMM PF08323; match to protein
FT                   family HMM TIGR02095"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87509"
FT                   /db_xref="GOA:Q0SWZ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWZ0"
FT                   /protein_id="ABG87509.1"
FT                   /translation="MIKVLFATSEANPFIKTGGLGDVMGALPKELKRKGIDARVILPKY
FT                   SAIKGELLDKLNFKKWFMVPVGWRNQYCGVYQCEYDEVIYYLLDSEFYFHRNGLYGEGD
FT                   DGERFAFFDRAVLETLKEIDWCPDIIHCNDWQTGMIPVLHKLEYSKDPFYKDIKTVTSI
FT                   HNLLFQGNFSADILPELFGYDYEPVRNGSLEFYGGMSFMKGAINYSDRILTVSETYAKE
FT                   IQTPYFGENLDGLLRERGYALKGIVNGIDYYEFNPSKDSLIAKNFSVETIEDKVLNKLA
FT                   LQKELGLPINQDIPMISIVSRLTNQKGCDLIVNIAHRLLQRNVQLVILGTGDYNYENHF
FT                   KGLQELYPTKVSANIKFDNGLAHRIYASSDIFLMPSLFEPCGLGQLIALRYGAIPIVRE
FT                   TGGLKDTIHSYNKYTGIGNGFSFTNYNNNDLMHVIELALETYDDKEVWRSLIIQAMDSD
FT                   NSWNTSAEKYKELYEELIK"
FT   gene            97054..99489
FT                   /locus_tag="CPR_0083"
FT   CDS_pept        97054..99489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0083"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85744"
FT                   /db_xref="GOA:Q0SWY9"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY9"
FT                   /protein_id="ABG85744.1"
FT                   /translation="MLSINKESFKRDYKKKFLELHGIELEEGKNFHKYEALGCLVRDYI
FT                   AEDWVNTKKKYEDSKQKQVYYFSMEFLLGRLLGDALLNLGIRETCREALKELNIDLEEL
FT                   EEFESDQGLGNGGLGRLAACFLDSMASLNIAGHGCGIRYKYGFFNQKIIDGSQVETPDS
FT                   WLKNGNVWEVKKPDKSEIVKFGGNIKCENINGRLTFTHVNYEPILAVPYDTPIVGYENN
FT                   VVNNLRLWSADPVDNEFDFCYFNRGQYLKAIEYRNSIEAISQVLYPDDSMYEGKLLRLK
FT                   QQYFFVSAGLQSIVRHYKKNGGKIEEFDEYIAIHINDTHPTLAIPELMRILLDEEGLSW
FT                   ESAMRITTNTISYTNHTILSEALEKWPINMFKELLPRIYMIVEEMNERYCAELWHKYIG
FT                   QWDKISKMAIIGDGFVRMANLAIVGSHSVNGVAKLHTEILKKKEMSDFYYLYPSKFNNK
FT                   TNGIAHRRWLLKSNPELTNLLKETIGDSFIKHPTDMENFEKYIDDEYVLKRLGEIKRKN
FT                   KENLAKVIFDNQGIKVDPNSIFDVQVKRIHAYKRQTLNCLRIMELYNRLLENPNLDIAP
FT                   RTFIFAGKAAPAYYLAKNTIELINAVANKVNNDKRINDKIKVVFLENYRVSLAERIIPA
FT                   TDLSEQISTTTKEASGTSNMKFMMNGAITIATLDGANIEIRDEVGDDNIVIFGLTENEV
FT                   LDYYSRGGYSAWDVRNNDNRLIRVTDDLINGVYSKDKDKFRSVYDNLLTYNDEFFVLKD
FT                   FDSYLKAQDKVDLLYRNNKEWQRKCGVNIAHSGIFSSDRTIAEYATGIWGSKVIYKNL"
FT   gene            99856..101676
FT                   /locus_tag="CPR_0084"
FT   CDS_pept        99856..101676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0084"
FT                   /product="pullulanase"
FT                   /EC_number="3.2.1.41"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86305"
FT                   /db_xref="GOA:Q0SWY8"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWY8"
FT                   /protein_id="ABG86305.1"
FT                   /translation="MGKVYIYHDSQGTFYREPFGAVSVGSKVSLRLECKECGEVFIEVI
FT                   KFDGSRYLIPMTIEERRNECIIYKGIIDTTNSLGVINYYFKYIKDGFTKYYGNNDECLG
FT                   GEGKIYYDFPNYYQITVYEDNKIPSWYKEGIIYQIFVDRFFNGNKDSMILNKKKNSFIY
FT                   GNWYDEPMYIRDSNGNIKRWDFYGGNLRGVIEKLDYIKSLGVNIIYMNPIFDAVSCHKY
FT                   DTGDYENIDKMYGTNSDFNELCQKAEEKGIRIILDGVFSHTGSDSRYFNKYGNYGELGA
FT                   YESKYSKYYNWYRFYDYPNSYECWWGFENQPNVEELEKTYSDYIVNSENSIIAKWLRLG
FT                   ASGWRLDVADELPDEFIQMIKERMKNEKEDSVLIGEVWEDASNKVSYSKRRKYLLGNEL
FT                   DSVTNYPYRDIISNFLNEEISSKDFYKVIMSIKENYPRENFFANMNILGNHDTERILTV
FT                   LKENLNKLKLALCLQMTLPGVPLIYYGDEAGLLGNKDPENRKTYPWGRENKEILSYYSF
FT                   FGNFRKNEEVLRKGDFYIFKDTPEDIIAFKRVYKDKEMIIIVNRSNSRKTITLDSEKRR
FT                   YKDKFSKEEFYGDGSITLEVERENYKILTN"
FT   gene            101731..102174
FT                   /locus_tag="CPR_0085"
FT   CDS_pept        101731..102174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0085"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87218"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWZ3"
FT                   /protein_id="ABG87218.1"
FT                   /translation="MIRTIVCQRDGCNGNAFYINSHDGEMSVVCKECNSEYKYEIENNS
FT                   LLMLSTCSNCNNDTFKVFKDTESNNIYAKCIVCGNPPENIFIDADGNQVSYESKILNDI
FT                   KDMVYKVEQRISDLEREAESLGSGQVLIEQSIAYINQFLSENK"
FT   gene            102399..103565
FT                   /gene="glgC"
FT                   /locus_tag="CPR_0086"
FT   CDS_pept        102399..103565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="CPR_0086"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="identified by similarity to SP:P39122; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR02091"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87378"
FT                   /db_xref="GOA:Q0SWS5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWS5"
FT                   /protein_id="ABG87378.1"
FT                   /translation="MSKKEIVAMILAGGQGSRLGVLTKNLAKPAVPFGGKYRIIDFPLS
FT                   NCSNSGIYTVGVLTQYKPLKLNEHIGIGDTWDLDRRDGGVSILPPYQKEKGGDWYKGTA
FT                   NAIYQNIEFIERYDPEYVLILSGDHIYKMDYDKMLEMHKQKEADATIAVINVPMHEASR
FT                   FGIMNTNEDLSIYEFEEKPEHPKSTNASMGIYIFNWKILKKFLEEDELDPSSSNDFGKN
FT                   IIPKMLNSGKKLIAYPFNGYWKDVGTIESLWEANMDLLKYEDELSLYDSEWKIYSANPV
FT                   RPAQFIGKDAEIKSSLTVEGCIVHGKVENSVLFQGVYVGKGAIVKDAVIMPNTKIEDNV
FT                   LIEKAIIGSEAIVCKGCKIGDGNKISVIASKEVVIGSKEIIEECAMVK"
FT   gene            103595..104701
FT                   /gene="glgD"
FT                   /locus_tag="CPR_0087"
FT   CDS_pept        103595..104701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgD"
FT                   /locus_tag="CPR_0087"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /note="identified by match to protein family HMM TIGR02092"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87622"
FT                   /db_xref="GOA:Q0SWS4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS4"
FT                   /protein_id="ABG87622.1"
FT                   /translation="MNNCIGIINLDENESKIGELVKNRPLAAVPIAGRYRIIDFILSNM
FT                   TNAGIESLGILSKNKSRSLVDHLTNGRPWDLHRKRDGLRVFNFGERDPYYDDITNLYEN
FT                   LEFLTKSRREYVIMSPSYMICNIDLKEALEYHKKNDNDITVIYKKVKDADSNFIDCDVL
FT                   NFDECGFIKSIGKNLGREEESSISLEMYILRTDLLIEIIYECIRRGSHRKFKSYLKEFL
FT                   DEIKVGGFEFKGYLSCVNSLKSYYKANMDLLEEKVYKELFIDNNPIYTKSRDEGPTHYT
FT                   KNSEVTNSIIANGSYIEGKVENSIIGRRVYVGPEAVIKNCIIMQETVIGENAHLDKIIT
FT                   DKAAVIRDDDKIVGLEYCPMVLSKPNVI"
FT   gene            104764..105210
FT                   /locus_tag="CPR_0088"
FT                   /note="CPE0070"
FT   CDS_pept        104764..105210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0088"
FT                   /product="putative acetobutylicum phosphotransbutyrylase"
FT                   /note="similar to Bacillus halodurans (strain C-125);
FT                   BH3707; identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86892"
FT                   /db_xref="GOA:Q0SWS3"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS3"
FT                   /protein_id="ABG86892.1"
FT                   /translation="MENKRKRIIAWSLMILWMAFIFFMSSQPGEVSSKQSNFVVVLLDM
FT                   FGMNLNSRFGELSTYIIRKGAHFTEYMILYFLAFNLLRLYITRKMAYIYSLIIVFGYAC
FT                   SDEFHQLFVEGRSGQFKDVLIDTSGGIFGSLLVILKNKIFSNKA"
FT   gene            complement(105377..106789)
FT                   /gene="cls_1"
FT                   /locus_tag="CPR_0089"
FT   CDS_pept        complement(105377..106789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls_1"
FT                   /locus_tag="CPR_0089"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86340"
FT                   /db_xref="GOA:Q0SWS2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS2"
FT                   /protein_id="ABG86340.1"
FT                   /translation="MAFIINVILSVIIVVLERKQPEKTIAWLLILTLLPPIGLILYIFL
FT                   GRNWKRNKLNDRVNPEINELINPILDEYPEKQYVPLMELLAFNSDSPIFVNNDIKIYKD
FT                   GVEKFKDLKEELLKAKHHIHLEYYIVNSDEIGNEIKDILIKKALEGVKVRFIIDKVGSS
FT                   SLKRSYIKDLKKAGISVIMYSYFLAPLLKVINTQINYRNHRKIVVIDGQVGFLGGINIG
FT                   DEYLGRNKKFGYWRDTHIMIKGDFVLALQAVFLDDFITIEKANNSYTFYDKEFDKYFPE
FT                   NIVAKERVLMQLVKSGPDSTFPAIMQSVLKMIMTARENIYITTPYFVPPSSIIEALRIA
FT                   SLSGIDVKIIFPEKSDHFMVNKASKSYLAELMDCGIEVYFYDKSSFIHSKTMTIDGKIC
FT                   TLGTANMDIRSFELNYEINTVIYDKEITCKLDALFFEDLLKSRHFKIEEYEKSTKFDKF
FT                   IEGFARIFSSLL"
FT   gene            112669..112744
FT                   /locus_tag="CPR_0090"
FT   tRNA            112669..112744
FT                   /locus_tag="CPR_0090"
FT                   /product="tRNA-Lys"
FT   gene            113027..113875
FT                   /locus_tag="CPR_0091"
FT   CDS_pept        113027..113875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0091"
FT                   /product="SACPA operon antiterminator"
FT                   /note="identified by match to protein family HMM PF00874;
FT                   match to protein family HMM PF03123"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87419"
FT                   /db_xref="GOA:Q0SWS1"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS1"
FT                   /protein_id="ABG87419.1"
FT                   /translation="MIKKTEKAYEVKRSFNNNIVLVDDDKKEIILFAKGIGFNCKKGSI
FT                   IPENTNIEKIFTIQDENNIANFRRVIGSNDEKFIAFCEELILEISRDFNEELNEIIHIG
FT                   LIDHISFAIERMKKGEILRNPFLVEIETLYPKEFEAATKMVKKLEDFTGVSIVEDEIGF
FT                   IAMHIHSARTTGKISHTIKFTYISNTAVEYIEDAFNIVVDRTSLSYARFISHLRFAIER
FT                   LINNTPVKNELLSIIKLKYPESFKVSEEIGKAINEDFSLEVAEDEIGYLALHVERIRKN
FT                   E"
FT   gene            complement(113907..114386)
FT                   /locus_tag="CPR_0092"
FT   CDS_pept        complement(113907..114386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0092"
FT                   /product="putative PTS system, N-acetylglucosamine-specific
FT                   IIA component"
FT                   /note="identified by match to protein family HMM PF00358;
FT                   match to protein family HMM TIGR00830"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85413"
FT                   /db_xref="GOA:Q0SWS0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWS0"
FT                   /protein_id="ABG85413.1"
FT                   /translation="MFGLFKKELKLIAPATGKTIDLSQVPDQVFAEKMAGDGVAIEVTG
FT                   DTIVAPADGELSLVFKTNHAFAMTLSNGIELLVHVGIDTVSLEGEGFERLTEPGQQVKA
FT                   GTPILKIDRDFILGKGLKLHTPVLITNPDMVKDMKPVIGETVTSGNDTVLTYKVK"
FT   gene            115034..116479
FT                   /gene="nagE"
FT                   /locus_tag="CPR_0093"
FT   CDS_pept        115034..116479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="CPR_0093"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85983"
FT                   /db_xref="GOA:Q0SWR9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR9"
FT                   /protein_id="ABG85983.1"
FT                   /translation="MSKKGSKVLGFLQRIGKSLMVPIAVMPALGLLLRLGDKDLLNIPW
FT                   ISAAGGAAFGDNMAMLFAVGIGFGLSDENNGVGGLAGLLGFLVMKNVATSFDPSINMGA
FT                   FGGVVAGVVGGLLYNKFKDIKVPQFLGFFGGKRFVPIITSAVCLILGVFFGYTWPTFQA
FT                   GLDGFANIMVAVGAIGAGIYGILNRLLIPIGLHHVMNTVIWFQLGSFTDPVSGQIATGD
FT                   IARFLAGDPTAGVYTAGFYPIMMFGLPAACLAMYVCAKKKNKAVVGGMFLSLALTAIIT
FT                   GITEPIEFAFMFLSPILYVIHAILTGISLAVAYALNVHLAFSFSGGLIDYILYFGKGQN
FT                   QLIILLMGLVAFVVYYFLFMFFIKKFNLKTPGREDDFDDENEDVENNSKTVPKLEDNPS
FT                   KGGTLAEKAEVVLVALGGKENIEVLDNCITRLRLTLKDASKIDEVTLKKAGASGIMKLD
FT                   GKNVQVIMGTLADPLASQMKKLL"
FT   gene            complement(116548..117066)
FT                   /locus_tag="CPR_0094"
FT   CDS_pept        complement(116548..117066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0094"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86849"
FT                   /db_xref="GOA:Q0SWR8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR8"
FT                   /protein_id="ABG86849.1"
FT                   /translation="MPKIIKNVKEDLLTEGKKQLLSNGYLNLNIRNITKKCNIGTGTFY
FT                   NYFKNKEQLVIDILSNDWTSILNISNEIIKEDISFKEKLIFISNNINYFLKNYRLIFSE
FT                   MAKHTSKNHYVIEPMYEILEKLIEIHIEKGEINPPISSNKFAYFLLNNLILTSRYELTI
FT                   DDLLLLLNI"
FT   gene            122457..122531
FT                   /locus_tag="CPR_0095"
FT   tRNA            122457..122531
FT                   /locus_tag="CPR_0095"
FT                   /product="tRNA-Asn"
FT   gene            123190..125280
FT                   /gene="fusA_1"
FT                   /locus_tag="CPR_0096"
FT   CDS_pept        123190..125280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA_1"
FT                   /locus_tag="CPR_0096"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03764; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86160"
FT                   /db_xref="GOA:Q0SWR7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR7"
FT                   /protein_id="ABG86160.1"
FT                   /translation="MKEYKIENLRNIGIIGHSDSGKTALSEALLYYTKTTDRLGTCEDG
FT                   NTISDYDQEEKKRKISLALSIIPFEYDGTKINILDTPGYFDFVGEQIEGVKAADSAIIT
FT                   VCGVTGVQVGTEKAWECCEKEKLPRAFFINKLDRENSNFDKVLENIRNIFGNKVIPTQY
FT                   PLGKEKEFKGIVNLITEKAFEYDKKSGKINKIEIPNEVKDKVNEYRTYLMESVAETDEE
FT                   LLDKYLSEGELTVDEIYKGLSIGFEEGDIAPVMCGSSVSIVGMKSLLDSIKGYFPSPYI
FT                   SKAKVAIDSNNKEILVKSNKDMPFSAFVFKTIADPFVGKLSIFKVQTGELTTDKIIINS
FT                   KNNKIEKVSSLCFLRGKNQIQTNKIGAGDIGAITKLQYTSTGDTLCESNFKIAYEEFEF
FT                   PEAVMTMAVLPKSKCDEEKISQGLSKLLDEDPTFKVSRDQENAETLVSGIGETHVEVLA
FT                   SKLKSKFGIDVILQDPKIPYRETIKGSSDVQGKHKKQSGGHGQYGDVKIKFEPRRDGEL
FT                   DLEFVDKVVGGVVPRNYIPAVEKGLRDCLKKGVLAGYPVIGIKATLHDGSYHPVDSSEM
FT                   AFKVAASLAYKKGMENAKPVILEPIMKVKIIIPDEYMGDIISDINKKRGRVIGMEPEGN
FT                   NEKVIADIPLSEMFKYATDLRSMTQGRGSFSMEFEKYEEVPSTEVDKIIEDAKKIKEAK
FT                   EA"
FT   gene            125703..125939
FT                   /locus_tag="CPR_0097"
FT   CDS_pept        125703..125939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G97292"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87031"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR6"
FT                   /protein_id="ABG87031.1"
FT                   /translation="MCNYRMDIKGKISLSDYSNIFDYINIVDVCDRFMIYMESLDDDNI
FT                   GIICSMLKDNNFNIKNQGYDNQGIYYINAKKIG"
FT   gene            126191..127138
FT                   /locus_tag="CPR_0098"
FT   CDS_pept        126191..127138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0098"
FT                   /product="putative glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="BH0797; identified by match to protein family HMM
FT                   PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87603"
FT                   /db_xref="GOA:Q0SWR5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR5"
FT                   /protein_id="ABG87603.1"
FT                   /translation="MKNYVVGIDLGGTKISCALADLEGNVKAQHTTPTNAHEGEQAVLD
FT                   RIIGCVETVICEGKVTIDEVEAIGIGSPGPLDARTGIIITTPNLPFKNFNLVSPLKAKF
FT                   GIPVYLDNDANVAAIGEFMLGAGKGTENMIYITVSTGVGGGAILNGKIYRGSTSNALEI
FT                   GHSTVAPGTVRCNCGNMGCLEAVSSGTAIGKRGREAVATNVETSLKDYDNVTSYEVFVE
FT                   AAKGDRVAKSIIDEALNYLGIGVANAIATFDPDMVVIGGGVSKAGEVVFETVQEVVNER
FT                   CFKAMAEHCKIVPAGLGTDAGVIGAVALALLECK"
FT   gene            127697..128239
FT                   /locus_tag="CPR_0099"
FT   CDS_pept        127697..128239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0099"
FT                   /product="rubredoxin/rubrerythrin"
FT                   /note="identified by match to protein family HMM PF00301;
FT                   match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86362"
FT                   /db_xref="GOA:Q0SWR4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR4"
FT                   /protein_id="ABG86362.1"
FT                   /translation="MKKFVCTVCGYVYEGEKAPEKCPVCGVGADKFIEQGEDLAFADEH
FT                   RIGVAKGVDERIIEGLQANFVGECTEVGMYLAMSRQADREGFPEVAEAYKRIAFEEAEH
FT                   AAKFAEMLGEVVEADTKANLQARVNAEHGACQGKKDLATLAKQLNLDAIHDTVHEMCKD
FT                   EARHGKAFAGLLNRYFK"
FT   gene            128573..129196
FT                   /locus_tag="CPR_0100"
FT   CDS_pept        128573..129196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0100"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87170"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR3"
FT                   /protein_id="ABG87170.1"
FT                   /translation="MKIYFTRHGETLWNLEHRFQGWKDSELTENGVKRAELLGKKFNDI
FT                   KIDKIFTSPIKRAKRTAYLIKGDKDIEVEEVEGLKEISFGKWEGMTTEEIKSHDEYVNE
FT                   LDNLFNKPFSYKSFEGENIKDFTERLFKTVDDIIKNNKDKDILIVTHGMCVRYLIGYFK
FT                   NEFEESKIIDYPIFHQASYNEVEWNGENFEVITLNNIDHYEYDK"
FT   gene            130082..130354
FT                   /locus_tag="CPR_0101"
FT   CDS_pept        130082..130354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86742"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR2"
FT                   /protein_id="ABG86742.1"
FT                   /translation="MSKKVEELKNEVMADVEKSCVEDIKAHMIDKIEEDVKVLDEDSRA
FT                   YKEDEKEAAKLGKAINKELDREIKEEAENAKEFAKELKADIESRE"
FT   gene            complement(130753..131706)
FT                   /gene="ldh"
FT                   /locus_tag="CPR_0102"
FT   CDS_pept        complement(130753..131706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="CPR_0102"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01771"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87518"
FT                   /db_xref="GOA:Q0SWR1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWR1"
FT                   /protein_id="ABG87518.1"
FT                   /translation="MIREKTNKISIIGAGFVGSTTAFALMQDGLASEIVIVDINKDKAH
FT                   AEAMDLAQGAAFVKSVDIKSGDYADTKDSDIVIITAGVGPKPGETRLDIINKNLKIFKS
FT                   IVPEVVKYSPNSILLVVSNPVDILTYITYKLSGFPKERVVGSGTVLDTSRLKYMLSEHF
FT                   DIDARNVHTYIIGEHGDSEITAWSLTNIAGANVDEYCKTVCANCDGSFKKELPEKVKNA
FT                   AYEIINSKGYTNYAVALAVTRIVEAILRDENAILTVSSLFEGQYGIDNVYLAMPTIVDR
FT                   SGARQILDVPISNEEKENLIKSAEILKGHIANSELD"
FT   gene            132319..133494
FT                   /locus_tag="CPR_0103"
FT   CDS_pept        132319..133494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0103"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85506"
FT                   /db_xref="GOA:Q0SWR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWR0"
FT                   /protein_id="ABG85506.1"
FT                   /translation="MIKIKKNINKDAEKKYEYRFYRYLGLILIILFSCIVTVSNLINSD
FT                   ATKKLISQMVRKDYSDFFQYELKNSDRSMQGIYDLYSKRENIDVYKLMALNTIYFGGDR
FT                   NRYLEPYIRPYIDKYNLSQNDRLKLYEDVNKEIKNIENKYIFKLIVKRFSPYILAIAFV
FT                   TLIMGSTSFIRKRNNVERIIINILIFLAGIYICYLSSISVKHGIWINLAIMMALAGFII
FT                   ENKTKLLEYIGGSIILIILALSILGKFEYKSNELYKYDVNKLVLVNNFQGANFANEEHD
FT                   IQRSGRALYSEIKKENMILVDNSNENINNLIENKEKIIFNNKENNEPVFYMCLYNNIPV
FT                   YRLALVKDGQIVKIYEGVLNPYMRSTLMKLERGKGHKKNKVCNIEMLKTIN"
FT   gene            133613..134053
FT                   /locus_tag="CPR_0104"
FT   CDS_pept        133613..134053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ9"
FT                   /protein_id="ABG86010.1"
FT                   /translation="MLFYGVISVEYKKEQFNEKVLTDHITKEQWIDILKNSNLIGLRDM
FT                   KILLNLYGSNGQPLKTSLIGEHLEFEDISTRIQKMCKKIEEELGITLDEKSEMGSWKYK
FT                   FRHWFIMLNGSKIYDEKEEKNYFTWTLKKELKEAIDSLLGKE"
FT   gene            134261..135058
FT                   /locus_tag="CPR_0105"
FT   CDS_pept        134261..135058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0105"
FT                   /product="putative uncharacterized conserved membrane
FT                   protein CAC2649"
FT                   /note="CAC2649; identified by match to protein family HMM
FT                   PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86919"
FT                   /db_xref="GOA:Q0SWQ8"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ8"
FT                   /protein_id="ABG86919.1"
FT                   /translation="MNRKEIKSIAKSKLKGRWFNIVLLTLIIAIIEFGASEIIGRTEGI
FT                   TSNILNIANNFLLMPAITASGIIYTIKFVKSNEVVSLSYAIPSIKTWGRFIMSMIVTMI
FT                   FSIPILLVVFLGNIFLVLSITSLHSAMLTGQISMNPMIGIWGVVFLIVILVLILAAIVG
FT                   ILLFPLPYLMAEDTCGIWEAVKRSFKIMNGHKWELFIMGLSFLGWLILSALTFGIGLLW
FT                   LLPYIQVTLRIYYLSITGRALEIGKYELNQNIEVKEEDFEFRD"
FT   gene            complement(135198..136520)
FT                   /locus_tag="CPR_0106"
FT   CDS_pept        complement(135198..136520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0106"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85901"
FT                   /db_xref="GOA:Q0SWQ7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ7"
FT                   /protein_id="ABG85901.1"
FT                   /translation="MSNFNETPRGSRIHISLFGKTNSGKSSIINALTGQNISLVSDFKG
FT                   TTTDPVYKAMELLPLGPVVFIDTAGFDDEGEIGKLRVEKTEEVVGKTDVALITLSLSEI
FT                   LEAIKTNIEFKDMLSKEILWLNKLKKAKKPAILVINKCDLVPNKLIESKIDLKDIDKTT
FT                   LSNKDYFVDSNLNNSLKEIGELLGIPCVAISAKNNLNINELKKELVNVSPSSITESPII
FT                   GDKIKAGDKILLVAPQDIQAPKGRLILPQVQVLRDILDYGGIPTMVTLDKLDEGLKIFN
FT                   GKPDLVITDSQVFKQVNKKLDRSVPLTSFSILMARYKGDLDKFYSGAKAIKNLKAGDKV
FT                   LIAEACTHHQLKGDIAREKLPTWLEETCPGVIVHNCSGKDFPKNLNEYALVIHCGGCMF
FT                   NKAEIMNRIGICDDALVPITNFGTSIAEINNILDRVMEPLK"
FT   gene            complement(137279..137563)
FT                   /locus_tag="CPR_0107"
FT   CDS_pept        complement(137279..137563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86477"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ6"
FT                   /protein_id="ABG86477.1"
FT                   /translation="MTVDQNSLERRTCCNIHKIVLTLEKGFSSMESLKYAVITHLQNEG
FT                   YRCNDTKNNIGDYPLLKINANDFLLTIKDIDENSLNFEGCSEVVLVPHH"
FT   gene            complement(137986..139407)
FT                   /locus_tag="CPR_0108"
FT   CDS_pept        complement(137986..139407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0108"
FT                   /product="putative thiazole biosynthesis protein ThiH"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87599"
FT                   /db_xref="GOA:Q0SWQ5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ5"
FT                   /protein_id="ABG87599.1"
FT                   /translation="MLKDNEKYNALDFIKDDEINSLIAKGKELVSDKELVREIIEKSKS
FT                   AEGLTPEETAVLLNLEDKELIEEMFKAARQVKEKLYGKRLVVFAPLYVSNYCVNNCTYC
FT                   GYKHCNDELKRKKLNKEQLIEEVKVLESLGHKRIALEAGEDPVNAPLDYILDCIKSIYS
FT                   IKFDNGSIRRINVNIAATTVEDYKRLKDAEIGTYILFQETYHKPTYERLHVSGPKHNYN
FT                   YHTTAMHRAREAGIDDIGMGVLYGLYDYKYETLAMLMHAMDLEETTGVGPHTLSVPRIR
FT                   PAENVSLENYPYLVDDEDFKKIVAILRLAVPYAGLILSTREEPGLRDEIIALGVSQVST
FT                   GSCTGVGGYSESYVDPEEKPQFEVEDHRSPVEMIESLMEAGYIPSYCTACYREGRTGER
FT                   FMEIVKSGELYKICEANALITLKEFIDDYGTDKTREIGDKLIKKSIDEIDNESFRKSVE
FT                   EKINKISKGTRDLRF"
FT   gene            complement(139513..139764)
FT                   /locus_tag="CPR_0109"
FT   CDS_pept        complement(139513..139764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:H96959"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87018"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ4"
FT                   /protein_id="ABG87018.1"
FT                   /translation="MSTRIAVVGIVIESLDNIKEVNSILNKYEKLIVGRMGLPYKEKNI
FT                   RVISIVVDGTTDEISAITGKIGKLKGVSVKAAISKTSF"
FT   gene            140209..141771
FT                   /locus_tag="CPR_0110"
FT   CDS_pept        140209..141771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0110"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:D97239; match to
FT                   protein family HMM PF06207"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86838"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ3"
FT                   /protein_id="ABG86838.1"
FT                   /translation="MKKNKLITAIILAGAISIGSFTTVFADTKEVVTLGANLNSTQKQE
FT                   MFKEFGVKPNDVKVITMNVNEIREQLGLPKIVGEFKGNAYSSVFVKIEEKGYGLKVKTN
FT                   NLTEVTKTMLSNALLTSRVTDADVIATAPFPVTGTSALAGVLQAFEKATGENIPVKNKE
FT                   VARQELSITNNLAKAKNSEGQEIGRDGASAIVNQAKEEVIKDKPKNDKEVGEIVNNITN
FT                   NYNIELTPTQEQELVGLLANINSLGLDYSKLKGELDSLSNNIQETLKENGQELKESGTL
FT                   DRILNKILGVCTDIKNWFVAHLGDGEVTINGVTYDKDGNMINKDQLKNIGTSISDDDND
FT                   TSNNESKNNTEDKSQKSDSKDKEIDKANSNKQDASNSEGEQESKSNSSLNNDNKGNKES
FT                   QNNNAKGDKASQNSKSKNGVSSSKNNSNKNNSGSSNNSKDKSKETIKLEDGTVIPKYNS
FT                   KGEEYNPVTGGYGHMQETEDAGKDSDQTIDYIIVDGKKVPLHDEQGREYNPETGRYGDP
FT                   DDN"
FT   gene            141919..142146
FT                   /locus_tag="CPR_0111"
FT   CDS_pept        141919..142146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC14097.1; match to
FT                   protein family HMM PF07872"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86230"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ2"
FT                   /protein_id="ABG86230.1"
FT                   /translation="MAKAILTKKSLVLKYQKGVDDSGSPKFSTQKFSKIKVDAEDEKLY
FT                   EVGKALADLLSSRVNSVLKEDDFKFVDDTQ"
FT   gene            142431..142655
FT                   /locus_tag="CPR_0112"
FT   CDS_pept        142431..142655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC14096.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85881"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ1"
FT                   /protein_id="ABG85881.1"
FT                   /translation="MEKELYLVLSFKNAGGSITKITLKNIKEDVTEEEVQNLMEKIVTA
FT                   NIFASKGGDLVSKVKGEIVEKTTESFEMA"
FT   gene            complement(142715..143674)
FT                   /locus_tag="CPR_0113"
FT   CDS_pept        complement(142715..143674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0113"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87282"
FT                   /db_xref="GOA:Q0SWQ0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWQ0"
FT                   /protein_id="ABG87282.1"
FT                   /translation="MKNFLRILSIIIISSLMLLGCGSNSTKPNINKDSNSINNSNEENN
FT                   KIEKNNSNNKNNSIDENNNKEKNDSKEGNIDQKKEKNKIDSNTSKETDKKSDVEPYCEN
FT                   EPNKANKDITIVIDPGHSSTISNETEPECPGSQKRKLKDTLGAIGVQSKIPEYTITHGV
FT                   AEELKKLLTSEGYNVIMTKDSPDKQLSNIERTTIGNDNNANLIIRIHCDGVDSPKACGA
FT                   SILVPATKGNVTKDISDISYSYGEKILTAYTKYTGLKNRGVVVRDDLTGFNWSKVPIVL
FT                   IELGFISNPNEDLYLSNPDNYIKIATGISNGINYCFAK"
FT   gene            complement(143687..144859)
FT                   /locus_tag="CPR_0114"
FT   CDS_pept        complement(143687..144859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86737"
FT                   /db_xref="GOA:Q0SWP9"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR038434"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP9"
FT                   /protein_id="ABG86737.1"
FT                   /translation="MKFCSKCGNKLSDSMKFCNKCGAKVKSVDKDTENNSNPEDAKNIS
FT                   NIENNIDKTIILDAPKIKKEINTDINENIKNNLKPIHNSNFNNKEKCLDASFDDDLDDD
FT                   LDENFYDESCNNENTDNFKHSNTKKKILISIFTLVAFVIIGTSIYFLRSPLLYKYYYNS
FT                   ALKSSSVTEKLSYYNSALKYSKNDDLLNSIYTTLKSDSDFVDNSSILTNLNKSEKDNLM
FT                   SKLYVNKATVDFKNKNYTDCDSDLDLATKYGYKKENFSQYDDLQKKLNESKNSSNNDKV
FT                   DNVYSFTNENPSKFSGNIYDYPYDFIMPYSNSSYLSASDLSKYNKSTLSLMRNEIYARH
FT                   GYVFNTNPFKEYFNSKSWYHPDSSFKGDDSELNDYEIKNVQTIKSVENSK"
FT   gene            complement(144871..146121)
FT                   /locus_tag="CPR_0115"
FT   CDS_pept        complement(144871..146121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F97297"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86918"
FT                   /db_xref="GOA:Q0SWP8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP8"
FT                   /protein_id="ABG86918.1"
FT                   /translation="MNFCNKCGSKLINGVCPNCSKIKKNKKKSKIIIISLVLIVVIFSG
FT                   VFFYLKSTVKSEKEIALSFSNSISSSNPEELSKILYCNDSSLPINKSNSTILIDYFNQN
FT                   PSKFSSINDDFKKGNYTDTDSPLSIEEVRKDFFLIPVYKVVVKPSFIKVKTDLKDAKVQ
FT                   IGDETFGDLTKKDELGPLMPGNYTIKSEISNSYLNKSENIEVNTFKSSNQEISIFDNFI
FT                   KVNITSDIPDAELYVNNKDTGVKIKDAKTFGPIDPNSIIYGVAKDGDKKIISNKYDVNY
FT                   SKNININFAEAKASEANFKKDLYVLLSNYSNDFAYAVNTNSFNYIENYLEFDSPIYNKQ
FT                   KKVVPEIHSKDIRENFESTEILNYTFNNDTNTGEVTCNEIYSIGKGINVPKRQEFKNTY
FT                   TFKKLSNGSLVLTDIKD"
FT   gene            146237..147037
FT                   /locus_tag="CPR_0116"
FT   CDS_pept        146237..147037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0116"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87352"
FT                   /db_xref="GOA:Q0SWP7"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP7"
FT                   /protein_id="ABG87352.1"
FT                   /translation="MFCSKCGKEIPNESVFCPECGNRCKGSNKSIPIDVNEHKGYIIKS
FT                   LCHPITSVKEHVFGVSLKIQLIYIAIITLIIPLVKTLLFKAFSFNLVKSVVGIILEFSN
FT                   VNTWDFNNMIKAKSQFDMIMENVFPTGNIYFLNLGSYIINYALILGIIYIIFKFLVKED
FT                   INKDSLVNIMFVVSIINVFILIISSIALVLGGAIWMIVSIFSSILSVVLLYALFNTLIK
FT                   SKNKFIYIYSLTCMVVYSINAWFVFNNVSSIIYQIYYNLERYFI"
FT   gene            147177..147857
FT                   /locus_tag="CPR_0117"
FT   CDS_pept        147177..147857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0117"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85779"
FT                   /db_xref="GOA:Q0SWP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP6"
FT                   /protein_id="ABG85779.1"
FT                   /translation="MESKKIFIIEDEEKIREELTKFLEKYGYVVESSDDFENIVDISLS
FT                   CNPNMILLDINLPYYDGYYICREIRKKSQVPIIVVTSRQSEMDELMSMNLGADDFVTKP
FT                   YNTQILLARIASIMKRTYSGIEGETEIFNCRELKYNMSTSEVSFKGEVEELTKNESKIL
FT                   NILIRNKGKIVSRDNIIKTLWQSNEFIDDNTLTVNVNRLRRKIEGIGAEGYLQTKRGQG
FT                   YILS"
FT   gene            147854..148867
FT                   /locus_tag="CPR_0118"
FT   CDS_pept        147854..148867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0118"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86155"
FT                   /db_xref="GOA:Q0SWP5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP5"
FT                   /protein_id="ABG86155.1"
FT                   /translation="MNLRDFIRERIVFIIINLLILLFTAVLLMVLKVDSFAILFIIIIN
FT                   GAGILIYHIFDYLRKKQYYDEIKENMESLDKKYLISEVIEEGTFTESKLIYEVICKSNK
FT                   AMNDEIGEFKRGINDYREYIELWVHEIKTPIATCKLLIENNESPLTESIGEEVCKLENY
FT                   IDQALFYTRSNTIEKDYIIKEMSLSSCVNKVLNNNADALIKKRVKISLGDLEKIVYSDS
FT                   KWIEFILGQIISNSIKYMNKEHKELKIYCSESSKYVILNIEDNGAGISEKDISRVFDKG
FT                   FTGENGRKFGKSTGIGLYLCKKLCKKLGLDIKLISEEGKFTRVSIIFPINRMMIFE"
FT   gene            149643..150413
FT                   /locus_tag="CPR_0119"
FT   CDS_pept        149643..150413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0119"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86539"
FT                   /db_xref="GOA:Q0SWP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP4"
FT                   /protein_id="ABG86539.1"
FT                   /translation="MGKEVLKVSNIEKYYGKKGNVTKAINDISFTVSEGEFVGIMGASG
FT                   SGKTTLLNCISTIDKVTSGHVYLEGEDVTSFSSKKLAKFRREKIGFIFQDFNLLDTLTA
FT                   YENIALALTIQRVNNKEIDKRVRLVAEALNISNELNKYPYEMSGGQKQRVASARAIVTN
FT                   PSLVLADEPTGALDSKAATMLLESLEDLNKNLNATIMMVTHDAFTASYANRILFIKDGK
FT                   IFNELIKGTDSRKEFFNRIIEVITLLGGDSNNVF"
FT   gene            150403..152382
FT                   /locus_tag="CPR_0120"
FT   CDS_pept        150403..152382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0120"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87391"
FT                   /db_xref="GOA:Q0SWP3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP3"
FT                   /protein_id="ABG87391.1"
FT                   /translation="MYFKLAFKNIKKSYKNYVIYFLTLIFGICIFYTFNSIESQSVMME
FT                   LNEQKQSAFMMAEQLIGYFSVFIAFVLGFLIVYANNYLIKRRKKEFGIYMTLGMENGSL
FT                   SKMIFLETLFIGAISLGIGVVLGIMLSQALSVLTAYMFQVDLTKFQFVFSPLGFKRTVL
FT                   CFSIIYLVVLIFNFISVRKIKLIDLLTASKRNEKPTIKNLWVSVILFLVSVGILGIAYY
FT                   KVIHDGIAFASFNALGLPILLGCIGTFIFFYSLTGFFLKVIQGNKKFYLRDLNMFVMKQ
FT                   ISSKINTTFVSLSFICLMLFLAICTFSGGLGINRAINADLKDLTKFDVTFWSNSGENIE
FT                   SLLKEKNIDISNIAKEDSNMVMYDSEVKYSDFLSKEGMTAMKNYFPVANDNDTLVIGEN
FT                   GYNNTLKLLGKEPVNLKENQYLAVGNIDEMKKWVNESLESGKKINISGKTLEPANKKYE
FT                   NINLYNFTMKGDILILVVKDFLLEGLKPVSSRFNMMLKDNSNTKEELENVRDKLVESQV
FT                   YSITKKEIYDNAAGLGATMAYLGIYLGLIFIITSAVVLAIQQLTESTDNVERYRLLKEI
FT                   GVDQKMINKAIFTQVGVYFMLPLSLAIVHSIVGLKISSTIVGVFGNASIIPNIIITAII
FT                   FVIIYGGYFLATYLGAKKNINERS"
FT   gene            152671..152883
FT                   /locus_tag="CPR_0121"
FT   CDS_pept        152671..152883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F69799"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86933"
FT                   /db_xref="GOA:Q0SWP2"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP2"
FT                   /protein_id="ABG86933.1"
FT                   /translation="MEQLNRKEIIELVNIIRNPKEEWSEAMIDELIFKLERNVIYPNPS
FT                   DLIFYTELSAEEIADKILDYKPILL"
FT   gene            153171..153497
FT                   /locus_tag="CPR_0122"
FT   CDS_pept        153171..153497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP1"
FT                   /protein_id="ABG86401.1"
FT                   /translation="MSKYIYDENVFLKIDNFDNIYFEEKDSVLNIRLVKIEDGLVKEFF
FT                   EDDLKFDLSKYNNTKEELNKSLVYELKNEFLDFMDNEKEKIFDVIINLKELKEELINKE
FT                   VSLV"
FT   gene            153732..154748
FT                   /locus_tag="CPR_0123"
FT   CDS_pept        153732..154748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0123"
FT                   /product="C4-dicarboxylate transporter family protein"
FT                   /note="identified by match to protein family HMM PF03595"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86131"
FT                   /db_xref="GOA:Q0SWP0"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWP0"
FT                   /protein_id="ABG86131.1"
FT                   /translation="MKKYLDKLQNIPIGISGTCLAFITLSNSWKLKGINYFKPIAIFLA
FT                   VCMLSLMLLRLIRFPKVMYEELKNPVTGTFYPTMGMVVWLVSGFFYPYFPVVCSLLWIA
FT                   AVIYHYGIVIFYTVIRIKERKFENIMPTCFIVYTGMITGSVASKGMDGVIPQIPQIAHF
FT                   MLMFGFIFYTILLPLVLYIVFKSEILDDHKLPTVGIICSPAPLGVVGILTIEPNPNPYM
FT                   LAWLVITGLILLVVVYGYILKLFKEGFKPSYAAFTFPLAIATLSAFKLSTYFTGLGYAK
FT                   MANLFKFLGDVEIFIATYVIFFMLLNFLNMFFKAISPKLGEYVEEEEELIGGTLYSK"
FT   gene            155200..155352
FT                   /locus_tag="CPR_0124"
FT   CDS_pept        155200..155352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85633"
FT                   /db_xref="GOA:Q0SWN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN9"
FT                   /protein_id="ABG85633.1"
FT                   /translation="MIGEVLSFGYDQCAKLGYAIGFGAMEGLVIYLGLLAIIVLKLFNS
FT                   KRKAN"
FT   gene            complement(155573..156466)
FT                   /locus_tag="CPR_0125"
FT   CDS_pept        complement(155573..156466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0125"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87339"
FT                   /db_xref="GOA:Q0SWN8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN8"
FT                   /protein_id="ABG87339.1"
FT                   /translation="MNSKFKGIIFMILASAAFATMNLLSKLAVGVNSYQKTFLTNVVAT
FT                   LIVCFIIASKKGSFFGKKESRKYLLVRGVAGTLSILTNYYALDKMFLSDATILTKLAPF
FT                   FTIIFSYLLISEKITKKQFTLLIVAFAGSLFVIKPQFSTAIIPSLIGVASAAFAGIAYT
FT                   MIRVIGNKEDFWTIILSFTSIATIVMLPSMFMNTDNLTLQNILLLVGAGIAFTLGQVAL
FT                   TIAYKNAPASEISMYDYIGLIIAAIYGFIFFKEIPDFLSFTGYIIIVGSSLLNILGNKK
FT                   TSNKEINEDSSLVSTD"
FT   gene            complement(156697..157851)
FT                   /locus_tag="CPR_0126"
FT   CDS_pept        complement(156697..157851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0126"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86692"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN7"
FT                   /protein_id="ABG86692.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGA
FT                   GYDKYYKKTGSRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVKIENSR
FT                   NVDGNIKRVTVSRTQSGKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEAN
FT                   PKHFRKAEKRLIKLQRDLARKEYNSKNYHKNRIMIAKLHERIANQRTDFLQKFSTKLIR
FT                   ENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAEWYGRKIVIAPPDYASSQ
FT                   LCSECGYKNIEVKNLGLREWVCPECGTHHQRDLNASINLEKLIA"
FT   gene            complement(157862..158062)
FT                   /locus_tag="CPR_0127"
FT   CDS_pept        complement(157862..158062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0127"
FT                   /product="ISCpe2, transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86429"
FT                   /db_xref="GOA:Q0SWN6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN6"
FT                   /protein_id="ABG86429.1"
FT                   /translation="MTYVKLNNNIIKALKGVSARLLFLKHPEIKRYLCGGNLWNPSCFV
FT                   ATVSENTEEQIRNYIQNQQVK"
FT   gene            158400..159638
FT                   /locus_tag="CPR_0128"
FT   CDS_pept        158400..159638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0128"
FT                   /product="cinA family protein"
FT                   /note="identified by similarity to SP:P46323; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   PF02464; match to protein family HMM TIGR00199; match to
FT                   protein family HMM TIGR00200"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85716"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWN5"
FT                   /protein_id="ABG85716.1"
FT                   /translation="MKAEIMAIGTEILLGDIVNTNAQFLAKELANLGIGVYHQSVVGDN
FT                   SERILEAFDNAFKNCDTIITTGGLGPTKDDLSKELAAKYFNMEMCLREELLCDLEDYFK
FT                   KNNLEMTENNKKQCYFPKEAIILPNPNGTAPGAILEGENNKRIILLPGPPREMEPMFTN
FT                   HVVPYLSKFTDSVLVSKILRVFGIGESKMDDLVCDLLDNENPTVAPYAKNIDVILRITA
FT                   KGKDKEEAEKLIAPMEKEIRKRLGDNIYGEGEVTLEEVVGKLLVDKKMTVSTAESCTGG
FT                   MVASTLINYPGISEVFMEGAVTYSNEAKMKRLGVKKETLEDFGAVSEECAREMAKGIAK
FT                   NAETRIGISITGIAGPGGGTEEKPVGLVYAGLCIDGITKVKKFNFKADRQKVRTRTMMN
FT                   VLDWLRRELEKID"
FT   gene            160288..161214
FT                   /locus_tag="CPR_0129"
FT   CDS_pept        160288..161214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0129"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87776"
FT                   /db_xref="GOA:Q0SWN4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN4"
FT                   /protein_id="ABG87776.1"
FT                   /translation="MKPIFKVSLYFLIVLVLSIVGPMFVTSVLYKIGLVPPLVLMVIHI
FT                   IFFIVPAIIYIIVTKSNYKKVFSFKKPKGKDVFFSILIAALALPIMTFFSYTSSFFYTN
FT                   DVALVLDQMRVYPLWLMILVVGVTPAITEEITIRGIALSGFEFKSKNVAAIMTGIMFGI
FT                   LHLNAHQFLYATAMGIILAYVVRATGSIFLSMLIHFLINSWNLIQQRIVSQGITTEDLV
FT                   HSMDSIKNIPMELKIGVFFYYLIFAIVAAFLISYLIRKMEKRNFDITLDELDVATRVSY
FT                   KEERVINVPFIISVIVFIVYTFFIMKG"
FT   gene            complement(161508..162101)
FT                   /locus_tag="CPR_0130"
FT   CDS_pept        complement(161508..162101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87242"
FT                   /db_xref="GOA:Q0SWN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN3"
FT                   /protein_id="ABG87242.1"
FT                   /translation="MDIYDLKNYDFKNYKYSKEALENLKKVKKLSNITRLISIILVIFP
FT                   FIKYLKTDNFSYVILIFLILILARFIEYKKYTNIKLSLSKESLEDFHDFVYYFYCKKRS
FT                   KATHNMHLLDLIYCNFERKKYDIVLKLLDSLDMTSPFLQNRRFLYYYYYAKSYEELGLI
FT                   EKSKEYLLLLNDLVKRNGLSKEAAKIRGIKIIIE"
FT   gene            complement(162570..162992)
FT                   /locus_tag="CPR_0131"
FT   CDS_pept        complement(162570..162992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:162738..162740,aa:Sec)
FT                   /locus_tag="CPR_0131"
FT                   /product="HesB-like domain protein"
FT                   /note="Selenoprotein. identified by match to protein family
FT                   HMM PF01521"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85499"
FT                   /db_xref="GOA:Q0SWN2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN2"
FT                   /protein_id="ABG85499.1"
FT                   /translation="MQIYKKIITIFHFFISLKLHTIAPFLICVYNLINKVNLYIKFTKI
FT                   YKEVFILKVKIHPNTLDKVKDMLDNSDKDALRIKACSSGUAGLNIEVVLDEQRENDDVV
FT                   MDNGIKIVADKKISHFFTDATLEYKNTILGKKFKIY"
FT   gene            163211..163798
FT                   /gene="rbr_1"
FT                   /locus_tag="CPR_0132"
FT   CDS_pept        163211..163798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbr_1"
FT                   /locus_tag="CPR_0132"
FT                   /product="rubrerythrin"
FT                   /note="identified by match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86250"
FT                   /db_xref="GOA:Q0SWN1"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN1"
FT                   /protein_id="ABG86250.1"
FT                   /translation="MKSLKGTKTAENLMKSFAGECQARTRYTYFSSTARKEGYVQISNI
FT                   FLETAENEKEHAKRFYKFLKDDLQGEAVEINAAYPVELPTDTLTNLKFAADGEHDELSN
FT                   LYPSFADVADEEGFPEVAAAFRMIAKAETAHYNRFMKLAKNMEEGKVFKKDEVVLWKCG
FT                   NCGFIWEGAEAPLKCPSCLHPQAFFEVFKETY"
FT   gene            complement(163961..164506)
FT                   /locus_tag="CPR_0133"
FT   CDS_pept        complement(163961..164506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34821.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87069"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWN0"
FT                   /protein_id="ABG87069.1"
FT                   /translation="MLYYLVALFDKVSYAIIKPLQESISNEYKLYENLPMLHITLAVIE
FT                   DPDMDKLNEVVKNTLKSYKKFEVHLNGLIKFGEPYRSVNLKVDEESGVIKKLSRELYEN
FT                   LSKEGFKLTSNPDTWQLHVSLANPYFAQRVWGEDEFESAYTKLQDYNFDRELLIDEIQF
FT                   WRPINDENKMVVFSYPLH"
FT   gene            164801..164893
FT                   /locus_tag="CPR_0134"
FT   CDS_pept        164801..164893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86105"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM9"
FT                   /protein_id="ABG86105.1"
FT                   /translation="MESKKNIFEKLKLDNILYIMYIREFKKKFI"
FT   gene            164936..165061
FT                   /locus_tag="CPR_0135"
FT   CDS_pept        164936..165061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86792"
FT                   /db_xref="GOA:Q0SWM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM8"
FT                   /protein_id="ABG86792.1"
FT                   /translation="MIESRVSRLNKKKSSKMSVLYNIVGICFLALILFVGSQMFL"
FT   gene            165329..166885
FT                   /locus_tag="CPR_0136"
FT   CDS_pept        165329..166885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0136"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="CAC3339; identified by match to protein family HMM
FT                   PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87027"
FT                   /db_xref="GOA:Q0SWM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM7"
FT                   /protein_id="ABG87027.1"
FT                   /translation="MSILIVKNMNHGFGDRAIFEDVSFRLLKGEHVGLIGANGEGKSTF
FT                   MNIITGKLMPDEGDVQWSNKVRVGYMDQHAQLEKGKTIREVLREAFQYLFDMEVEMNGL
FT                   YERMGEMSEDEITKALERTATIQDMLDHNGFYMIDAKVEEVAAGLGLRDVGLDKDVTDL
FT                   SGGQRTKVLLAKLLLETPDILLLDEPTNYLDEEHIAWLKNYLIGYENAFILISHDIPFL
FT                   NSVVNVIYHVENRALTRYTGDYDNFMRVYEANKKQLEAAYERQQAEIAKLEDFVARNKA
FT                   RVATTGMARARQKKLDKMDRIELAAEKPKPEFNFKQGRTSGKLIFEARDLVIGYDEPLS
FT                   KPLNIRMERGQKIALVGANGLGKSTLLKSLMGLIKPISGEVETGDYQSIGYFEQEIKEA
FT                   NYNSCIEEVWQEFPGYTQYEVRSALAKCGLTTKHIESSVAVLSGGEQAKVRLCKLINKE
FT                   TNILILDEPTNHLDVEAKDELKRALKEYKGSILLVCHEPEFYRDVVTDVWSCEDWTTKI
FT                   V"
FT   gene            167240..169240
FT                   /locus_tag="CPR_0137"
FT   CDS_pept        167240..169240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM6"
FT                   /protein_id="ABG87633.2"
FT                   /translation="MKLSKLRIKNYKSFKDSGTIEIKGNIFALIGQNNAGKSAIMDAIQ
FT                   VFFPNCKKSANSENFHKFTKEDISIELWFSKVNSDYLENKLFQDKIKKQNEVIKKCIET
FT                   EKYDKELKKLDEIREKELNKCILKYGIENEELYVKKIIPKESKAFYILKNNDKISEADL
FT                   KKILPELKIIPAIRDPKNESTAGTNSYLKDLIQMLDEEAQTEIMMEDKKLTYKELNEVL
FT                   SEETSKRSKELSSKITNYYSKAIGSSDFEVKVNSSVNISKGTNYSTELIDNTTNIKADI
FT                   LDCGTGYQSMVILALLETYVEIAHTNNNYILIIEEPEVYLHPRLQRKMIDTLLRVSEHN
FT                   QVIFTTHSPITISKLNSLDVKLVEREYGEAKIKNSSVKEIIDELGVRADDFLHSKGIIF
FT                   VEGKDDEIVIRELLKKLDKCIIDKINIIQAVGCSNFKWYANAEILINKNFDIPTLILRD
FT                   SDVERPEKLKKDLVEDIINSFINTPQYARYNQDEKEEIKTKINDAIKVLSQHSLEYYFI
FT                   NPNLLVQFYECKVELENAIKCYNCKYNDKMQEGLSGKDIEGKVQNYYQPKRFLEGYPDK
FT                   PSDIAKNLEPKFIEEWESYKESCNCEISELYGIDNFIKIRNVLKNNINDFNKSNDVFKE
FT                   IINIYDIKYLEENGLKELIDILKEFIIKVKI"
FT   gene            complement(169323..169484)
FT                   /locus_tag="CPR_0138"
FT   CDS_pept        complement(169323..169484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86297"
FT                   /db_xref="InterPro:IPR038733"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM5"
FT                   /protein_id="ABG86297.1"
FT                   /translation="MPRKDLKNRTPVGSAMDNKIYYEMKAYSEKTGIPISKILDKAMSM
FT                   YLESTKKL"
FT   gene            169595..170170
FT                   /locus_tag="CPR_0139"
FT   CDS_pept        169595..170170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0139"
FT                   /product="BRO family, N-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF02498"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87126"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM4"
FT                   /protein_id="ABG87126.1"
FT                   /translation="MNDLFIKKFNDEEIITLILDNRICWIAKDVAKILNYDDPSKAINQ
FT                   CIKAEKFEYGIEYEVLAGDKLKEVKRLIGVTHISYLKQTPKLVIFYEEGLYGFINYSKL
FT                   PIGISFRKWLRREVLPELRAKGTYSINKESYKDNLKYKNENLSLYTQDKLNEGRNLSLL
FT                   LEVLNLVDRITSKENEDKLRYLNDILNG"
FT   gene            171167..172339
FT                   /locus_tag="CPR_0140"
FT   CDS_pept        171167..172339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0140"
FT                   /product="nad-dependent malic enzyme"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87060"
FT                   /db_xref="GOA:Q0SWM3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM3"
FT                   /protein_id="ABG87060.1"
FT                   /translation="MNYYEESLKLHENNKGKLDVISKVKVETRDDLSVAYSPGVAEPCK
FT                   KIKENKADVYKYTCKGNMVAVVTDGSAVLGLGNIGPEASLPVMEGKAILFKEFGGVSAF
FT                   PICINSNDVDTIVNTVKLISPGFGGINLEDISAPRCFEIEERLKKELDIPVFHDDQHGT
FT                   AIVVLAGVLNALKLVNKNIEDVKVVVNGIGAAGTAICKLLLIAGVKNIIPCDKVGIITE
FT                   AMENIDYAKRDLAKIINSKKITGTLKDALKGADIFIGVSAPNILTKEMVKEMNKDAIIF
FT                   AMANPTPEIMPEEAKLGGARIIGTGRSDLPNQINNVSVFPGLFKGTLSVRASEINEEMK
FT                   IAAAMAIANSIDEKDLADDNIIPSSLDKNLVDSVAKAVANAAKETGVCRI"
FT   gene            172365..173330
FT                   /gene="mleP"
FT                   /locus_tag="CPR_0141"
FT   CDS_pept        172365..173330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleP"
FT                   /locus_tag="CPR_0141"
FT                   /product="malate permease"
FT                   /note="identified by similarity to GB:CAA57770.2; match to
FT                   protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87638"
FT                   /db_xref="GOA:Q0SWM2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM2"
FT                   /protein_id="ABG87638.1"
FT                   /translation="MLFFKSIQSVLTIILMIALGYILKKNKWFDDRFGKSISSLVVKVA
FT                   LPVSIFTSVLKHLTKDSLLQLSGSLIYPIGTVILSYIIAYICIKIFKIKPGRRGIFMNA
FT                   IANANTIFIGLPLNIALFGNISITFFLVCYISNTVSTWAFGILLIANDDPTKDKSSTHQ
FT                   KINIKKIISPPLIGFLIGLIFLAFSIPVPEFIGSALSYLGSIVTPLALIYIGIILSDAG
FT                   LSSIRFDRDTILALIGRFIISPLIIIVLILIGTNIFSSNLPKLLIQTFVVQADTPMLAV
FT                   LPILANEYHCDVKYATNLVTTSTVLFVIVVPVLMLITQYI"
FT   gene            complement(173401..174294)
FT                   /locus_tag="CPR_0142"
FT   CDS_pept        complement(173401..174294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0142"
FT                   /product="malolactic regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85552"
FT                   /db_xref="GOA:Q0SWM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWM1"
FT                   /protein_id="ABG85552.1"
FT                   /translation="MNIRDFEYFDCLCSTKSFTKAAEKLYISQPSVTLSLSRLERELDS
FT                   KLIIRDHSNKEIQITESGEILRKRIKNILREIEEAKLEIRKVKNKKIKFGIPPIIGAYF
FT                   FPKFIEELISKSFIENIEFVQAGSVKMKELLLDGKIDIALIGSLEPIRDKKIESYLLKK
FT                   ESFVICISKNNKLLREKSLNFEKLKNEQFIVLSDEYLHLGVLKKLLNKYNIESQKIYYT
FT                   DEIQTAKSLIAANLGVGIMTKMSVEDLVGIQRKPLKDDIKFHVSIVTKKEHYLTDVEKS
FT                   ILDLIKEKNKEINSCI"
FT   gene            174754..175314
FT                   /gene="kptA"
FT                   /locus_tag="CPR_0143"
FT                   /note="CPE0144"
FT   CDS_pept        174754..175314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kptA"
FT                   /locus_tag="CPR_0143"
FT                   /product="RNA 2'-phosphotransferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF01885"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86196"
FT                   /db_xref="GOA:Q0SWM0"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWM0"
FT                   /protein_id="ABG86196.1"
FT                   /translation="MKNNDSKISKYISLILRHKPEEIGLKLDEHGYLVVLDLIEGINKS
FT                   YEGFSMDDLERIVREDSKGRYSFNEDKSKIRANQGHSIKVDLGLEEIKPPKVLYHGTGR
FT                   KYLESILKNGLIKKERQYIHLSKDRETASIVGKRHGDLVILEVDSESMFNDGIKFYLSK
FT                   NNVWLCNYVPKKYIKELNLEEVF"
FT   gene            175735..177909
FT                   /locus_tag="CPR_0144"
FT   CDS_pept        175735..177909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0144"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF05737;
FT                   match to protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86767"
FT                   /db_xref="GOA:Q0SWL9"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL9"
FT                   /protein_id="ABG86767.1"
FT                   /translation="MKNSKNFNIFTLWSVVISMILIMISPGSIVLGEETKSVQNDGAVE
FT                   ITSTTFESNTVAKGISNNLRIDYKILNKDKLKDGDKIVISLPDIFKDIEPKCHDQHFKD
FT                   FDVKDGVVTLTFNENVEKAVTGYMIIRFVGNSNIRKGVSYPVSIDLNGKPSTVYITGEE
FT                   YSNSSSGGQYPLMYKTADLPTAATDKEQGREYYGEIVDRNKPIKYFVEINLGDGVNPNT
FT                   RSYLSNADFFDNIPKGMALDINSICIKRMGYYDERSSDVTKDFWESNRIKADTKHLEIN
FT                   FGDIRYERYTIIYETRITSTESGYLNDAKLYYDDDKELPSKHYSKLSKDAGALNVYKYV
FT                   DKTKVTNNPNDQKIKYDIKFDSYGYFFKDTLNIIDKLDPRLSDIKITATDQFITDFYEN
FT                   TKELVIKNSNGDIDAKKPAYITIEASMKNVGPGEVVKNIAYVNGNPTNEVSTRKNPIVE
FT                   IIKVSKDDVESNLLEGAVFKLTTKDGKTVKDVYNQLVKTFTTNSEGPIRFELPNGDYKL
FT                   EEIKAPNGYKLDQTPIEFTVNDESKIVKVVAKDDPLSTTCNLVINKINEKEIPILGAKF
FT                   KLFEESNPKKVLKFSSQKNNYELNQNGVGKLTPSGKNASFKINNLPYGNYILKEVQAPK
FT                   GYKLSDDIYITLGFEESFYRVGKEGEKIILNKNTETNTYDISVKNVPRIILPETGGCGT
FT                   SKFSLIGITLLAGVLSIVSTTKFVLKEREN"
FT   gene            177913..179481
FT                   /locus_tag="CPR_0145"
FT   CDS_pept        177913..179481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0145"
FT                   /product="putative surface protein"
FT                   /note="identified by similarity to GB:AAO49409.1; match to
FT                   protein family HMM PF05738"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87340"
FT                   /db_xref="GOA:Q0SWL8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL8"
FT                   /protein_id="ABG87340.1"
FT                   /translation="MKNNILKKFSFMMVFIFVFITTSIPVFAATPSISKDAPIKGSITI
FT                   SKKGATFTAYKLLDATKSGDAYEYSVNSDLKDFFNNSNYGSYSQESIQKLSGEEVKEFA
FT                   VKLHKYVLDNKKSGKELTDGQKNTVDLGYYLVTEASSDSEGAAVASTPIIVSVPQVSGD
FT                   SWNYDVTINPKDNTPILEKNIVKENQRVKTSSENIGDVVKYEVKASIPVYQKNAQDIMY
FT                   KFTDTMSKGLTYDEKTGFKVTSGDKVFAKDKDYTVEVKKQEDGETVITINFVYENIKAY
FT                   AETGITLNYQATLNKDVVISNKENLGNTNNIQLDYTNNPHVKDSYKKLTDKVTTYTFGF
FT                   GITKVDSELNSKLLQGAEFSVKDESGKTVAKYTYDEKGQVVSLSGNGVTNSKGITTFVG
FT                   LKEGKYLITEEVAPSGYSLLKNPVEVTITANKDESGKYTGAATIEISNGNKAGQIINDI
FT                   SENDGNILFNVQIENHAGFSLPSTGGLGNTGFIKIAIILLSIVCVLSILGLGYTKFENS
FT                   RKTKN"
FT   gene            179660..180481
FT                   /locus_tag="CPR_0146"
FT   CDS_pept        179660..180481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0146"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85560"
FT                   /db_xref="GOA:Q0SWL7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL7"
FT                   /protein_id="ABG85560.1"
FT                   /translation="MKRLKRIYFSILILITLIALGFLLYPSFSNYINNKFAVSTISDYT
FT                   EKINNVKDEEVDDLIKNINKYNYDLFNGTAENQLPDYLNIHEGDVLGYIEIPSINIKLP
FT                   IYYGTSVDILKKGVGVLEGTSLPVGGENTHSVLSAHTGLANQKLFTDIDKLKDGDVFYL
FT                   HILKKDLAYKVNQIKVVHPDEIDELKISDDKDYVTLLTCYPYGINTERLLVRGERTDLS
FT                   PSNVEQVQKEISTFNHSNENLILIVIILNSVLIIIFLLFLIMKFKGKNKSR"
FT   gene            180611..181177
FT                   /locus_tag="CPR_0147"
FT   CDS_pept        180611..181177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86139"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL6"
FT                   /protein_id="ABG86139.1"
FT                   /translation="MKEHAIFLEAGLGPKNSKLAKELDKCKGNLEKLLFDVVKLSKGRV
FT                   RQSIVDSGEVFTEYTLETEKKTEHYTGININSKITTMEKDLMCAPKKGIDSKVASCVKD
FT                   INNKAIKLIDELIDLKMKILDDVLCCKIFTSNYPSLVEHTIEEAKLYRSYIDEVDISKT
FT                   EAFWNEIMMEHSLYILIYLLFFMII"
FT   gene            181726..182889
FT                   /locus_tag="CPR_0148"
FT   CDS_pept        181726..182889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0148"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86760"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL5"
FT                   /protein_id="ABG86760.1"
FT                   /translation="MKRAYKIEINPTDEQMFKIQQTIGVSRFVYNLYIARNKEIYEKEG
FT                   KFVSGMEFSKWLNNEYIPNNQEMNWIKEVSSKATKQAIMNGDKAFKDFFKKAKGFPRFK
FT                   KKKNQDVKAYFPKNNKTDWTIERHRVKIPTLGWVRLKEFGYIPINSIVKRGTVSQKADR
FT                   YYVSILVEEDYKEVSKSINEGVGIDLGIKDFAICSDGNKFKNINKTYNVKKLEKKLKRE
FT                   QRRLSRKYESLKIRNKNIKEGRPTRQNIQKQVVKVQKLHKRLTNIRTDYINKTVAKIVE
FT                   QKPSYVTIEDLNVKGMMKNKHLSKAVAQQKFFEFKTKLTVKCKEKNIELRIVDRFYPSS
FT                   KTCSQCGKVKKDLKLSNRIYKCDCGLSVDRDLNASINLKNAKEYKIA"
FT   gene            183066..183743
FT                   /locus_tag="CPR_0149"
FT   CDS_pept        183066..183743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0149"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87278"
FT                   /db_xref="GOA:Q0SWL4"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL4"
FT                   /protein_id="ABG87278.1"
FT                   /translation="MKKKSLIILSIIVLIFVCITLYLTREHIMVFYKLITNGEVIKSYL
FT                   ERFGPWAAIIFFIFQILQVVIFFIPGEVIQAAGGYIFGALGGTLLSFFGIAVGSAILFY
FT                   ICQKFGKKLVQRFVPKDMYDKLEKILNSPKFKLILVILFFLPGAPKDSLIMVCALSNIT
FT                   IGHFIIFSMIGRIPALVASSFMGANLAEGNIVGVIIIGVIALIACTLGVIFRKDIFKYM
FT                   EKL"
FT   gene            184413..185069
FT                   /locus_tag="CPR_0150"
FT   CDS_pept        184413..185069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0150"
FT                   /product="conserved domain protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87798"
FT                   /db_xref="GOA:Q0SWL3"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL3"
FT                   /protein_id="ABG87798.1"
FT                   /translation="MNKEKLKSVFTSKIAIGIICFIIGGIALGNSNSGVNLTKERYDQL
FT                   LEFEKVALQKDGETVETLNEELTEENLDNKINEKTEKGKKTLGIGETAYINDKNGVKSM
FT                   AITIDNVKLTNERNQFSEKEAEKVVVIEYTYENIAGEENLYVFDSNFKVYDASGNVLET
FT                   YPAGAEKYPQAISKGKKCTANMSFALNNESNNLEIEFYDNMFDGKASEVFNISAE"
FT   gene            185146..185739
FT                   /locus_tag="CPR_0151"
FT   CDS_pept        185146..185739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0151"
FT                   /product="protein T24A6.7"
FT                   /note="identified by match to protein family HMM PF08719;
FT                   match to protein family HMM TIGR02464"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85925"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL2"
FT                   /protein_id="ABG85925.1"
FT                   /translation="MRYSVEGVCEKFKSGEKLEFLFFWGHTKNKNGKITKACFSQWYLS
FT                   DFTVNGVLYNCAEKYMMAEKARLFKDYETLEEILSAENQKEIKDLGRKIKNFNEELWNR
FT                   EKYEIVKRGNLAKFSQNENLKEFLLNTGDKIIVEASPYDSIWGIGMGAKDENIEDPTAW
FT                   KGENLLGFALMEVRDLLNKRSTFINCRKFFNNFI"
FT   gene            186214..187245
FT                   /locus_tag="CPR_0152"
FT   CDS_pept        186214..187245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0152"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86349"
FT                   /db_xref="GOA:Q0SWL1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL1"
FT                   /protein_id="ABG86349.1"
FT                   /translation="MQVLIGAGLLLIVLGLFTLFSYKAPHGMKAMGALAGAACASFLVE
FT                   AFHSSFFGNVLNIEFLKKVGDANGSLGGVAAAILVPLALGVSPVYSVLIGLSCSGLGIL
FT                   PGFIAGYLMSFVVKFLEEKLPSGLDLIVIIVVATPLTRIIGDFTAPVVDSTLLKIGQVL
FT                   IASANSNPITMGIILGGIITVVATAPLSSMALTAMLGLTGAPMAIGALSVFGSSFLNFV
FT                   LFQKMKFGSKKDTISVAIEPLTQADIITANPIPIYVTNFIGGALCGIIIVLMGLTNMSP
FT                   GTATPIAGFAVMFAYNPAFKVLMASLACVVVSAGSGYLGYLLFKNYKIHTVDEIRGNDL
FT                   EVE"
FT   gene            187437..187895
FT                   /locus_tag="CPR_0153"
FT   CDS_pept        187437..187895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87051"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWL0"
FT                   /protein_id="ABG87051.1"
FT                   /translation="MKLAEALILRADLQKELMSLKNRINQNLLVQEGEKPSENPYTLYD
FT                   EILLKVSELEGLILKINKTNSNYITSNNESISDLIVKRDMLGKKISILKEIAEEATVKV
FT                   NRYSQTEIKIFSAMKVDQLQREINKYSKEYRELDTKLQGLNWTIDLME"
FT   gene            187966..188184
FT                   /locus_tag="CPR_0154"
FT   CDS_pept        187966..188184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD62162.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85378"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK9"
FT                   /protein_id="ABG85378.1"
FT                   /translation="MLVAFIKEVINPNLGKKVIIHVSRSRYLFYNLCSNKLHGYYLRIT
FT                   IYNHMTINNKRGWGKGIQFKEDRVMIH"
FT   gene            188938..190425
FT                   /locus_tag="CPR_0155"
FT   CDS_pept        188938..190425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0155"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86110"
FT                   /db_xref="GOA:Q0SWK8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK8"
FT                   /protein_id="ABG86110.1"
FT                   /translation="MSERKRSLSSGALMLMTFTAVFSFGNIIDSSVNIGLATIPSYIFG
FT                   TVFYFLPFALMIGEFASASSDSESGINSWIKKSLGARWAFLGSWSYFFVNLFFFTSLLP
FT                   KILIYASYTFVGRNVFDGKTVLISVISIVLFWAVTIISTKGVSWISKITSISGVARIIL
FT                   GLGFIVLSFGVILFLGKAPAQEFTAETIMPKFNWSYFMVLAWILQAVGGAESIGVYIKD
FT                   VKGGNKTFIRTMVISTAIVGGLYALGAVSVGLVVPSEVLQGNFSNGLFDAFAILGANYG
FT                   VGNIITNIVGFIMMLASLGSLVLWTAAPVKVLFSEIPEGIFGKWIAKTDKKGTPVNALY
FT                   VQAVIVTVLLLVPALGIGSVDSLLEMLINMTASTSLIPVLFFLVGYIVLRAKKDDMERS
FT                   FKVGSKNFGIAIGVLLLALFVFVFVISSIPAPQDFAAYFNGTLAEGATNPVFVLLYNVL
FT                   GLVFFLGFAEICWRKYEKKVGKAVANEWDQEEVSEIA"
FT   gene            190582..192651
FT                   /locus_tag="CPR_0156"
FT   CDS_pept        190582..192651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0156"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF02449;
FT                   match to protein family HMM PF08532; match to protein
FT                   family HMM PF08533"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86644"
FT                   /db_xref="GOA:Q0SWK7"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK7"
FT                   /protein_id="ABG86644.1"
FT                   /translation="MKNYGPISSKVTKMLHGADYNPEQWIDIPNIWGEDVRLMKLSHTN
FT                   VVAVGIFSWTMLEPEEGKFNFEWLDEIMDLMHKNGNYVILATPSGAKPIWMAHKYPETL
FT                   RVAPNRVRNLYGERHNHCYTSPIYREKIAIIDRLLAERYKDHPALILWHISNEFEGQCY
FT                   CPLCEQAFRDFLRKKYDNDINKLNKAWWTKFWSHTYASFDEIEAPAPHGEPALHGLNLD
FT                   WMRFVTHQTLDYYKHERSILKEITPDIPVTTNFHDYISLFRGIDYWKFAPYLDVVSWDN
FT                   YPYWHGERTDDHEGSRIGFIHDLNRAILNGKPFMMMESSPSSTNWQPVAKLRRPGMHVL
FT                   SSLQAVAHGSDTVQYFQWRKSRGSSEKFHGAVVDHCGHENTRVFRDVTKVGEILSKLDD
FT                   VIGTSVEPQVAVIYDWENYWAINDAQGPRIEQKDYFETCQKHYKAFWDMSIPTDVINMD
FT                   CDFSKYKVVVAPMLYMVRPGVGERLEEFVNNGGTLVTTYWSGIVDENDLCFLGGFPGPL
FT                   KKVTGIWAEELDALYDEDVNYVSIEEGNSLGMKGEYEARIFCDLIHSEGAEILATYKTD
FT                   FYKGMPALTCNNFGEGQAYYIAFRNNDEFLSDFYSSLAKKLTLKRAIEIDLPNGINAQV
FT                   RMDEKNEFVFFMNFSSEEKTIDIKDLDLTDMVTGEKVTKEMEIEPYGVRIVRRK"
FT   gene            193204..194445
FT                   /gene="arcA"
FT                   /locus_tag="CPR_0157"
FT   CDS_pept        193204..194445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="CPR_0157"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87611"
FT                   /db_xref="GOA:Q0SWK6"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWK6"
FT                   /protein_id="ABG87611.1"
FT                   /translation="MRDDRALNVTSEIGRLKTVLLHRPGEEIENLTPDLLDRLLFDDIP
FT                   YLKVAREEHDAFAQTLREAGVEVLYLEVLAAEAIETSDEVKQQFISEFIDEAGVESERL
FT                   KEALIEYFNSFSDNKSMVDKMMAGVRKEELKDYHRESLYDQVNNVYPFVCDPMPNLYFT
FT                   RDPFATIGHGITLNHMRTDTRNRETIFAKYIFRHHPRFEGKDVPFWFNRDEKTSLEGGD
FT                   ELILSKEVLAVGISQRTDSASVEKLARKLLYYPDTSFKTVLAFKIPVSRAFMHLDTVFT
FT                   QVDYDKFTVHPGIVGPLEVYAITKDPEKDVQLIAVEECDTLENILKKYLKRDIELIKCG
FT                   GGDEIIAAREQWNDGSNTLAIAPGEVVVYSRNYVTNEILEKKGIKLHVIPSSELSRGRG
FT                   GPRCMSMPLIREDL"
FT   gene            194553..195548
FT                   /gene="argF"
FT                   /locus_tag="CPR_0158"
FT   CDS_pept        194553..195548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="CPR_0158"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85583"
FT                   /db_xref="GOA:Q0SWK5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWK5"
FT                   /protein_id="ABG85583.1"
FT                   /translation="MAVNLKGRSFLTLKDFTPAEIRYLLDLSHDLKAKKRAGILGDSLK
FT                   GKNVVLLFEKTSTRTRCAFECGAAEEGAHVTFLTNSQMGKKESIEDTAKVLGRMYDGIE
FT                   FRGFKQSTVEELAKHAGVPVWNGLTDADHPTQILADFLTIEEHAHKPLSEIKLVFTGDT
FT                   RNNMSYALMYGAAKMGMHFVALGPDSLKPDEDILKEMQEYSKETGATIEFSSNVDEAVK
FT                   GADVIYTDIWVSMGEDESLYPERVKLLTPYKVTREMMNKTGNKNTLFMHCLPSFHDEDT
FT                   EVCKDMMDRLGLDIREVEDEVFRSKNSVVFDEAENRMHTIKAVMVATAGK"
FT   gene            195692..197128
FT                   /gene="arcD"
FT                   /locus_tag="CPR_0159"
FT   CDS_pept        195692..197128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="CPR_0159"
FT                   /product="arginine/ornithine antiporter"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03845; match to protein
FT                   family HMM TIGR00905"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85788"
FT                   /db_xref="GOA:Q0SWK4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR022461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK4"
FT                   /protein_id="ABG85788.1"
FT                   /translation="MAEQHNESKKLGFAQLAALIVGSMIGGGAFNLPSDMARGAGTGAV
FT                   IIGWIITGIGMIALAFVYQSLANRKPELTGGVYSYAKAGFGEYIGFNSAWGYWLSAWIG
FT                   NVSYSVLLFGAVGYFLPMFGAGNNVASIIGASVLLWAFTLLILNGVSGAALINLITTIA
FT                   KLVPIFLFIVISLFMFNFDKFTFQFWGTSDLGGIVTQVKSTMLVTLWCFIGIEGAVVVS
FT                   GRAKKQSDVGKATVLGLIGTLIIYMLITLMALGVMDRVKLSGLENPSMAYVLEFAVGKW
FT                   GAVLINLGLIISLFGSLLGWALLAAEIPYVAAKDGVLPKVFAKLNKKGTPSGSLIITNL
FT                   LVQAFLILTLVASSTYQALYSVASTAILVPYLLSAMYGFKLALTGETYDKDPTGRTRDK
FT                   IFGGIATVYAIWLCYAAGLKYLLLCFILYAVGIIFFYIGKKQNNKDSVVFVGKEKILAI
FT                   IVLVIAIIAIVMLFNGAITI"
FT   gene            197182..198126
FT                   /gene="arcC"
FT                   /locus_tag="CPR_0160"
FT   CDS_pept        197182..198126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="CPR_0160"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86292"
FT                   /db_xref="GOA:Q0SWK3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK3"
FT                   /protein_id="ABG86292.1"
FT                   /translation="MKIVLALGGNALQKDSKDKSAEGQLETCRQTAVSVADLIEDGHEV
FT                   SIVHGNGPQVGQILASIELAHQVDNGNPLFPFDVVGAFSEGYIGYHLQNTIREELSKRG
FT                   IKKSVDTIITQVIVNKNDPGFKNPTKPIGSFYTKEEAEKLEKDKGYTMKEDAGRGYRRV
FT                   VASPKPVDIVEKEAIKNMVYSGFVVIACGGGGIPVVEDGDRLEGVPAVIDKDFAAEKLA
FT                   EILDADALLILTAVDRVCVNFNKPDQKALKEINLEEVDKYIEEGQFAPGSMLPKVEACK
FT                   KFVLSGDKKVAIIASLTNAKAALRGQSGTKIVK"
FT   gene            198199..198654
FT                   /gene="argR_1"
FT                   /locus_tag="CPR_0161"
FT   CDS_pept        198199..198654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR_1"
FT                   /locus_tag="CPR_0161"
FT                   /product="arginine repressor"
FT                   /note="identified by match to protein family HMM PF01316;
FT                   match to protein family HMM PF02863"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87848"
FT                   /db_xref="GOA:Q0SWK2"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK2"
FT                   /protein_id="ABG87848.1"
FT                   /translation="MSNLEKSLRHEVILDIIKSKCICKQEELIIELKECGINVTQATLS
FT                   RDLHEMNIIRKSFENHEHRYIVTKEDKFIKKFKSIFRSSVRSVSMQEYFISVNTLDGMA
FT                   SLIGEFIDRLGDGRIAGTVAKKNHILVLCRSVNATQQIFKELDSLRL"
FT   gene            199196..202510
FT                   /gene="colA"
FT                   /locus_tag="CPR_0162"
FT   CDS_pept        199196..202510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="colA"
FT                   /locus_tag="CPR_0162"
FT                   /product="microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="identified by similarity to SP:P43153; match to
FT                   protein family HMM PF00801; match to protein family HMM
FT                   PF01752; match to protein family HMM PF04151; match to
FT                   protein family HMM PF08453"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87113"
FT                   /db_xref="GOA:Q0SWK1"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWK1"
FT                   /protein_id="ABG87113.1"
FT                   /translation="MKKNLKRGELTKLKLVERWSATFTLAAFILFNSSFKVFAADKKIE
FT                   NSNNGQITREINADQISKTELNNEVATDNNRPLGPSIAPSRARNNKIYTFDELNRMNYS
FT                   DLVELIKTISCENVPDLFNFNDGSYTFFSNRDRVQAIIYGLEDSGRTYTADDDKGIPTL
FT                   VEFLRAGYYLGFYNKQLSYLNTPQLKNECLPAMKAIQYNSNFRLGTKAQDGVVEALGRL
FT                   IGNASADPEVINNCIYVLSDFKDNIDKYGSNYSKGNAVFNLMKGIDYYTNLVIYNTKGY
FT                   DAKNTEFYNRIDPYMERLESLCTIGDKLNNDNAWFVNNALYYTGRMGKFREDPSISQRA
FT                   LERAMKEYPYLSYQYIEAANDLDLNFGGKNSSGNDIDFNKIKADAREKYLPKTYTFDDG
FT                   KFVVKAGDKVTEEKIKRLYWASKEVKAQFMRVVQNDKALEEGNPDDILTVVIYNSPEEY
FT                   KLNRIINGFSTDNGGIYIENIGTFFTYERTPEESIYTLEELFRHEFTHYLQGRYVVPGM
FT                   WGQGEFYQEGVLTWYEEGTAEFFAGSTRTDGIKPRKSVTQGLAYDRNNRMSLYDVLHAK
FT                   YGSWDFYNYGFALSNYMYNNNIGMFNKMTNYIKNNDVSGYKDYIASMSSDYGLNDKYQD
FT                   YIDSLLNNIDNLDVPSVSDEYVNGHEAKDINEITKDIKEVSNIKDLSSNVEKSQFFTTY
FT                   DMRGTYVGGRSQGEENDWKDMNSKLNDILKELSKKSWNGYKTVTAYFVNHKVDENGNYV
FT                   YDVVFHGMNTDTNTDVHVNKEPKAVIKSDSSVIVEEEINFDGTESKDEDGEIKAYEWDF
FT                   GDGEKSNEAKAAHKYNKTGEYEVKLTVTDNNGGINTESKKIKVVEDKPVEVINESEPNN
FT                   DLEKANQITKSNMLVKGTLSQNDYSDKYYFDVAKKGNVKITLNNLNSVGITWTLYKEGD
FT                   LNNYVLYATRNDGTELKGEKILEPGRYYLSVYTYDNQSGAYTVNVKGNLKNEVKEVEKD
FT                   SIKEVENNNDFDKAMKVDSNSKIVGTLSNDDLKDIYSIDIQNPSDLNIVVENLDNIKMN
FT                   WLLYSADDLSNYVYYANADGNKLSNTCKLNPGKYYLCVYQFENSGTGNYTVNLQNK"
FT   gene            complement(202649..203116)
FT                   /gene="mscL"
FT                   /locus_tag="CPR_0163"
FT   CDS_pept        complement(202649..203116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="CPR_0163"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87077"
FT                   /db_xref="GOA:Q0SWK0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWK0"
FT                   /protein_id="ABG87077.1"
FT                   /translation="MWKEFKEFAMKGNVIDLAIGVIIGGAFGKIVTSLVNDIIMPVIGR
FT                   LVGKVDFSNLYINLSGQQFNSLQEAQAAGAATINYGLFLNNLINFLIIAFSIFIVIKQI
FT                   NKLKNFTKKKEEVQVEATEKDCPYCCTKIDIKATRCPHCTSVLEEATNQSS"
FT   gene            203860..204483
FT                   /locus_tag="CPR_0164"
FT   CDS_pept        203860..204483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0164"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86335"
FT                   /db_xref="GOA:Q0SWJ9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ9"
FT                   /protein_id="ABG86335.1"
FT                   /translation="MNSVKYFNSIAKEWNKMRVDYFKDELREMAIKSVDISNKVIADLG
FT                   AGTGFISLGIAKKANLVFSLDSSKNMLKELYSSAKENEINNIYPIKGELENLPLFDDSI
FT                   DLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEMFDTWLGFNYD
FT                   QLINWFEKAGFKNISIKNTGLVARGESSFGEVIEPGIFMSIAKK"
FT   gene            204547..205701
FT                   /gene="metC"
FT                   /locus_tag="CPR_0165"
FT   CDS_pept        204547..205701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="CPR_0165"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="identified by similarity to GB:AAF14695.1; match to
FT                   protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86840"
FT                   /db_xref="GOA:Q0SWJ8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ8"
FT                   /protein_id="ABG86840.1"
FT                   /translation="MKKNSLLIHGGISIDEKTGAVNIPIYQTSTYKQRSFGENSGYEYS
FT                   RTGNPTRESLEKLIADIEYGKRGFAFASGLAAITAVLSLFKSGDKLLITNNLYGGTFRV
FT                   IDKIFSNFGIGYEIIDDFNNIEEKIDKSVKAIYIETPTNPLLDVIDIKIASDKAKKYNL
FT                   LTIVDNTFMTPYFQNPLNLGADIVIHSATKYLGGHSDLVAGLVVVKDEELGEKIHFIQN
FT                   STGGILQPFDSFLLIRGIKTLSVRMDRHELNANFIAEKLGDLEGIDNVYYPGLKTHIGH
FT                   EIQKKQASGFGGIISFTLNKKYNYEKFFNSLELITFGESLGGVESLACHPASMTHAAMP
FT                   LELRERIGITDRLIRISVGIEDKEDILEDIQQALVKAGDKNEIL"
FT   gene            205688..206596
FT                   /locus_tag="CPR_0166"
FT   CDS_pept        205688..206596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0166"
FT                   /product="cysteine synthase family protein"
FT                   /note="identified by similarity to SP:P37887; match to
FT                   protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85476"
FT                   /db_xref="GOA:Q0SWJ7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ7"
FT                   /protein_id="ABG85476.1"
FT                   /translation="MKYYNDIRDLIGNTPILKLNNISTKEGVNIYAKIEGTSPGGSCKD
FT                   RVGIYMIEKAEKEGKLKPGSTIIEATAGNTGIGIALAAINKGYKIIFIVPDKFSIEKQK
FT                   IMKALGAEIINTPKEEGMEGAINLANSLLSEIPNSLSLNQFKNEANPLAHYETTGRELY
FT                   DGLDGQIDYFVAGAGSGGTISGVLKFLKENISEVKGILADPVGSIIGGGQCGTYKIEGI
FT                   GNNFIPETMDMSLVDDVIKINDEEAFDAVKLLAKKEGLIVGSSSGAAFAAALKLAEKID
FT                   KGNIVTIFPDRGDRYFSTDLF"
FT   gene            206694..207149
FT                   /gene="luxS"
FT                   /locus_tag="CPR_0167"
FT   CDS_pept        206694..207149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="CPR_0167"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87307"
FT                   /db_xref="GOA:Q0SWJ6"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWJ6"
FT                   /protein_id="ABG87307.1"
FT                   /translation="MVKVESFELDHTKVKAPYVRKAGIKIGPKGDIVSKFDLRFVQPNK
FT                   ELLSDKGMHTLEHFLAGFMREKLDDVIDISPMGCKTGFYLTSFGDIDVKDIIEALEYSL
FT                   SKVLEQEEIPAANELQCGSAKLHSLELAKSHAKQVLENGISDKFYVE"
FT   gene            207441..208595
FT                   /locus_tag="CPR_0168"
FT   CDS_pept        207441..208595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0168"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87137"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ5"
FT                   /protein_id="ABG87137.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGA
FT                   GYDKYYKKTGGRPKFKSKKNEIQSYTTKLVKTKGNVNIEIVGKRIKLPKLGLVKIENSR
FT                   NVDGNIKRVTVSRTQSGKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEAN
FT                   PKHFRKAEKRLIKLQRDLARKEYNSKNYHKNRIMIAKLHERIANQRMDFLQKFSTKLIR
FT                   ENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAEWYGRKIVIAPPDYASSQ
FT                   LCSECGYKNIEVKNLGLREWVCSECGTHHQRDLNASINLEKLIA"
FT   gene            209320..210294
FT                   /locus_tag="CPR_0169"
FT   CDS_pept        209320..210294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0169"
FT                   /product="alpha/beta hydrolase domain protein"
FT                   /note="identified by similarity to GB:BAB94482.1; match to
FT                   protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86388"
FT                   /db_xref="GOA:Q0SWJ4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ4"
FT                   /protein_id="ABG86388.1"
FT                   /translation="MWFKKLYVGTIDLLSAIVEKIAKCNLACKIYKAVFQLGVFPKPKN
FT                   FNEIVSNLVIEKDIIYESSILEGNKLDVYYPKNLNKKAPILMWIHGGGYIANSKETVKN
FT                   YMMTLANKGFVVFNIDYALAPKYKYPSQIVQCNEALKYVFENAEKFNGDRENIFIGGDS
FT                   AGAQMASQLVAIISNEELSNKMNLKPSITNKFLRGVILFCGLYNMDSLRETKFPGIKTY
FT                   MEALTGESDFENYERIDELSTIKYITPNYPSTFITVGDIDPFVDQGKELASSLRALGVN
FT                   VVSRFFENKGLWHEYQFKFSIPESRETFKSIIKFLNDNSKSSN"
FT   gene            complement(210570..211361)
FT                   /locus_tag="CPR_0170"
FT   CDS_pept        complement(210570..211361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL97274.1; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87193"
FT                   /db_xref="GOA:Q0SWJ3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ3"
FT                   /protein_id="ABG87193.1"
FT                   /translation="MKRYARIYVQFLKQYLKTLLEYKEDFIYGILGFFLVQATSIIFIS
FT                   LIFNNVPTLSGWSFYEIIFIYGFSQIPRGIDHIFTDYLWIFSGRSIVRGEFDRYLLRPL
FT                   NPLFQVIAERFQPDGFGELVVGFILVVYSAIKLSVNITLLWIIGFIIAVIGGTLIYTGV
FT                   KLATASIAFWTKTSFRHVQMAYGLSDFSKYPISIYPGAIKFLLTFIIPFAFTGYYPGTY
FT                   LLGKESFFMGVILTLIVGILSIVVSYRIWFKGVSSYESSGN"
FT   gene            complement(211366..212184)
FT                   /locus_tag="CPR_0171"
FT   CDS_pept        complement(211366..212184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0171"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by similarity to GB:AAS39523.1; match to
FT                   protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87021"
FT                   /db_xref="GOA:Q0SWJ2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ2"
FT                   /protein_id="ABG87021.1"
FT                   /translation="MDFFKTIRVYSSFAKGTFKALSSYKANLLMGLIGQLIMISVTYFL
FT                   WIAIYSSSQEGIMNGFTLKEMLTYVMITLLIGIVTSNDISQEISFEVRDGSISTNLIKP
FT                   INYRLRIIFIGIGNFIFFFLTLFLPGAILISTYAILNGININLASILIFLISIILGCLI
FT                   NIYYSYIFGLLSFKFYNIWGISQIARAIIMLVSGAMIPLTFFPEIVQKLFNFLPFSSII
FT                   YTPAMIYLNKLSCSQIAKSLGLQLIWVVILMVLSKIMWNKVIDKLTIQGG"
FT   gene            complement(212187..213212)
FT                   /locus_tag="CPR_0172"
FT   CDS_pept        complement(212187..213212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0172"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86311"
FT                   /db_xref="GOA:Q0SWJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ1"
FT                   /protein_id="ABG86311.1"
FT                   /translation="MIKVKNLTKEFKIRKKESGLKGAFKSLFSSEFDSKTAVSNISFEI
FT                   KSGEIVGYIGSNGAGKSTTIKMMTGILTPSSGQVLVNGRVPYKEREKNAKDIGVVFGQR
FT                   TQLWWDLALSETFTILKDIYSIPDEVYEKNMKFLNKVLDLEEFMTRPVRTLSLGQRMRG
FT                   DLAASLIHNPKILYLDEPTIGLDVVVKEKVRTAIKEINKEFGTTVILTTHDLSDIEELC
FT                   KRIIIIDKGTKIYDGSLDDIKKKYGYMTTLEIQSKKDFKTLLNIKEILKSESNIPIETF
FT                   SSDDLSEYIESGKLIITFNKNKITSSKIISKVIERVDVLDFLLKESSIEDIIKKIYRNE
FT                   V"
FT   gene            213523..214191
FT                   /locus_tag="CPR_0173"
FT   CDS_pept        213523..214191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0173"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87502"
FT                   /db_xref="GOA:Q0SWJ0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWJ0"
FT                   /protein_id="ABG87502.1"
FT                   /translation="MKLDRKDIIDIFNFRFATKEFTGEIIPKEDMEMIAETARLSPSSF
FT                   GLEPWKFLIVENKELIKEISEVSWGFQRQASTTSHIVIALTKAGSEVKYDSDYIRNLWI
FT                   NTKGVSEEFFEGIKDVLKNFQVGKLEADETNEKLLEWSKRQTYIALGNMMTAAAMREID
FT                   SCAIEGFDKEKVEEILAKKGLLDKEKYELTYLIAFGYRKENPNRKKSRLPKSEVIQWVE
FT                   "
FT   gene            214465..215130
FT                   /gene="nanE"
FT                   /locus_tag="CPR_0174"
FT   CDS_pept        214465..215130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanE"
FT                   /locus_tag="CPR_0174"
FT                   /product="N-acetylmannosamine-6-phosphate epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="identified by similarity to GB:AAD28762.1; match to
FT                   protein family HMM PF04131"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87344"
FT                   /db_xref="GOA:Q0SWI9"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWI9"
FT                   /protein_id="ABG87344.1"
FT                   /translation="MLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQ
FT                   GIDDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRP
FT                   NGENIKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDF
FT                   ELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDILK"
FT   gene            215167..216033
FT                   /gene="nanA"
FT                   /locus_tag="CPR_0175"
FT   CDS_pept        215167..216033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanA"
FT                   /locus_tag="CPR_0175"
FT                   /product="N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /note="identified by similarity to GB:AAD28763.1; match to
FT                   protein family HMM PF00701; match to protein family HMM
FT                   TIGR00683"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85625"
FT                   /db_xref="GOA:Q0SWI8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWI8"
FT                   /protein_id="ABG85625.1"
FT                   /translation="MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGST
FT                   GENFMLSTDEKKRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVT
FT                   PFYYKFDFNEIKHYYETIINSVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGVKFT
FT                   AADFYLLERMRKAFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGIRARQIFEAAQK
FT                   GDIETALEVQHVTNDLITDILNNGLYQTIKLILQEQGVDAGYCRQPMKEATEEMIEKAK
FT                   EINKKYF"
FT   gene            216135..217652
FT                   /locus_tag="CPR_0176"
FT   CDS_pept        216135..217652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0176"
FT                   /product="sodium:solute transporter"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86232"
FT                   /db_xref="GOA:Q0SWI7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI7"
FT                   /protein_id="ABG86232.1"
FT                   /translation="MQGFTKFDLVVLVVYLGAVLYAGLKFSKKEMKGKEFFRGDGTIPW
FT                   WVTSVSIFATLLSPISFLSLAGNSYKGTWIMWFAQLGMFVAVPLTIRYFLPVYSRLNID
FT                   TAYEYLEIRYKDKGLRILGAIMFIIYQIGRMAIIMYLPSMVLSNLTGINVYLLIVAMGV
FT                   IAIIYSYTGGLKSVLWTDFIQGCVLIAGIIFSLIFLISTINGGFGAIMHELTEGGKFLA
FT                   SKEPIFNANIFKTSVFLLIVGGGLNTFSSYISSQDIVQRFTTTTDIKQLKKMTYGNLVL
FT                   SLFVATVFYLIGTALYVFYNQNPQLLQTAQQDQIFASYIAFQLPVGITGIVLAAIYAAA
FT                   QSTLSTGLNSVATSWTLDIQNFITKDMSMEKQTKVAQYISLGVGIASIIMAVILANGGV
FT                   NSAYEWFNGFMGLVLGVLAGIFVLGIFFKKATKAGAYAGFIASAIAVIVCKYGGFDVSI
FT                   WSYSIISIGVSVIVGMIVSLMTQSQLADKKTLNEATIYYNENEIVNN"
FT   gene            217750..218202
FT                   /locus_tag="CPR_0177"
FT   CDS_pept        217750..218202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P39335; match to
FT                   protein family HMM PF04074; match to protein family HMM
FT                   TIGR00022"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87090"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI6"
FT                   /protein_id="ABG87090.1"
FT                   /translation="MIFGNLINLESYNYLPELVKEALIHAKNNNVIEFEPGTHEIKGEE
FT                   LFFNRVNYTTKNKEDRFWEGHKKYIDVHVVFSGRERIDINFKENLKFKEFVEKDDFLSF
FT                   DGKENSTVVLEEGDFLICYPEDIHMTCLKADNEPSDVKKAIYKVIL"
FT   gene            218353..219240
FT                   /locus_tag="CPR_0178"
FT   CDS_pept        218353..219240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0178"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87630"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI5"
FT                   /protein_id="ABG87630.1"
FT                   /translation="MGLFAVIDIGGTSIKYGVINEDGTLLETNDRDTEAYKGGLSIIDK
FT                   VKDIIHEIKINNDIRGICVSTAGMVCPNEGKIVYAGPTIPNYTGVEVKKILEEEFNLPC
FT                   FVENDVNCAALGEFFGGAGKGTHSMACLTIGTGIGGALIIDGKVLHGFSNSAGEIGYMM
FT                   VNGEHIQDIASASALVKNVALRKDVEPSSIDGRYVLDNYENGDLICKEEVEKLADNLAL
FT                   GISNIVYLINPEVVVLGGGIMAREEVFRPLIENSLRKYLIESVYNNTKIDFAKLKNTAG
FT                   MKGAYYNFKENFNK"
FT   gene            219431..220270
FT                   /locus_tag="CPR_0179"
FT   CDS_pept        219431..220270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0179"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86425"
FT                   /db_xref="GOA:Q0SWI4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI4"
FT                   /protein_id="ABG86425.1"
FT                   /translation="MGILEQLENPKFKATKSEKTLIEYIKSDLDNIIYKSISIIAKESG
FT                   VGEATITRFTKKLGFNGFQDFKVTLAKEISNKKNTSIINLHVHRDESVTETANKMLKSS
FT                   INILEQTVKQIDLDLMCKCRDLIMNAKRVYFIGIGYSGIAATDINYKFMRIGFTTVPVT
FT                   DSHTMVIMSSITNDDDVIVAISNSGTTKEVIKTVKQAKENGTKIITLTEDSDNPLRKLS
FT                   DYELTYKSAETIFETGSISSKIPQIFLLDLLYTEVIKEMFSEAVEKKIKTTSAILND"
FT   gene            complement(220458..220847)
FT                   /locus_tag="CPR_0180"
FT   CDS_pept        complement(220458..220847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0180"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87001"
FT                   /db_xref="GOA:Q0SWI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI3"
FT                   /protein_id="ABG87001.1"
FT                   /translation="MKKGNVRTLDGIIYSLFIFMTIVTLFIIYRDIPSNAVLNFVTAYA
FT                   IFAILIPLYILIRVLFTVKHFTFEEVKKEGVKFLMFFIGIMMLNLVGDFLLPLPDLKLS
FT                   KMLPSSLVFAFGITCFDIVLSKRTK"
FT   gene            221109..223243
FT                   /gene="nagH"
FT                   /locus_tag="CPR_0181"
FT   misc_feature    221109..223243
FT                   /gene="nagH"
FT                   /locus_tag="CPR_0181"
FT                   /note="identified by similarity to SP:P26831; similar to
FT                   hyaluronidase, degenerate"
FT   gene            224119..224862
FT                   /gene="cbiM"
FT                   /locus_tag="CPR_0182"
FT   CDS_pept        224119..224862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="CPR_0182"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="identified by match to protein family HMM PF01891;
FT                   match to protein family HMM TIGR00123"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86121"
FT                   /db_xref="GOA:Q0SWI2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI2"
FT                   /protein_id="ABG86121.1"
FT                   /translation="MSKKNQVFIGFLLMFLLIPRSVSAMHIMEGFLQPKWCIAWGVITI
FT                   PFIVLGLFSIKNKVGNNPRLKILLAMAGAYAFVLSALKLPSVTGSCSHPTGVGLAAILF
FT                   GPTAASVLGLIVLLFQALLLAHGGLTTLGANTFSMAVVGPLVSYGLYKLVKKLNGPTWL
FT                   GVFLASALGDLATYMVTSVQLGLAFPAEVGGIMASVMKFMGIFAVTQIPLAISEGILTV
FT                   IIFNTIENYAKEDLMELNIFSKGVK"
FT   gene            224862..225173
FT                   /locus_tag="CPR_0183"
FT   CDS_pept        224862..225173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0183"
FT                   /product="cobalt/cobalamin transport protein CbiN"
FT                   /note="identified by match to protein family HMM PF02553;
FT                   match to protein family HMM TIGR01165"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86719"
FT                   /db_xref="GOA:Q0SWI1"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI1"
FT                   /protein_id="ABG86719.1"
FT                   /translation="MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAITQ
FT                   IDKNYEPWFSPLFEPASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKHR"
FT   gene            225157..225927
FT                   /gene="cbiQ"
FT                   /locus_tag="CPR_0184"
FT   CDS_pept        225157..225927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="CPR_0184"
FT                   /product="cobalt ABC transporter, permease protein CbiQ"
FT                   /note="identified by similarity to SP:Q05598; match to
FT                   protein family HMM PF02361; match to protein family HMM
FT                   TIGR02454"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86955"
FT                   /db_xref="GOA:Q0SWI0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWI0"
FT                   /protein_id="ABG86955.1"
FT                   /translation="MINIDKYAYASKLKNINPAEKMFFALITLCVCLWANNFIVSMLII
FT                   SIMTFLITKVGRTKIKVFIKLMMVPIAFLIIGIITIVVSYSLKQDTFLVSFKLFNGWIG
FT                   VSKSGIIQGLNMFLKVMGSLSCLYFISLTTPMIDVISVLAKLKVPSFLIELISLVYRFI
FT                   FIILETSEMMFISQNSRLGYRDIKTSYKSLGALASTLFIRSFKRANDLYTALEARGYNG
FT                   ELKVLEEQVQKRNYIYIITIIINLIFIGIAIFIK"
FT   gene            225942..226799
FT                   /locus_tag="CPR_0185"
FT   CDS_pept        225942..226799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0185"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01166"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85580"
FT                   /db_xref="GOA:Q0SWH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWH9"
FT                   /protein_id="ABG85580.1"
FT                   /translation="MEDYILKVEELNYNYSDGTHALKGINMNIKRGEVTAILGGNGVGK
FT                   STLFQNFNGILKPSSGRILFDNKPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQDV
FT                   SFGAVNMKLPEDEIRKRVDNALKRTGIEHLKNKPTHCLSFGQKKRVAIAGVLVMEPKVL
FT                   ILDEPTAGLDPMGVSEIMKLLVEMQKELGITIIIATHDIDIVPLYCDNVFVMKEGRVIL
FT                   QGNPKEVFAEKEVIRKVNLRLPRIGHLMEILKEKDGFVFDELDLTIGQARKTINSWKNK
FT                   IFND"
FT   gene            227354..227545
FT                   /locus_tag="CPR_0186"
FT   CDS_pept        227354..227545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH8"
FT                   /protein_id="ABG85628.1"
FT                   /translation="MILKIKKGEYGKMFTNELKDLLAGLYQKYGCTQEVLQLSNIIDEI
FT                   IVKEQRERLKEYYKSRKK"
FT   gene            227770..229335
FT                   /locus_tag="CPR_0187"
FT   CDS_pept        227770..229335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0187"
FT                   /product="ISCpe5, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86221"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN7"
FT                   /protein_id="ABG86221.1"
FT                   /translation="MKNIHQIVLPINLEIIIPKDDSVRLLYEVTEGLNYKKLYRSYSIL
FT                   GRNSAIDPKALFRIVVYGYMERIFSSRELEKACIRDVNFRWLLQGQKAPSHNTIARFKS
FT                   SRMKYCLEDLFNQLVLKLNEKDEIKFENLFIDGTKIEANANRYTFVWKKSTKKFEEKLQ
FT                   IKVRKLIENINKDLNITFHNENKISVSEATNLLTYIILLKEKTNLEFVYGKGKRKSKLQ
FT                   KYAEGLEDFIEKQSKYDNYNEIFNGRNSFSKTDKDATFMHMKEDHMKNGQLKPGYNIQI
FT                   GVEGEYIVGVDVSSERSDQLTLIPFLDKLKSNLSTQYKSVTADAGYESEENYLYLENNN
FT                   YEAYIKPQNYEKSKTKKFKKNIGNKENMTYLKDEDCYICANSQRLTVKSVTTKKSKSGY
FT                   KSEITIYESESCEGCKYKSSCTKAKGNKKITTSKKFAYLREKSLENIKTDKGILLRKNR
FT                   SIQVEGAFGVIKQDYGFRRFLMRGTKNVITEFLLIAFGYNINKLHRKTLEKRNGQLLHL
FT                   KNIA"
FT   gene            complement(229532..230395)
FT                   /locus_tag="CPR_0188"
FT   CDS_pept        complement(229532..230395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0188"
FT                   /product="5'-nucleotidase, lipoprotein e(P4) family"
FT                   /note="identified by match to protein family HMM PF03767;
FT                   match to protein family HMM TIGR01533"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86620"
FT                   /db_xref="GOA:Q0SWH6"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH6"
FT                   /protein_id="ABG86620.1"
FT                   /translation="MKNSKITAIVLSAIIGIGVGTGGTLVYENNQEAKQISKLEQTTKA
FT                   NAVEEIVKGNVLATLWQQNSGEVKALRYEAYNSGKRYVDELVKEPTAKPYAITLDIDET
FT                   IIDNSPHAGYEIKHNELYSKENFGEWVQMADAAAIDGAKDFTDYAKSKGFEVFYVSNRS
FT                   EEKELDATIKNMQKLGFVNSDKDHILLKTDTSSKDGRWNKIKDNYNLAIYCGDNLGDFP
FT                   DGYDNKSNEQRREIVDKEAQFFGTKYIVLPNPTYGDFENAVYGYDFKKSPEQKLEDRLN
FT                   SIKSFK"
FT   gene            complement(230618..231817)
FT                   /locus_tag="CPR_0189"
FT   CDS_pept        complement(230618..231817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0189"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87489"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH5"
FT                   /protein_id="ABG87489.1"
FT                   /translation="MNKLKIVSLFMSSFLMISAFSAPLITKANPEVNKLQEEKKQITEE
FT                   KEIKKGKLDEIKDSIDAKQAELNSAQAKVTEYEEKIKTLNNEISSTDSEISKVEKSIEE
FT                   NTTEIEKAKKEQELKKEILGERLRNVYKSNLNDKFLYMILESKNFGELFSNIANIRTLV
FT                   KTDNKLIEEIESLKNELEVRQAELETSKSTLASKKVELLSKEKSLNEVKAEHENTLNTY
FT                   KSQLNELEELESEKNAELKELADREDEIEKEIQSYFTKTPSTASPTSNSSSGFIRPVAS
FT                   STITSSYGPRVHPVTGQYKVHTGVDFAASAGTPFIAAKDGVVTAAEYHPAYGNMVIIDH
FT                   GGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPHAHFEIRINGQHVNPMDYI
FT                   "
FT   gene            232097..232753
FT                   /locus_tag="CPR_0190"
FT   CDS_pept        232097..232753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0190"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86094"
FT                   /db_xref="GOA:Q0SWH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH4"
FT                   /protein_id="ABG86094.1"
FT                   /translation="MARKSSKKYLKEANAQIILFVLIMIIMRIVVLNFMSEISGIEFDE
FT                   LSKARIYNGDITAILFLESLVNFFGNFILETYKGIILLAIINVFIASYILTKKDFTGNS
FT                   YFNIVIAYLFSAIITVFLLLTGIILFFSIMQCMVVINSLNIDVSSEILWLAIAVLVGVV
FT                   FIKYFRKSVVFSLLTFLIISVYASYYTDIGKKAINTDYTQYSLEEFANNLNLVGE"
FT   gene            238171..238246
FT                   /locus_tag="CPR_0191"
FT   tRNA            238171..238246
FT                   /locus_tag="CPR_0191"
FT                   /product="tRNA-Phe"
FT   gene            238759..239388
FT                   /locus_tag="CPR_0192"
FT   CDS_pept        238759..239388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0192"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87863"
FT                   /db_xref="GOA:Q0SWH3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH3"
FT                   /protein_id="ABG87863.1"
FT                   /translation="MKDIVIIGTENIGKEVVKIIEAINSKRNTWNVLGFISLKKDEALS
FT                   NIEGYSVLGSIDSMFNYFEGRKKDKFYFFKKLESQNELFTIIAIDNCKLKKEIEDKLKD
FT                   KIKFATIIHPDITFFNKQEVGEGTIIYPGLISVGRFKLGKHVILKQKCSLGNNIEIGDY
FT                   SFISFNSNIDSNVMVKEGAYIEANTTILANNNIDKNTYIKEGSILY"
FT   gene            239941..240210
FT                   /locus_tag="CPR_0193"
FT   CDS_pept        239941..240210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85361"
FT                   /db_xref="GOA:Q0SWH2"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH2"
FT                   /protein_id="ABG85361.1"
FT                   /translation="MNSEKKKALQCLKTAKGQIEGIIKMIEDERYCIDISNQVMASQAL
FT                   LKKANKLILQQHMHNCVKGAFENNESKDEKIEEILSVLNKLIDK"
FT   gene            241743..242324
FT                   /locus_tag="CPR_0194"
FT   CDS_pept        241743..242324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85794"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH1"
FT                   /protein_id="ABG85794.1"
FT                   /translation="MENLLKDYSNEEVLKALKIVTELKLEREQGDLPEFIRGRVSEVSE
FT                   DEFDLIQAYNYYMRELRRGSVLLSEEETEKCGFNSRLSIDVELKDLIIFLNTQPNIKTL
FT                   YSCSGHQFVRGQITFEGLLKFPQVDDFKIEYADERDETKVSFDIPERSYDYLNKLRKLY
FT                   NYFYLINYNNLKTLTRDEVSSIKIKENCTA"
FT   gene            complement(242461..244836)
FT                   /locus_tag="CPR_0195"
FT   CDS_pept        complement(242461..244836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0195"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86527"
FT                   /db_xref="GOA:Q0SWH0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWH0"
FT                   /protein_id="ABG86527.1"
FT                   /translation="MDNSIFFHIFNDDKNKLETKRIIKLSIFIVFSIFFILTLDLSYKV
FT                   LIRKNIEFIPNNSIPNFPLSLSLILGTMAYISSLIYYSSTKKDDFFIISLIYMNLSVEL
FT                   LITKGHNLIIFDKFIFIHAIFRIILLFYVAFNKKGISPLITKHKTISSVAVFLFSVITP
FT                   MINYKIFSNKLFTKDIYFYATLMTIIIILYIIACIFLSKKSLDDCELIYSFIIASILLI
FT                   ALRGLYWICEVLLPNITLLKTNNVVLLLTILSFLLAISGVFNEITTKNKKSSLLQNELQ
FT                   VFYHLVEFNTSSSIILYDNKKKVIYTNKTIRERYCKSTELKDQLKEVEKLFVDSIFIDD
FT                   SEKNATKSLFNKGNWEGKIILKNDKIVSAYIQILNVENKNYFAVNLKDITEEYTLTKNI
FT                   KRNEQLLSCINNNVQDLIISVDNNGLITYVNDSVLETLNYTYEEIIGMPIINLLGKNDE
FT                   ILNQLKLEDEEDSIKCKLVGKHSFVYVESIIRTLSDNNEIPYGKVIVAKNLTSKKRLEN
FT                   LAIKFKEAKAYEQIRNEFFANISHELRTPLNIIYSTIQLLNSKHETNYVNFNDFYGKYK
FT                   QGLKINCYRMLRLINNLIDVSKIEVGFLKADFTNRDIVFLVENIVSLVIPHSENKDINI
FT                   IFDTNVEENIIKCDPVKIERLILNLLSNAIKFTQNHGKIFVDLNISKDWVKISIKDNGI
FT                   GIPKEMQASIFDRFVQADKSLKRRNEGSGIGLSIVKSIAELHDGKIELISDGIKGSEFI
FT                   VWLPNVKLNYTEESNNLVDYITDDKNIELELSDIYEVH"
FT   gene            245815..246006
FT                   /locus_tag="CPR_0196"
FT   CDS_pept        245815..246006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0196"
FT                   /product="putative site-specific integrase-resolvase,
FT                   degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86185"
FT                   /db_xref="GOA:Q0SWG9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG9"
FT                   /protein_id="ABG86185.1"
FT                   /translation="MKNQVEFLRQYANAKGIIVDEIIEDYGSGLNYNHKKCNKLIDSCI
FT                   TNEISTIIIAHKDRFIRF"
FT   gene            246218..246457
FT                   /locus_tag="CPR_0197"
FT   CDS_pept        246218..246457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0197"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG8"
FT                   /protein_id="ABG86853.1"
FT                   /translation="MVEERDIKTSNSNIGIKISNSNTGMKISNTNSKGLGIDLGIKEFA
FT                   ICSNGNKFKNINETSTVKKVEKKLKRGKKTFKEI"
FT   gene            246681..246953
FT                   /locus_tag="CPR_0198"
FT   CDS_pept        246681..246953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0198"
FT                   /product="ISCpe4, transposase"
FT                   /note="identified by match to protein family HMM PF07282"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85572"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG7"
FT                   /protein_id="ABG85572.1"
FT                   /translation="MKNKHLSKAIASQKFFKFQTKLTVKCKENNIELRIVDRFYQSSKT
FT                   YSQCGKVKNDLKLYDRVYKCDCGFTIDRNLNASINLKNDKKYKIA"
FT   gene            247074..248171
FT                   /locus_tag="CPR_0199"
FT   CDS_pept        247074..248171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0199"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85777"
FT                   /db_xref="GOA:Q0SWG6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG6"
FT                   /protein_id="ABG85777.1"
FT                   /translation="MDIFEHILSSRNNMNAVLKQRKRLDYLDISKAFLIISVVLCHSPF
FT                   ENAYYLYWFHMPAFFIISGMLYKRGMNIKEQAIKFFVPYAIFSLIDINFNYIMYYHGNF
FT                   SLSDLIHEIIKYSYGGKATWGVFWFIPVMFVTKVVFDQLNKRLTSKKLAFLCILSYILA
FT                   HIYSMSFIPSSVTEITENQFVFWNLDAVLITLPYYALGYYITKLNIQRVFKETSTLILS
FT                   SIGVVAMFILNSSMGIGYYLNIKYSYYKDPIFDILMPVTITIFILSLSYQISKFKCKKL
FT                   FTIIGANSLVIMYLHKQIATLFMDVFNYGYIMFTIIGVCLPLLMMVLINKSIVSKFLFN
FT                   GDLTFYRKIKDIKDIEPKDIIIDNK"
FT   gene            248354..249235
FT                   /locus_tag="CPR_0200"
FT   CDS_pept        248354..249235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0200"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86360"
FT                   /db_xref="GOA:Q0SWG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG5"
FT                   /protein_id="ABG86360.1"
FT                   /translation="MTMQRKNFNNYKEVSLLIMLIPMLFILIDTLGRMNSKINNKNLFE
FT                   IIFNEIFLYREVIVKFIMAIVVIFVISKIKIIKEKFILGDFKIIIGYTTLGIISYKFFG
FT                   SEYGLSKSLDVYVMCIIAMIFILSGIREIISSIDNININIEEKSNFERLVYTRVKYLGI
FT                   IYFIIFSILIAIENLNSIMSSDFIVSLISNYNQHYNNMARVISVLGVVLIAALIIIIKK
FT                   SFSNLNLCYEEYIYIIKHKTVTEEIKKDIDFVNLKVEANKKYINNKFKKLEDKKTQVLL
FT                   KGIFDFFKNNKH"
FT   gene            249264..251462
FT                   /locus_tag="CPR_0201"
FT   CDS_pept        249264..251462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87256"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG4"
FT                   /protein_id="ABG87256.1"
FT                   /translation="MDSKKSTNYDFILKTSIERYYDLLKNAEKAWETHAALTYIALRMV
FT                   VEDLLIKLEEKYEVNRDKEDNFKNTLNKLKEYVPSWIIEYGEYIRIKGEKSANKEIDSN
FT                   LEEDSTLLALKKVHEILIWYLKNVTKEMSLEADYSFITPESIKESECDLAIDKKVLENK
FT                   EKFIISLEKQIKTNSDDEKKQEELEELLRNVKEEKKELTEKLEKKELELQEVLNSFKEI
FT                   QVKLTTYIAKDQSVEESNNKYPDFYKGFLSLQGYELRVVYAFLKSLSLGSIFLNKSKSI
FT                   FLKSQRKEFLKFIEKEVEDLKKYSDGILKLKLYYILLKLTNTPVASVADKETFDKSLDS
FT                   IVEKAYFIIESRNGFNGKVDKLEAIINYYLIVIINSLSAEINHEEDNEGKVSDIIYEVL
FT                   KTIPLDERKIILNKMNFTDISDGAIKENIRLNQVEFLKAALDCGISESSEFVIKSVFSI
FT                   YVAFQKDFDFYEFRTRHDMLRAYIGPLLLVILLKEFKISRENLVPIFVMEISISNKILR
FT                   KERREKIYYNQLVQAWLEEKEKYDKILSEKDNLEKNLKEVQEARELLLTNERKFVAEKD
FT                   NTENAIKSQWDMFKEKVLKSEEIKSFNSYEEYVRAINQKNLIEVSEEHSLKDRGIIKNL
FT                   FSLDTWKYKLNKLEISKNIKVLEEKLIEEAKESGVFENELLTIRELEKILEDKESGLED
FT                   IRVDLKENSVENEKLNRLISNSSKLMEKFKEDNFDFAK"
FT   gene            complement(251679..252494)
FT                   /locus_tag="CPR_0202"
FT   CDS_pept        complement(251679..252494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0202"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85717"
FT                   /db_xref="GOA:Q0SWG3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG3"
FT                   /protein_id="ABG85717.1"
FT                   /translation="MKFDLSKMYEKLLSWITTNGFKLVIGLILLYIGWKIINKVIKILA
FT                   NIMKSRNVDPTLTSFAEAFSEVSLKVLLVITLMSYVGFDIAGLAALIASAGLAVGLALQ
FT                   GSLSNFAGGVIILLLRPFRVNDFIEASGYSGTVERITVFYTHLVTPDNKEILIPNGTLA
FT                   NGSLINYSSKDTRRVDLIFNVGYDDDIIKVKNVLWDIINKNELILKTPEAFVGISQHAA
FT                   SSIDFTVRVWTKQEDYWKVHFSLLEEVKLRFDEENITIPYPQMDVNLTK"
FT   gene            complement(253101..253745)
FT                   /locus_tag="CPR_0203"
FT   CDS_pept        complement(253101..253745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0203"
FT                   /product="heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="identified by match to protein family HMM PF01126"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86403"
FT                   /db_xref="GOA:Q0SWG2"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG2"
FT                   /protein_id="ABG86403.1"
FT                   /translation="MNSFMMDIKNNSNDLHAVAEKTGFLKRLLEGKASTESYAEYLYNL
FT                   YEVYNAIEVNLEKCKDNKVVKDFVLPEIYRAEAILKDLKFLLGENLNTMKPLASTRAYV
FT                   ARINEIGETAPELLVAHAYTRYLADLFGGRTIYGMVKDLYKIDEEGLNYYKYETLSDGP
FT                   EMKGFVMNYHNKLNNIELNEEMKERFINEVANSYVYNIAISNELDFIRFNR"
FT   gene            254146..255369
FT                   /locus_tag="CPR_0204"
FT   CDS_pept        254146..255369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0204"
FT                   /product="putative nuclease SbcCD, D subunit"
FT                   /note="identified by similarity to SP:P13457; match to
FT                   protein family HMM PF00149; match to protein family HMM
FT                   TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86816"
FT                   /db_xref="GOA:Q0SWG1"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG1"
FT                   /protein_id="ABG86816.1"
FT                   /translation="MRILHTADWHLGKNLEGLSRMDEQERFLEDFVHIVKDNNIDLVII
FT                   AGDVYDSSNPPARAEKMFYDTLKKISANGERMTLVISGNHDNPERLVAAGPLARDHGII
FT                   MVGTPKSIVEVGEYGRNKVLNSGEGFIELDINGEKSVILTVPYPSEKRLNEVLYGAMDE
FT                   TCERIKSYSDRIKLLFDSLKGNFKEDTINLVVSHLFATGAENTGSERNIELGGSFIVDK
FT                   ECFPEEAQYIALGHIHKPMILPGTNKKIRYAGSPLQYNKKEISFEKKCFIVDVKANEEA
FT                   NIDEIKFDVYKPIEVWKCDSIDEAIYKCEENKDRECWVYLEIKTDRYIREDEIKAMKKL
FT                   KGDIIEIIPKITLDEEENDERSFSEKSFEELFTDFYEKERGVKPEEDLLELLLNIVKEE
FT                   GDEENETN"
FT   gene            255356..258874
FT                   /gene="sbcC"
FT                   /locus_tag="CPR_0205"
FT   CDS_pept        255356..258874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="CPR_0205"
FT                   /product="exonuclease SbcC"
FT                   /note="identified by similarity to SP:P13458; match to
FT                   protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87480"
FT                   /db_xref="GOA:Q0SWG0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWG0"
FT                   /protein_id="ABG87480.1"
FT                   /translation="MKPIKLEVKGLNSFIDKQVVEFDKLTERGLFGIFGPTGSGKSTIL
FT                   DGITLALYGDIARKSSNYINTNCDGVYVSYEFQITGNEVKRYRVDREFKRDNKSGGIRN
FT                   KSSKIIDITGGVENVLEEKAKAVTSKCEEIIGLKLDDFMRTVVLPQGKFSEFLKLEGKE
FT                   RRNMLERLFNLRKYGDDLSSKLSLEIRKEKDKMNVLEGQLKGYEGVSEEALKAKEEEIN
FT                   EINLSIKSKEELLNKIKKEFEEAEKVWNTQKELYDKRIEEESLVSRSEEIKSFKERVEI
FT                   SNKADKVIVFINNLEEILKEINKEDLKFNELNKKLEELTNLREENKLKFEEVSKKKEEK
FT                   LPDLRLKKEKLLESQKERDILFQIKADGVKLKEACKKIFEDRSKCDTKLNSIEENEKRL
FT                   NEELKEKEERKEELFVHEEFKNKINSGLFILSSYEGLDKQFNEIKSEEIELKKYIKNLT
FT                   EDKEKSEKDLKVKIESLSKTRDKLESLLKKTPGDSNSILEKQIKLGEYREKLNKYKEIK
FT                   NSLEESLKSKNNFEEKLKAFENQKLLLEKEVRELKEYINKVKVEELAHKLRENLVDGEC
FT                   CPVCGSTHHELNKVEKINLEESNEKTTLLESKEEKLKELILEFSKIEATLEYENKKIEE
FT                   LNISIEEVGEVNEERLKSLEEEFNTLKEKVEEFNLKKENLEKDLEKLKEEKNNLENIFN
FT                   KAEVILCEKIVREKEIASKIKEVDKELKLKNSELNSIKNELKIEDIKLENELILKKEKE
FT                   KNLLEKEIRILRTQLEESNKIKDELREKRDALKEDYLSQKSLLDGKVEVYREKERMIKG
FT                   SLKGLIDEALPIEKIDIKGLLEDLQLEIDYIEKAYLNLSEEKEKLEKAFNNMNQEVAVT
FT                   KERVNSLNLRKENEEKKVNLALEEEGFKTILEVKEGILSKDEKEKLKTLIEEYDNNLIK
FT                   VRANIELLIKKLNGKSLTEEEWTRVLQEKNNTEKELKEVEELKIRLVTENESIKKKLEE
FT                   QRDILHIKAKQEHKLALLSDLEKLFKGKKFVEFIAANQLKYISIEASKKLKDITNGVYG
FT                   LEVDENGKFIIRDYKNGGAKRDASTLSGGETFLASLALALSLSSQIQLKGTAPLELFFL
FT                   DEGFGTLDDNLLDVVMNSLERLHHERLSVGIISHVESIKNRVPVKLILTPAEAGIGGSK
FT                   VKIERS"
FT   gene            259277..260473
FT                   /gene="ackA_1"
FT                   /locus_tag="CPR_0206"
FT   CDS_pept        259277..260473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA_1"
FT                   /locus_tag="CPR_0206"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86216"
FT                   /db_xref="GOA:Q0SWF9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF9"
FT                   /protein_id="ABG86216.1"
FT                   /translation="MKILIINCGSSSLKYKLIDMANEKDIIEGIIERIGLDQSRLVQKN
FT                   ELREKYILEKEIKDHKEAIDIVLNTLVDSKVGVIESIDEITAVGHRVVHGGERYSSSII
FT                   INEEVIKYLEECSKLAPLHNPANIIGIRACQSLMPNKEMVAVFDTAFHGTLPEKAYIYA
FT                   IDYALYKDHKIRKYGFHGTSHKYVSHKVAETMGKDIKDLKIITCHLGNGASISAIKGGE
FT                   CIDTTMGFTPLAGIPMGTRSGNIDPSIIPFLVQECGYTIEEVSESLNKKSGVLGISGVS
FT                   SDFRDIEDAASNGDKRAQLALDIFHYRIRAEIGSFIVNMGGVDVIVFTAGVGENSPETR
FT                   EECLKDLEFLGLTLDKEKNKVRGKLAEISQADSKIKAYVVPTNEELMIAKETVELIGK"
FT   gene            260909..261730
FT                   /locus_tag="CPR_0207"
FT   CDS_pept        260909..261730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0207"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87583"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF8"
FT                   /protein_id="ABG87583.1"
FT                   /translation="MGFIVFCLIAYFVISNLSNKKDVSGNKANSNCPYCNAAFYLTENG
FT                   DFNCSNCGRLFKYRDGIVYRQDERLPIVVELACTLFTILCKADGIVTKDEVSITKELLE
FT                   KNFGLEDKDMKMAIDILNKSKSKPYNKTIINDLNNIFNNYDFSKIDAEDYKELILRCAM
FT                   IIAFCDDGEPSNNQNKILDDIVSIFNISATKYTNLLNYFRDNCIEKNKNNYYEILGVSE
FT                   GASKEEIRAAFRKLSKLYHPDRYSSKDLPPEIIKEFEEKLAKIIEAYEALK"
FT   gene            complement(261979..262737)
FT                   /locus_tag="CPR_0208"
FT   CDS_pept        complement(261979..262737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0208"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86735"
FT                   /db_xref="GOA:Q0SWF7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF7"
FT                   /protein_id="ABG86735.1"
FT                   /translation="MIFLKSILVDFFNCCEIPIRAVDNNMNILSEVGYSSFYDYIFNNL
FT                   NLNSKFERSYLKHDHNDSLIITFENNISFYSLFNYKSIDKDLIFIIGPLYLKEDLKNSN
FT                   DDLELYKIPLKTKSCLKYYNSLLKIILDEKLKDNFSISYSPYIGRAIDFIEKNYAEEIT
FT                   IDSLCTEFKINKSYFCNIFKNETGQTFINFLNNYRIKKSKDLLKDLDLSLLDIAHKVGF
FT                   SNQSYYCTVFKKFTGLTPLKYREDNYKKGL"
FT   gene            262883..265114
FT                   /locus_tag="CPR_0209"
FT   CDS_pept        262883..265114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0209"
FT                   /product="cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF05031;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86144"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF6"
FT                   /protein_id="ABG86144.1"
FT                   /translation="MGRKKINKILGYALVTSMLVGVGADTVYAATNINSGSAIVRSEGL
FT                   RDGIYEANNVTSYVEEGNSTGENMARNAIKEKTKFKIENGKTLMTVYFNSSLYGFMNNI
FT                   EVRAGGEDLKIEENKDDKSITFEVPSPDTKVKIGLFITMMGRKVELFLVNDMNTVNLLD
FT                   EAPTINNAKDISVTQGDAIDLLSGVIGTDKEDSNLKVEISGDTSFIKDGKAEIPGVYPI
FT                   TYKVTDSSGQFDEKTVNVTVNKKTTLGDGSYTLKNTVQYVGQGNMETGNSMARKVLSED
FT                   SRIDISNGKNTVTLTFNSELYAFLKNFNVTVDGEKVEAEVNKDNRTIKFNIPDLNSDIV
FT                   VSTLVSMMGKEVSFKTTLNYDTAKKLENNLEDNNKPGNEDNENIPGENENSGNQDNSGN
FT                   TNQGSNGSANEDKENESEGSSGEIVDANQLKNGIYNIKNDVSYIGDGNQDVGNDMARKA
FT                   LSKNSKLEVKDDKKILTLKFNEEQFSFFKDFRITVNGKDVVSTPNEADRTISFEIPSLD
FT                   ADIVVTAFVSVMGRDVSFKTILNKGTLELVSGEDKPAIEEENKSEESNGTSSSNNGSSA
FT                   NEGNSTVTENKVTKGKLYTIENKVVHKSQTGVDMARKYLNKISDLEEIDGKTYLTLTFT
FT                   GQEFMKDHKISVNGKDANYKVVSKNGDSIKLRFEIPNLDADIEVSLYVIPMGRNVEFNV
FT                   ELLKDTKKFVKDFTLSSLPQTGSPIGGNSVALLGMAMMGASMFIRKREE"
FT   gene            265177..265824
FT                   /locus_tag="CPR_0210"
FT   CDS_pept        265177..265824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0210"
FT                   /product="putative iron transporter"
FT                   /note="identified by match to protein family HMM PF05031"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85912"
FT                   /db_xref="GOA:Q0SWF5"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF5"
FT                   /protein_id="ABG85912.1"
FT                   /translation="MRFLKPVLLVMLTLFISLTGVFGSVDVLANENLENGIYDVKNDVY
FT                   HDSDIGMSMARSYLNDTMQLKILGDETEYTIGFSGTEYMENFRILVDGNDGNAEIVEED
FT                   KENGTIKLKVKVPNKDSELEAKIYVGPMERDVQFKVIPKFDTLTLVEKLEEPKVENKES
FT                   SGENLSDETGKSEDAISKATGLANNKNMVIYIGGGIIIVALIVSLVIVKRKK"
FT   gene            265826..266389
FT                   /locus_tag="CPR_0211"
FT   CDS_pept        265826..266389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0211"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87310"
FT                   /db_xref="GOA:Q0SWF4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF4"
FT                   /protein_id="ABG87310.1"
FT                   /translation="MRNKLAKGLFILGLVIVSTVLIGKLYKSSIEKKTLEEFKEKFNYS
FT                   EEEKKKTLEEIKNGDGIALIDIEKIGVHTVIAEGSTLNVLENNIGHFENTAMPGENGNF
FT                   SIAGHRNTINNEVFRNIDKLQVGDEIKITTLTDIFQYEINEIFVTSPSDTDVLNQNLDE
FT                   KTMTIVTCTNRGKDRYIVKAKLIG"
FT   gene            266403..267290
FT                   /locus_tag="CPR_0212"
FT   CDS_pept        266403..267290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0212"
FT                   /product="putative iron chelate uptake ABC transporter,
FT                   solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01497;
FT                   match to protein family HMM TIGR03659"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86518"
FT                   /db_xref="GOA:Q0SWF3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR019957"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF3"
FT                   /protein_id="ABG86518.1"
FT                   /translation="MFLKKGIALSLICLLGFGVMGCSNNSGESKESLKKESGEEIVVAT
FT                   SVAVTEILDELGVKVSGVPTSSYDLPESTKDAVKVGNPMNPDLEIIKSLNPDVVVSVDT
FT                   LGEDYKKLFTDNNIPSEFIDLTTLEGLKTSISTLGERFNKTEKANEILNELKVKEDEFV
FT                   NLSKEEKKNVLLVFAAPGSMMIATPSSYIGNLVDKIGANNIVKDDKKPFVSYSNEEIVK
FT                   LNPDMVLVMTHGMPEQAKKMAEEKFASDPAWSRIEAVKEGKVYYLENGYFGMSANLKVT
FT                   ESLDKLGEIIYGEK"
FT   gene            267277..268263
FT                   /locus_tag="CPR_0213"
FT   CDS_pept        267277..268263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0213"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85926"
FT                   /db_xref="GOA:Q0SWF2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF2"
FT                   /protein_id="ABG85926.1"
FT                   /translation="MVKNNKLKSLYIGLSILIVLILMIISLKLGSIDISFGELIKGLLS
FT                   GSNEGNIGIIKDLRMPRVIIAALVGGNLALAGVLLQAVIRNPLADPQVTGISSGACLVS
FT                   LIFIIFMPASGSIRPIVGFFGGLVSCIVVYLMAYKKELDTMRIVLAGAAINALLGGLSQ
FT                   ILTIGSGIGAGNIQSWISGSLAATSWDEVKILFLYSIIGMGFALILAKSCNVIVLGNKN
FT                   AKSLGFNSDLQMILITVVAVFLGSVSTAIVGIISFVGLVVPHICRILIGSDHRYLIPFS
FT                   IFVGGALVLLADTIGRMLVKPYEIPAGIIMAVIGAPFFLYLLRRSDM"
FT   gene            268264..269043
FT                   /gene="fhuC"
FT                   /locus_tag="CPR_0214"
FT   CDS_pept        268264..269043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="CPR_0214"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85569"
FT                   /db_xref="GOA:Q0SWF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF1"
FT                   /protein_id="ABG85569.1"
FT                   /translation="MIRGEKLSFNYKGEKNIINDLNIDIKEGEITTIIGPNGSGKSTLL
FT                   SLLCALNKSKTGHVYLGDINMNNLKYKNIAKILATVHQQNSVPKDIKVEELVAYGRYPH
FT                   KGYFKNNNKEDKNIIKWALECTGLDDLKHKGVMNLSGGERQRAFISMALAQKPKILFLD
FT                   EPTTYLDIFHQIEILEIVKKLNKDNGLTVVMVLHDINQAIKYSHNIVVMKDGKIVKEGK
FT                   SENVIDENLLKEVYKVNGVINKCKETGEIYFIPKTIC"
FT   gene            269085..270812
FT                   /locus_tag="CPR_0215"
FT                   /note="CPE0226"
FT   CDS_pept        269085..270812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0215"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87083"
FT                   /db_xref="GOA:Q0SWF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWF0"
FT                   /protein_id="ABG87083.1"
FT                   /translation="MIDKRLLNLCKESKKYIGLTVLMNWISVICNLMTIIVIGFSIQEL
FT                   FSLGNIENLNKKILILAALLGVRFCVNLLSGHFSYKSSEMVKITLRDKIYEKLLKLGMR
FT                   YDKVDSTSSIVQMAVEGVEALEVYFSKYLPQLIYSILAPLTLFCALAFISFKAALVFIL
FT                   CLPLIPISIILIMKIAKKILKEYWGQYSDLGNTFLENLQGLTTLKVFDVDNERHELMNE
FT                   EAESFRKITMKVLSMQLNSINVMDLIAFGGAALGSIVALLQFRAGTVSLGGMIVILLIS
FT                   AEFFIPLRLLGSYFHIAMNGIAAADRIFKVLEADESKVSSDSNLNEISNISLCNVSFSY
FT                   DGKREVLKDISLSINKGDYVAIVGESGSGKSTIASLILNNYKASKGKITLNGADINNID
FT                   FSKLYNRVSIISTNSYIFNGTIKDNLLIAKKNATLEEINYALKKANLLDFVNSKKEKLD
FT                   LEVGEGGSKLSGGQKQRLALARTILANREVIIFDEATSNIDVESENMIWKSINEISKEK
FT                   TVIVISHRLANVKNADRIYMLDKGILVEEGSHKDLMERKNKYYGMVNYQNELEIGGVI"
FT   gene            270813..272501
FT                   /locus_tag="CPR_0216"
FT   CDS_pept        270813..272501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0216"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86876"
FT                   /db_xref="GOA:Q0SWE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE9"
FT                   /protein_id="ABG86876.1"
FT                   /translation="MRKSGFSIMKRLIVELKPLAPVMFITVFMGVLGFLAAIGITVFGS
FT                   VAISSLIDSTISFSFKTALILMIVLGILRGPLRYGEQLSGHYIAFKILVILRDKVFLAL
FT                   RKLAPAKLEGMEKGNLISMITSDIELLEVFYAHTIAPISIAIITNTIMGLILLSINVKV
FT                   GIVGIIGYILIGFGVPYISSSFGKEAGVQYREAFGKTNSYILDSLRGIKEVLIFNNGNE
FT                   RRGNIKKFSEELNEKQKVIKKHEGIIRAFSDLIIMLTILIALYVAYLEVLKGTMTIGEL
FT                   IIVVTLIASSFGPVVALSNLSNNLLLTFASAQRIFNILDEKPSVEEVLGEGMNVGNNIE
FT                   YKDVSFAYKGKENVLKDVNIDIKLGDKIAVIGESGTGKSTFVKLLMRFWDVTKGEISLG
FT                   NKNVKEIQTKELRKKMALMGQETSLFNMSIEDNIKIGKLDATLDEVKEAAKKAGIHEFI
FT                   IGLEDGYKTKVGELGGNLSSGEKQRIGLARVFLRESEIVILDEPTSNLDTLNEGIILKS
FT                   IRTYLKDKTLILITHRKSTTRVCEKVFRINKGNLIQCEEVKHELA"
FT   gene            272488..272883
FT                   /locus_tag="CPR_0217"
FT   CDS_pept        272488..272883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS11534.1; match to
FT                   protein family HMM PF04304"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86291"
FT                   /db_xref="GOA:Q0SWE8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE8"
FT                   /protein_id="ABG86291.1"
FT                   /translation="MSLLKIFYVILGFISLGLGLIGIILPILPTTPFLLLTAFCFVKGS
FT                   DKFDKWFKGTKIYKNHLESFEKNRAMTLKTKLTILLTADIMLLFPLILSKSIHLKIFIV
FT                   ILMMFKFYYFIFRIKTVKVGEVVEQNR"
FT   gene            272858..273163
FT                   /locus_tag="CPR_0218"
FT   CDS_pept        272858..273163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO79602.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87450"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE7"
FT                   /protein_id="ABG87450.1"
FT                   /translation="MRLLNRIDKEKEIITLMIKLYCKKKHGSLNGELCNECRELDEYAH
FT                   KRLTYCKFGNEKSSCKKCPIHCYKKDMKEKVKEVMKFSGPRILIYNPKEYIRHIFK"
FT   gene            273681..273881
FT                   /locus_tag="CPR_0219"
FT                   /note="CPE0767"
FT   CDS_pept        273681..273881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0219"
FT                   /product="transposase, IS605 family"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86900"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE6"
FT                   /protein_id="ABG86900.1"
FT                   /translation="MKKLKRAYKVEINPTDEQKSKIHQTIGVSRFIYNFYIARNKEIYE
FT                   REGKFVSGMDFSKWLNNEYIP"
FT   gene            274995..275180
FT                   /locus_tag="CPR_0221"
FT   CDS_pept        274995..275180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0221"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85421"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE4"
FT                   /protein_id="ABG85421.1"
FT                   /translation="MGNIDKDRIVCRCKKVSEGTIIEAIKNGADTYEKVKKETGANTYG
FT                   CFACRLEIKKLLEENK"
FT   gene            complement(275281..276618)
FT                   /locus_tag="CPR_0222"
FT   CDS_pept        complement(275281..276618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0222"
FT                   /product="putative glycerol-3-phosphate transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00881"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87773"
FT                   /db_xref="GOA:Q0SWE3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE3"
FT                   /protein_id="ABG87773.1"
FT                   /translation="MFGFFSPAPAIPRLPKDKVSSAYKAYRIRMFLMIFIGYTGYYLVR
FT                   KNFAVASPYLIDNYGFSKTQIGLISMGLAVSYGLSKFILGNLSDKSNVKKFICFGLIAS
FT                   SVLSVLMGFARTVPIFLILMVFNGFFQGMGAPPCSIVLGKWFSQKERGLKMGIWNTSHN
FT                   IGGGLIAPIATLCLLIFGQNHFQSIFFVPAIICTIVALFCYVIGADTPASVGLPPVEEY
FT                   RNDYPEVKAEVNPTTLSSKEIMVKYVLKNKYVWYLALANIFVYLIRQGVVNWIPIYLKE
FT                   SKGFSAANANWAMFLFEYAAIPASILLGWLSDVVFKGKRAPLSILCMIGVIFATVAYWQ
FT                   TSSTLVTMISVAFIGCFIYGPQLLIGMNLIDVVPNFAVGSATGFSGLCGYLLGEFMADF
FT                   VLGMIADSFGWNGAFIFIIVGAFIALLLLALTLKIKKNPQVEDKIA"
FT   gene            complement(276819..277838)
FT                   /locus_tag="CPR_0223"
FT   CDS_pept        complement(276819..277838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0223"
FT                   /product="putative iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86993"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE2"
FT                   /protein_id="ABG86993.1"
FT                   /translation="MKKFLNKKITIILTIIILLLIAKLHIIKKEKALSTSNMNHIVVYG
FT                   SLREEEGKYLLEKFKNEYDCTYEYIKLPTEEAIQRILDTRDNPQGDIFIGGSCDGYEIL
FT                   KKYDALEEYNSPFANNIPAKYKDLRGYWTGFQITPLSIGINKSLWQKYFGDSVPYPKKI
FT                   EDLLNPEFKDKIILPNPQTSGTGYTLMASLYQELGKEKFETFIAKLNDNVSSSTISGFN
FT                   SIQRVASGEYLITVNFLSDQLIANRSSDNIISIVPENAGWNIDSIALIKNSKHEKIAKS
FT                   FIDFVLSKETSSDLSKFSKAISTKNFDTNQFKIYDKYNFYLAAEDREKIMQILYKNKE"
FT   gene            complement(277819..278607)
FT                   /locus_tag="CPR_0224"
FT   CDS_pept        complement(277819..278607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS44277.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86633"
FT                   /db_xref="GOA:Q0SWE1"
FT                   /db_xref="InterPro:IPR025031"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE1"
FT                   /protein_id="ABG86633.1"
FT                   /translation="MSKNFKNILAIYLFFIVIILSTYIYYSSNIYDSLTVVKSSQENKG
FT                   DLNIKIPDKIILSNPYLGTTVISNKSELNELLQYFNKICLTNSTKENALPLENTLFISG
FT                   EIHYLNGDKTPFEISNILKLDGESYSNNSSLINMLRNNLKDAFYTVNNLESILSSPDNL
FT                   ITYKEDGTMKNLSKDSKSLLLEDFKSLRLMNDNKDFLKTDLSEIPKHHLTLYRYAKEGD
FT                   ISNNTFYIDVYKDYVIIQYLGDENGKNIYLKGNLNEEIFK"
FT   gene            complement(278600..280030)
FT                   /locus_tag="CPR_0225"
FT   CDS_pept        complement(278600..280030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0225"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85906"
FT                   /db_xref="GOA:Q0SWE0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWE0"
FT                   /protein_id="ABG85906.1"
FT                   /translation="MKNNKKQMNLNLKQKIILTNLLILAPIIIFIFIITYNALSKNLIN
FT                   NSIEYLLDKSRTTESYILNLLSSNDSEDKEDIIRDNAPFIASTLSEKYNVRIQIISNSA
FT                   QIIYDSSSDEVSLFGSDINEALDGQTAYIVEKIDNVPTLFLSSPIFYKGKEYGAIRLIL
FT                   INTEAYEILTNTLTIFIISGLIAIIIAIFLINTFAKELVSPLMILKQKSKNISEGKFKE
FT                   ELHIKSGDEVEDLANTFNIMSENLDKYINEIKSAKLHQKKFFDNVSHEFKTPLTAIIGF
FT                   SEIIPKLNDKEKIVQSSALIEKEGKRLLNLVEEILLLAKSNKNTFEIEYTYIDVKSLID
FT                   DCLKILKIKLDNYDIKVYRNYESFFIYGDHDKTKQVFINIIDNAIKYSGCETLNISTKR
FT                   SPNKMEVIIEDDGTGFIIKDEYVNPKGNGLGIKICKDIMQSQNYGFNIESELDVGTKVT
FT                   LSFSIGKNNETKEGDFNE"
FT   gene            complement(280020..280691)
FT                   /locus_tag="CPR_0226"
FT   CDS_pept        complement(280020..280691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0226"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85776"
FT                   /db_xref="GOA:Q0SWD9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD9"
FT                   /protein_id="ABG85776.1"
FT                   /translation="MKILVVDDEVSILQLIKMNLEIEGHIPITAENALDALELVIKERP
FT                   DIIILDAMLPDISGFNLIPKIKNIDDIPIIMLTAKSDINDKLLGLQLGADDYITKPFNS
FT                   TELILRINIVGKHISSDSKKKVKDLTIGDLTLLLDERKALIKSEYINLTFKEFEVLRCL
FT                   CQNKNKVFSREELLNKVWGYDFEGTTRAVDILIQRLRKKLGPCQNYIKTLYKAGYKLDE
FT                   K"
FT   gene            280981..282180
FT                   /locus_tag="CPR_0227"
FT   CDS_pept        280981..282180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0227"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86351"
FT                   /db_xref="GOA:Q0SWD8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD8"
FT                   /protein_id="ABG86351.1"
FT                   /translation="MISYEFLFDLALILISTKLFGLITKKIRMPQVVGALVAGVVLGPA
FT                   FLNVLSETEFIQNLAELGVIVLMFTAGLETDINQLKKTGKASFIIAVLGVIIPLVGGFF
FT                   IASIFNKGNDVNTILQNVFIGIILTATSVSITVETLKEMGKLNTRAGNAILGAAIIDDI
FT                   LGIIALTITTSLADPSINVIIVLIKIVMFFIFAGFAGYLFHWAFIKLDEKYQRDLRRFV
FT                   IIAFVFCLLLSFCAEEFFEVADITGAFIAGLVISDSNRSKYLNSRFETLSYMLLSPIFF
FT                   ASIGIKIKLTAMTKTIFIFSILLLLVAILSKVFGCALGAKICRYSNIEAIQIGTGMISR
FT                   GEVALIVANKGIAMGLMLQEFLAPVVIMVVVTTIVTPILLKVVFKNRSKSVDLNLKANV
FT                   "
FT   gene            complement(282349..282424)
FT                   /locus_tag="CPR_0228"
FT   tRNA            complement(282349..282424)
FT                   /locus_tag="CPR_0228"
FT                   /product="tRNA-Met"
FT   gene            282597..283373
FT                   /locus_tag="CPR_0229"
FT   CDS_pept        282597..283373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD7"
FT                   /protein_id="ABG85787.1"
FT                   /translation="MFTKGFDEAYNRALELQKLFYDEKEKYNEELKNENRDIKHLVNKI
FT                   NEEKIYILETLVPKYAKNMSILERQSIKATLGEEVSSEYIINDYNIRPIKELLLIDYDE
FT                   KSIIKNIKNPFIKVFKINKINKNLDEETMEIQVARDEMKKISQCAKDDKLKLIRIYKLI
FT                   CSATNLGEAIEERFRDFIPMIQSSRLIYGDCNIEKRSYRIGNVMKCYDGIIQFLVKICE
FT                   TKYRSVEGKRVKYIKDSLINEHLEELDLWKQSFNEI"
FT   gene            283786..285216
FT                   /locus_tag="CPR_0230"
FT   CDS_pept        283786..285216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87768"
FT                   /db_xref="GOA:Q0SWD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD6"
FT                   /protein_id="ABG87768.1"
FT                   /translation="MSTISSILKSFLTQNILGYIGITLILIVICLGFIYNMRVKKKYEN
FT                   LLNAFNESEWINVSNNEEKKELKFLNSELKAMTDDFRRSAIKGTYNINTEVIIQKNIEK
FT                   KILKEENIANILPSISIALGLIGTFLGLTVAIMTTTGILSSGTQSMADFSRSMNMPLGS
FT                   MSSAFWTSIVGVIGSIILNYLNINLKRAKEDFYDVFEDYLDNILFSIYIKSDKDVLTDF
FT                   MNKALGSFSIKLDELFNKGINNLVEGINKNTVDMTSTFNGMNKHISDLENIVSYFRVSV
FT                   MGIKTPIKSFGEDLEKFSRVSAEFCNSVNSTNNKFLNKSTRLEESVNELSKAINDNKRE
FT                   INKLCMRLEVQSNEVRRGYNTFNDVFNIIKDEQSRNNKIISNQISKLNDGYREFERGIN
FT                   KFSSNVSNMKNEVANGIYYALQRETQELSSNIVDKLNVPLRDISLATEELSRSTNRNRE
FT                   IGKVDSGWKKDSKEIGRC"
FT   gene            285219..285911
FT                   /locus_tag="CPR_0231"
FT   CDS_pept        285219..285911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87190"
FT                   /db_xref="GOA:Q0SWD5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD5"
FT                   /protein_id="ABG87190.1"
FT                   /translation="MKVRRRKYKTEQEVPSYWPSFVDIMTTVTLVFFFILLTSIGISSI
FT                   FVDNIAVERETVYDKIQGELNQYAVNEEVMNFNREEGKIDIKTETFFDSDSSVLKKDGK
FT                   KLASELGDIFFKLLSNEDIKEKIDYIEIVGHTDFAGSTIHGRELSTERAISFLNEMMPE
FT                   DSELENLHGEKFKASGMSEFENYASKEERDRGYDEYNIEETKKDRRIEVRMVFSNEDLE
FT                   KAIKERKN"
FT   gene            complement(286009..286329)
FT                   /locus_tag="CPR_0232"
FT   CDS_pept        complement(286009..286329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0232"
FT                   /product="putative immunity protein"
FT                   /note="identified by similarity to GB:CAA11807.1; match to
FT                   protein family HMM PF08951"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86114"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD4"
FT                   /protein_id="ABG86114.1"
FT                   /translation="MENGELMNRSKDLVHSLYNSLSKSKENNFDDIKEVLLKVYTKLDL
FT                   CDEKNIPLINRLVNYIYFTAYTKKLTFSSNEENIIRELSDIGKYAGLNGVYRSDYGDKS
FT                   QF"
FT   gene            286464..286712
FT                   /locus_tag="CPR_0233"
FT   CDS_pept        286464..286712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0233"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85401"
FT                   /db_xref="GOA:Q0SWD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD3"
FT                   /protein_id="ABG85401.1"
FT                   /translation="MENQIKKSKAPIILGVISCIAWLIPLIGIIISIVGIVMSSKKIKE
FT                   FSCKAYKIALALNIIGLVLTIINSVAGMIMFYHKLMI"
FT   gene            286725..287495
FT                   /locus_tag="CPR_0234"
FT   CDS_pept        286725..287495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0234"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87414"
FT                   /db_xref="GOA:Q0SWD2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD2"
FT                   /protein_id="ABG87414.1"
FT                   /translation="MKKFFKTVGVCLGFPILNFLIVSFIQVFFLGYTKNNISLFQKNIF
FT                   SLTILGDILTLVLITIILLPSNERLLRRIKIKKINLKEYFYIIALSIGVSILLLFLSGI
FT                   LSKIIPSYGDVVNQLNVASKSSLQLVIAIILIPIYEEIVFRGIIFGYLRKNFNIIVAVL
FT                   VQALIFGIMHLNLVQGIYTFILGIVLALIYMYSDSILGNITVHIIFNLLGALIVPMLLS
FT                   KFPIMVIVLLILGIVLFIFSVIKIIGKYEKSLYK"
FT   gene            complement(287587..289914)
FT                   /locus_tag="CPR_0235"
FT   CDS_pept        complement(287587..289914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0235"
FT                   /product="GGDEF/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85387"
FT                   /db_xref="GOA:Q0SWD1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD1"
FT                   /protein_id="ABG85387.1"
FT                   /translation="MKHGPMLNKIKLFFIVQIILSFLVLAGTLISILVIPSHLPDYFIW
FT                   AIAFSFWVFQCGFSTIFAFRYRFSKSSLSTVKLSFILIGSIQILITLATNLFSIFDLPI
FT                   FNTLIIKNFQLLLLSLIFIVMIYKLIKDMLKYRVLKDYIIRDSFFTFIPFAFIIYKNSK
FT                   YFISSLYFLDDSVYSLALLNINSLRIFLEGFLIILIFVKTIYLRGNKKSSFLLLIYFYI
FT                   SNLNCYIVSYFNSKLLFYHYLYQGIGIYFICPILLILSTYYSITEQEKTPDKVEFDGSY
FT                   MNINNSWISITIGIFPVSFSAIDIIASSLASGDFNGIESLVIILLVMILLVCRDIILRK
FT                   DNLRLIASVKRANEIDFLTNMYSRNYFLKKLEAMNTDYALFFIDIKSFKDINNIFGHVV
FT                   GDKVLVEVANKFKELKLLLGKSVFYCRYSGNEFALISKLEQVDLILKFFRDLENIKIQH
FT                   NSDLIHINFNIGYSLNDSNINLDLLIQETDYALMRAKKLKGPNNSILMYDDNLKTDLKH
FT                   INILKKDFINDLLADKFHLVFQPKVCVKTLKIVGFETLLRWKHDKLGEISPCKFVPIAE
FT                   NLGEISSLDLYVFKKSCEFQRCLIDMGIEIKCSVNLSLNTLKSYEKINEILNIYKKYKI
FT                   PKHLITAEILENVSLNNNAKTISYINLLRENGICISIDDFGTGYSSLSQISNLYFDELK
FT                   IPREFVINARTSSKLAVIEAISILAKKLNVTSVIEGVETYEDFKLFSSLGFDIVQGYYF
FT                   SKPLTKSEIIDYIKVNINNKIS"
FT   gene            290169..291437
FT                   /locus_tag="CPR_0236"
FT   CDS_pept        290169..291437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0236"
FT                   /product="dnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85946"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWD0"
FT                   /protein_id="ABG85946.1"
FT                   /translation="MIDYFKELNIQIDASDNEVKNAYFNMTKKYPPEKFPKEYRVIRDA
FT                   YETLIDKSKRDAYILETFDIEIKNILNEGIDLAKSEKYDLAVLNFEKVLKKYPDNSKVK
FT                   KDLAVCLMRGRNYKKSSKILKELVIREPNNIEYYKLLINIYGDNYDLKNLESVLKKSLN
FT                   LKNVEVDFYLKLFEIYNESELRNYTKAIKVLKDGLENKNINSKKYKLYLKFLDLSDRLD
FT                   CKDDFNKGCEALNGIILKDNYEEVKSSILNLLDRILKEFHFKNGVRLTSTALVLIDEKE
FT                   DMETLEKIINLRRSFLELSRLYEDKSINEDFKKIVFYNAVSKFLKDDIEFNKDFERINQ
FT                   NFFNNLNFESDELVKSIGKLKNDYRNVYLETRKLSDKVLGRYSKVQKIKEEKNSSKEFY
FT                   SNRREGNPVKILFRKVINSFRDK"
FT   gene            291455..292057
FT                   /locus_tag="CPR_0237"
FT   CDS_pept        291455..292057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0237"
FT                   /product="putative co-chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87790"
FT                   /db_xref="GOA:Q0SWC9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC9"
FT                   /protein_id="ABG87790.1"
FT                   /translation="MNYEEALKDICEEKKYIDLFEEDRGLKEIKNSIKKIVIQNENMNQ
FT                   GYIEEVYKIASSLEGITTYISKKSEEEELRSKRINKELEVREKRLVKSIISIVDNIKYI
FT                   YDFSQKSSNEVLNEAMNNLLNTVKRAMVNVDILLIDGKETFFDESLHECVSTIWNDERK
FT                   DYEINEVLKFGYIYKGKVERTAQVVVVKNKEDMKWEE"
FT   gene            292045..293772
FT                   /locus_tag="CPR_0238"
FT   CDS_pept        292045..293772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0238"
FT                   /product="dnaK family protein"
FT                   /note="identified by match to protein family HMM PF00012"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86751"
FT                   /db_xref="GOA:Q0SWC8"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC8"
FT                   /protein_id="ABG86751.1"
FT                   /translation="MGRIIGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSIE
FT                   GDEIKVGKKAKNQILLKPELTVAEVKRVMGTENIIQIQGKEYRPEEISALILKKLKEVA
FT                   EYFLGEEVEEAVITVPANFNDIQRKATKNAGEIAGFKVERIINEPTAAAMAYGVDNLDK
FT                   NGNILVYDFGGGTFDVTILEMFNGVLDVKVSRGNNYLGGKDIDNKLIDHVVNEFNKSTG
FT                   VKLDTSDSRILARLKEGVEEAKKTLSTSKMAEIVLPYISADKDNNPINLEMVLTREEFE
FT                   FNVKEIIDSTEDIVNEALEDANITNNEIDTVLLVGGSSRIPYVRNMLEKRFKGKIARGV
FT                   NPDEAVALGASVQAAIKNDIPVGDSGTIIVTDTCNYTLGVALKGGIFDPIIDRDSKLPA
FT                   DVTKRYCTVMDNQTEVLVSVYEGESRYVSDNTLIDEFILSGIPKADTGKEKIDITFTYD
FT                   LNGILNVSAEILSTGDEISKIMSTKGLSKEEIKDLKEVVSSNENNNELVPWKSANLFKL
FT                   VEPNFRLAERKIPMLPSADREKLQEIMSDMKDAIVDNDKMALMKLDEELTDFLFDFVN"
FT   gene            293790..294524
FT                   /locus_tag="CPR_0239"
FT   CDS_pept        293790..294524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0239"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86028"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC7"
FT                   /protein_id="ABG86028.1"
FT                   /translation="MKNSKEALEVVYNNALDLILNKKLKEGEKLLEKIYGSGNINIDIL
FT                   NLLGIIKYMYCDFYEAKKYWNESLKVSCEDNKASEFIEDVESDDFKLISEKYIYSLNLI
FT                   EDKNYLQAIENLEEINKGRSELIEVKILLVLLYMIIDEKNKAFKNIESALSYDISNYKI
FT                   KEIYNEIKCDLAKDEEKEESEELTFSESILNLIMILNYRINSFYEEELKYRNEEIKSLY
FT                   EEIKTMNLEIESLNTKKEKLSL"
FT   gene            294796..295569
FT                   /locus_tag="CPR_0240"
FT   CDS_pept        294796..295569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0240"
FT                   /product="putative protein-tyrosine-phosphatase"
FT                   /note="BH3667; identified by similarity to SP:Q54518; match
FT                   to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85603"
FT                   /db_xref="GOA:Q0SWC6"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC6"
FT                   /protein_id="ABG85603.1"
FT                   /translation="MIDIHSHIIPNIDDGSKSLEMSLEMLKRAEESGTKKIIATPHFFK
FT                   GYWTENYNSVKDKVKELNNLAKENNLNIEIYPGQEVFFNNYILEDFKLGDIGTLGGSRY
FT                   MLIEFPMDKIYFQKAIDEIYELKIKGITPVIAHPERYVDFINNPDTINQFIDEGYLFQL
FT                   NGGSLTGLFGKEVKKTAELFLENNLYSFIGSDAHSNGNRNTSLKEACEVANSISRGASR
FT                   RFEANGLALLNNEKIVFQGQKIKKKKKGLFSFLKR"
FT   gene            complement(295736..296146)
FT                   /locus_tag="CPR_0241"
FT   CDS_pept        complement(295736..296146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO34832.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87202"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC5"
FT                   /protein_id="ABG87202.1"
FT                   /translation="MCTVAFVLYQCNIKITEYKRQILTLNNQLSKYKDTTYKKSNNDSQ
FT                   KTLIINFNKPEFRYGITLPYTSIFIAPSEESIAISKIKEKSQVKIIDEAEINNEIWYYS
FT                   LLNTESKINCNGWIKKSQFSMLMEDTNNVLKE"
FT   gene            296320..296505
FT                   /locus_tag="CPR_0242"
FT   CDS_pept        296320..296505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS44038.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86331"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC4"
FT                   /protein_id="ABG86331.1"
FT                   /translation="MANLNELELQNLRHLIGAHSTIEKKLECYSEQCTDPTLKNMLKKD
FT                   AQDAKNSKEKLMSFLG"
FT   gene            296518..296766
FT                   /locus_tag="CPR_0243"
FT   CDS_pept        296518..296766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP11869.1; match to
FT                   protein family HMM PF07875"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86734"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC3"
FT                   /protein_id="ABG86734.1"
FT                   /translation="MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDE
FT                   VRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG"
FT   gene            complement(296864..297594)
FT                   /pseudo
FT                   /locus_tag="CPR_0244"
FT                   /note="NAD-dependent deacetylase, Sir2 family, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF02146"
FT   gene            297960..299114
FT                   /locus_tag="CPR_0245"
FT   CDS_pept        297960..299114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0245"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86045"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC2"
FT                   /protein_id="ABG86045.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGA
FT                   GYDKYYKKTGGRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVKIENSR
FT                   NVDGNIKRVTVSRTQSGKYFASILCDVNTQELPKIDKKVGVDVGLKTFAVCSDGYEEAN
FT                   PKHFRKAEKRLIKLQRDLARKEYNSKNYHKNRIMIAKLHERIANQRMDFLQKFSTKLIR
FT                   ENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAKWYGREIVIAPPDYASSQ
FT                   LCSECGYKNIEVKNLGLREWVCPECGTHHQRDLNASINLEKLIA"
FT   gene            299341..299823
FT                   /locus_tag="CPR_0246"
FT   CDS_pept        299341..299823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0246"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85790"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC1"
FT                   /protein_id="ABG85790.1"
FT                   /translation="MYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKYPKKTVIKIP
FT                   VDNKKISMRTLLSKEDVNSIINSIPETETLWIDNDRQRNDEFKTILRSGNCDDLIVLIR
FT                   SIYLDKKKRKLDGKKACKGDDEIMQTAEKLIDEEFAVILDIRPEEVKSYIKSHIPQ"
FT   gene            300278..301414
FT                   /locus_tag="CPR_0247"
FT   CDS_pept        300278..301414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0247"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86329"
FT                   /db_xref="GOA:Q0SWC0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWC0"
FT                   /protein_id="ABG86329.1"
FT                   /translation="MKELERLLGRLTIINIKEIIIILVIMIIVLIINKILINNLFKLLI
FT                   RGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVGII
FT                   VSFIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFVSIIIRLIILLVGIIIIANEFGLTG
FT                   FIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEEITFRSTR
FT                   IRTFSMAIATVPNSKLANSNIINWTQRKLRRIHFKFTMDCKTPIESIKNSVNRIENMLK
FT                   KHDKIDKNLIIVSFNELSTYGFGVFIYFYTDEFEYLKYEKIKEEINIKILEILREENVS
FT                   LMFLNFDFKDFERKYGNCNLENTELESIKNITEEERGI"
FT   gene            301411..302034
FT                   /locus_tag="CPR_0248"
FT   CDS_pept        301411..302034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0248"
FT                   /product="putative copper homeostasis protein CutC"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87247"
FT                   /db_xref="GOA:Q0SWB9"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB9"
FT                   /protein_id="ABG87247.1"
FT                   /translation="MKIKLEACVESYKEGKRAEELGADRIELCDNLAQGGTTPSYGTIL
FT                   QCKKDINIDINVIIRPRGENFVYSKEELNIMKNDIKLCKDIGVTGVVFGFLKEDNTLDY
FT                   EATKEFVELAKPLSVTFHMAFDEIVNKFDALDKLIDLGVDRVLTKGGLDNSFKNKDTLK
FT                   ELVEHAKDKIIILPGGGVTKDNFLELKDYTNAREFHGTKIVGNL"
FT   gene            complement(302918..303595)
FT                   /gene="ung"
FT                   /locus_tag="CPR_0249"
FT   CDS_pept        complement(302918..303595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="CPR_0249"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by similarity to SP:P39615; match to
FT                   protein family HMM PF03167; match to protein family HMM
FT                   TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87781"
FT                   /db_xref="GOA:Q0SWB8"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SWB8"
FT                   /protein_id="ABG87781.1"
FT                   /translation="MAAEFNNDWDDLLKDEFEKEYYLNLRKFLIDEYKTQKIHPSMYDI
FT                   FNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCY
FT                   IPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFIL
FT                   WGRNAISKETLITNPIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQI
FT                   PNI"
FT   gene            309623..309698
FT                   /locus_tag="CPR_0250"
FT   tRNA            309623..309698
FT                   /locus_tag="CPR_0250"
FT                   /product="tRNA-Phe"
FT   gene            complement(309812..310279)
FT                   /locus_tag="CPR_0251"
FT   CDS_pept        complement(309812..310279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0251"
FT                   /product="AhpC/TSA family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86648"
FT                   /db_xref="GOA:Q0SWB7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB7"
FT                   /protein_id="ABG86648.1"
FT                   /translation="MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAGC
FT                   TTEACNFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDEIVCKLYDV
FT                   IKEKNMYGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN"
FT   gene            complement(310437..311595)
FT                   /locus_tag="CPR_0252"
FT   misc_feature    complement(310437..311595)
FT                   /locus_tag="CPR_0252"
FT                   /note="similar to IS1470, transposase frameshift"
FT   gene            311887..312633
FT                   /locus_tag="CPR_0253"
FT   CDS_pept        311887..312633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0253"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85464"
FT                   /db_xref="GOA:Q0SWB6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB6"
FT                   /protein_id="ABG85464.1"
FT                   /translation="MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVLE
FT                   QAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKDFYE
FT                   EHKENFVELETVTAKHILVASEEDAKKVEEEIASGSITFEDAANKYSSCPSKEQGGNLG
FT                   SFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQVVNM
FT                   LIQERQQKKYLELIKELREKYGVKLA"
FT   gene            313090..313902
FT                   /locus_tag="CPR_0254"
FT   CDS_pept        313090..313902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0254"
FT                   /product="ABC-2 type transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87532"
FT                   /db_xref="GOA:Q0SWB5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB5"
FT                   /protein_id="ABG87532.1"
FT                   /translation="MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRPL
FT                   AMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLVKK
FT                   VKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFLAAL
FT                   SRLLSAWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNPLYYL
FT                   AVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFNKFRPEFDDVL"
FT   gene            313920..315092
FT                   /locus_tag="CPR_0255"
FT   CDS_pept        313920..315092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0255"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85930"
FT                   /db_xref="GOA:Q0SWB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB4"
FT                   /protein_id="ABG85930.1"
FT                   /translation="MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVSF
FT                   EISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELTGM
FT                   ENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAINVDP
FT                   DILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQKGEV
FT                   IDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIVVKSNKKNVEYLEKLDLEVEYD
FT                   LISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKLKVSLNK
FT                   INLVAGVYYIDFVLRDGEEEVYRKINVYSFTLNDKYRGEGFLILGHSWGN"
FT   gene            315106..316389
FT                   /locus_tag="CPR_0256"
FT   CDS_pept        315106..316389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0256"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86485"
FT                   /db_xref="GOA:Q0SWB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB3"
FT                   /protein_id="ABG86485.1"
FT                   /translation="MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALTY
FT                   RKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYRTS
FT                   EQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQYIK
FT                   EKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEEIEEI
FT                   RGKENVAMITNGVQYDHWQYRSDEVPEKLKDIVSKGNPIIGYFGALAKWFDYELLKKVA
FT                   KERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTIPFLLND
FT                   ITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALTLDKKDEY
FT                   YNYLKEEALANTWREKAAILDRLIEKNI"
FT   gene            316408..317643
FT                   /locus_tag="CPR_0257"
FT   CDS_pept        316408..317643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0257"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86244"
FT                   /db_xref="GOA:Q0SWB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB2"
FT                   /protein_id="ABG86244.1"
FT                   /translation="MSLKRSVKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKNG
FT                   NYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEENLY
FT                   LVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVDDLS
FT                   DDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGVQYEH
FT                   FANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVLIGIDY
FT                   DQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFMVNEITEATSPVKLFEYMA
FT                   LGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEGNQNTWRQ
FT                   KAKDIKELILNS"
FT   gene            317657..318838
FT                   /locus_tag="CPR_0258"
FT   CDS_pept        317657..318838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0258"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86657"
FT                   /db_xref="GOA:Q0SWB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB1"
FT                   /protein_id="ABG86657.1"
FT                   /translation="MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTDV
FT                   SFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPELT
FT                   GEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVAINI
FT                   NPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIWLEKG
FT                   RVVDIGPSFDIVEKYYDKLMKSDDKEELETGKFVELINVEILDDKKVYKKGESIEFLVE
FT                   YEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRNKITFKI
FT                   DSLDVKEGIYYLDAIFSESQNLVALETQEDVVSFEVKNEGESEGFVFLDSTWT"
FT   gene            318953..320386
FT                   /locus_tag="CPR_0259"
FT   CDS_pept        318953..320386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0259"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85723"
FT                   /db_xref="GOA:Q0SWB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWB0"
FT                   /protein_id="ABG85723.1"
FT                   /translation="MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLELT
FT                   KVINEDGEETAYYENKITEEDILSGNFNELCYKTSKYIDDAISSILFEGQFNCFYEKIK
FT                   SILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNIYSIKKI
FT                   KDNLYVLNLDMYSLNVAFFEAIKSINKPKFVHVYATCLNSVDYEKIKTYMNKGFKVIYD
FT                   FVDELSSEISGYNITSKMIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENENNILAP
FT                   NAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWVDYKLIEELAKEREDYEIVL
FT                   IGMDYDGSYDQSNLKNYSNISYLGMIDYKYLINYSRYFDVCIVPFIKNDITDSTSPLKI
FT                   FEYMALEKPIVTTDINECKNYESCLISKDYDEFIRNIDKALKLEIDNKEYFNILRREAE
FT                   ENTWDNRAELIKEAIKNLE"
FT   gene            complement(320522..321175)
FT                   /locus_tag="CPR_0260"
FT   CDS_pept        complement(320522..321175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0260"
FT                   /product="haloacid dehalogenase, IA family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85510"
FT                   /db_xref="GOA:Q0SWA9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA9"
FT                   /protein_id="ABG85510.1"
FT                   /translation="MLSNIKGVIFDLDGTLVDSMGVWAKIDSDYLTDLGLEVPKNLKEE
FT                   ITHLGFKEVAKYFKKRFNIASSEEEIMKTWHDMAYVEYKNNIKLKPGAREFLEQLKESN
FT                   IKIGLATSNSYPLLEVCLKSNDIFHLFDSITITGEVPRGKDFPDVYLLAAERLGLEPKE
FT                   CAVFEDILPAVKGALSAGMKVFAVEEHTVSEEEKSQIKEIVHEYIDSFNDLLVN"
FT   gene            complement(321257..322606)
FT                   /locus_tag="CPR_0261"
FT                   /note="CPE0276"
FT   CDS_pept        complement(321257..322606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0261"
FT                   /product="[Fe] hydrogenase"
FT                   /EC_number="1.12.7.2"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02906"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86513"
FT                   /db_xref="GOA:Q0SWA8"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA8"
FT                   /protein_id="ABG86513.1"
FT                   /translation="MNKKYDSLFKELISSYYSEDNFDEKLNDIVKNNFNSKEDAIDVLS
FT                   SLCGVDIDKNSDNIAYDIRKAITTQKIKKNIVDKVSVCTKNCSKESKGKCQSLCPFDAI
FT                   LTDPIDNSKYIDPNLCQNCGICVQVCESGHFLDRIELLPIIDLIKNNETVIAAVAPAIA
FT                   GQFGENVSLDMLREAFIKIGFSDMIEVAFAADILSIKEAVEFNHHVEKTGDILITSCCC
FT                   PMWVAMLRKCYKDLVKDVSPSVSPMIAAGRVIKKLNKDAKVVFIGPCIAKKAEAREKDL
FT                   VGDIDYVLTFEELKGIFEALKIDLSSMKGVPSIEYTSRGGRLYARTGGVSEAINDVVKE
FT                   LYPDKAKIFKAVQANGVKECKELLNKVQSGELKANFIEGMGCVGGCVGGPKRIVDPSIG
FT                   KKHVDEVAYNSPIKVATHSHTMDEVLLRLGINSLKSFEDKEKISIFEREF"
FT   gene            322745..322891
FT                   /locus_tag="CPR_0262"
FT   CDS_pept        322745..322891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85911"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA7"
FT                   /protein_id="ABG85911.1"
FT                   /translation="MKYIILTGILALIWMFYMALFTAAAKEDRYFEEEFAKSIKEEGND
FT                   NLE"
FT   gene            complement(323069..323144)
FT                   /locus_tag="CPR_0263"
FT   tRNA            complement(323069..323144)
FT                   /locus_tag="CPR_0263"
FT                   /product="tRNA-Pro"
FT   gene            323179..323568
FT                   /locus_tag="CPR_0264"
FT   CDS_pept        323179..323568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85561"
FT                   /db_xref="GOA:Q0SWA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA6"
FT                   /protein_id="ABG85561.1"
FT                   /translation="MSTKKLKKLKYIIFLMDVIMLSSNLKIKNEVKQMKISSIVMLAAS
FT                   FLLIVVGIVLFANRKRFEGENQAGKYNAKYIQSNAIGNIFIGFLGTILGVLDNFVNGNS
FT                   IKIAFAVIIIGGSIIQKLIGNKISK"
FT   gene            323753..325051
FT                   /locus_tag="CPR_0265"
FT   CDS_pept        323753..325051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0265"
FT                   /product="NlpC/P60 family"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86564"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA5"
FT                   /protein_id="ABG86564.1"
FT                   /translation="MKKKIISTVLAATMTFGVGHSVFATPLTDDQKQQMEHNQDKYADI
FT                   NSKIRELEDKIDGLSAKIEPLFFQVEKNKEEISKTEESISTVKVQIEESKKKIEKQQEV
FT                   LGQRIRATYKSGGQANYLTALLDSNGIGDFLSRVQAISKVMGMDKQVIDELTSEKEKLD
FT                   SEVKELQDKTTELNKLNSETQSKIDELNKMKAEQEGVIKDMKAEQEKVVGELAPLERQL
FT                   MEPWTSKINSNSSLNDLNQAVTALRGLRNQIKTPEVDAEAVQAIEKAKDLIETKKAEEA
FT                   VSSAPNRGGDVNTGGSSSSASNGSSSSNSGSTVAPPSEGAASAVVSYAYQFIGRPYVFG
FT                   ATGPDTFDCSGFTSYVYRNAVGREITRTTYTQINQGRPVSRDQLQPGDLVFTNGVGHVG
FT                   IYVGGGQMIHAARPGVGVIVGPIYNFSSARRIL"
FT   gene            325246..325995
FT                   /locus_tag="CPR_0266"
FT   CDS_pept        325246..325995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM23407.1; match to
FT                   protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87345"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA4"
FT                   /protein_id="ABG87345.1"
FT                   /translation="MDLTLVKENETLDDLQLDGLHLIQKKEGFRFGVDAVLLANFANVN
FT                   RKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKINDVQDKVSFICG
FT                   DLKDKELNRSMPKFDVVTVNPPYKLNNAGIINSEDKLAIARHEIMCNLEDVIAASRRFL
FT                   KDNGRLYMVHRPERLADIFCLMRKYKIEPKRVRMVHPNTKKAANIVLVEGQRDGGAFLK
FT                   WEAPLYVYKDEGGYSEEIDKIYGRESK"
FT   gene            325998..326840
FT                   /locus_tag="CPR_0267"
FT   CDS_pept        325998..326840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0267"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85639"
FT                   /db_xref="GOA:Q0SWA3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA3"
FT                   /protein_id="ABG85639.1"
FT                   /translation="MSKVYLVPTPIGNLGDITLRALEVLKNVDLIAAEDTRQTLKLLNH
FT                   FEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVIVEKCIEEGI
FT                   EFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYESPY
FT                   RILDTIDTLKEGLGNRKVAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCVISGK
FT                   TDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKFSLDI"
FT   gene            complement(327007..327246)
FT                   /locus_tag="CPR_0268"
FT   CDS_pept        complement(327007..327246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0268"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86989"
FT                   /db_xref="GOA:Q0SWA2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA2"
FT                   /protein_id="ABG86989.1"
FT                   /translation="MKSTGVVRRVDELGRIVIPIELRRTLDIAEKDALEIYVDGEQIIL
FT                   KKYEPACIFCGDARDVVNYKGKNICQKCLDELKK"
FT   gene            327936..328535
FT                   /locus_tag="CPR_0269"
FT   CDS_pept        327936..328535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D96938; match to
FT                   protein family HMM PF08876"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87618"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA1"
FT                   /protein_id="ABG87618.1"
FT                   /translation="MDINNFNSEQIKFLAEEMSKNSMVSYDDLPKYDLFLSQVIDYLND
FT                   KFTEDKFTNNIVQNYIKSEVISKPEDGKKRGYTKVHLAQLVLLSYMRPLLKTDEIKKVF
FT                   ALAFNNINDRSDDIISWETAYKMFGEVQEESIKRFLEVPLVDNDKIEEIIQVSDIKEED
FT                   RDCIVTFLTVMTLIAQASVVKKVVQKIVNGYHKEEK"
FT   gene            complement(328572..329447)
FT                   /locus_tag="CPR_0270"
FT   CDS_pept        complement(328572..329447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0270"
FT                   /product="putative aldose 1-epimerase"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87742"
FT                   /db_xref="GOA:Q0SWA0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SWA0"
FT                   /protein_id="ABG87742.1"
FT                   /translation="MIYTLENQHLKISLSNYGGELHSIKGKKDNTEFLWSGDEAYWKYH
FT                   APVLFPIVGKVFNGKYTVDGITYELPQHGLARVRDFEMIEQTKNSISFELKYSEDTLKV
FT                   YPFKFSLIIKYTLNDINLSIDYIVKNLDNKEMYFSIGAHPAFMCPIENDKFDDYYFEFN
FT                   KKENASIMQLVDPGYFSKEEKSYLKDENIINLSTDLFKNDALVFKNLKSNKISLKSKNH
FT                   KKYLEFDFGEFPYLGLWTKDTGAPFVCIEPWFGHADFDGFNGEFKDKAAIQSLIPNKEF
FT                   HCNYNISFFE"
FT   gene            complement(329558..330580)
FT                   /locus_tag="CPR_0271"
FT   CDS_pept        complement(329558..330580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0271"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85700"
FT                   /db_xref="GOA:Q0SW99"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW99"
FT                   /protein_id="ABG85700.1"
FT                   /translation="MSQGKHAKKNDSNSQGNTPKKKSKVKIIVLTLFFLLLIGIGLGAT
FT                   YVYSTLNKMDIKKIAQDDKSLGIDESNKDLFQDGILNIALFGVDSRDHNNVGRSDSIII
FT                   ATIDTKHDKIKLTSLMRDSYVEVDGHGKTKLTHAYAYGGPTLALKTINENFGLDIKDYV
FT                   TVNFDNLAEIIDDLGGVPINIKPYEVKEVNNYAKNVAEIAGREYTPVSEGEQVLNGAQA
FT                   VGYSRIRYVGDGDYERTERQRNVLDAIIKKLSTLKPSEYPETIKKFLPYVETNLTPSKI
FT                   LSIAKSVASTGIPPVENMRFPLNGYCKGEMIDGVWYLTFDEAKTKEQIQNYIYKDVNPK
FT                   "
FT   gene            330756..331607
FT                   /gene="yihY"
FT                   /locus_tag="CPR_0272"
FT   CDS_pept        330756..331607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yihY"
FT                   /locus_tag="CPR_0272"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85963"
FT                   /db_xref="GOA:Q0SW98"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW98"
FT                   /protein_id="ABG85963.1"
FT                   /translation="MKKKSKGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFIP
FT                   FLMFLMNLVGFSHLNSDTILNLLSNVMPTEAFNLIQSTVIEIVDKEQTGLLWISIALAI
FT                   WVSSSGFKAVIKGLNKAYGVKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDVIGD
FT                   FFIKVLEHPEVIYYIWNMLRYVVVILIMVLFFMFLYNATPCVRLGWLEVIPGAVITTLG
FT                   WISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTWMFITSMILILGGEINAVLAEKNRLK
FT                   DL"
FT   gene            complement(331668..332654)
FT                   /gene="galE_1"
FT                   /locus_tag="CPR_0273"
FT   CDS_pept        complement(331668..332654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE_1"
FT                   /locus_tag="CPR_0273"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86328"
FT                   /db_xref="GOA:Q0SW97"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW97"
FT                   /protein_id="ABG86328.1"
FT                   /translation="MAILVCGGAGYIGSHMVAELIENNKEVVILDNFEKGHEDAILGGK
FT                   LYKGDLRDRKILDKIFTENNIEAVIDFAAYSLVGESMTEPLKYFNNNVSGTISLLEAMR
FT                   DHNVKYIVFSSTAATYGEPENIPILETDKNLPTNAYGESKLLVEKILKWCDTAYGIKYT
FT                   ALRYFNAAGAHVNGKIGEDHAPETHLIPLILQVALGKRDKIMMFGDDYDTKDGTCVRDY
FT                   IHVSDLASAHSLALERLMNGGESRIYNLGNGTGFTVKEVVEVARKVTGHQIPAEVAPRR
FT                   AGDPAILIASSDKAIEELNWKPKFNSLETIIETAWNWHKNHPNGYEK"
FT   gene            332808..333152
FT                   /locus_tag="CPR_0274"
FT   CDS_pept        332808..333152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0274"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87546"
FT                   /db_xref="GOA:Q0SW96"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW96"
FT                   /protein_id="ABG87546.1"
FT                   /translation="MNKIVLLGRLVKDPELRYVEGGEKVYTKFTIAVARNFKSSTGERK
FT                   KDFIPIIMWEKKAEIACKYLKKGDLLSVSGRLITRSFEDTEGKRRYIVEVSVEDFKCVN
FT                   FNHDRVDNNF"
FT   gene            complement(333227..334426)
FT                   /locus_tag="CPR_0275"
FT   CDS_pept        complement(333227..334426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0275"
FT                   /product="metallo-beta-lactamase family/flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85674"
FT                   /db_xref="GOA:Q0SW95"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW95"
FT                   /protein_id="ABG85674.1"
FT                   /translation="MKHLNIKDDLFWVGALDPNLRVFDIIMYTPYGTTYNSYVVKGSEK
FT                   TAIFETVKAEFFDQYIARLKDLGVEPSEIDYIVVSHTEPDHAGSIGKILELAPKAKIVA
FT                   SPIAINYIKEIVNGDFESIPVKDGDSISLGNKTLKFMSVPFLHWPDTIYTYVEEDKTLI
FT                   TCDSFGSHYSCEEMFDDLIPNEEEYMEALKYYFDCIMGPFKPYVLKALDKIKGLDIEII
FT                   CPGHGPILRSNPYKVVNLYKEWSTPAPAKEVKKASIFYVSAYGYTKQLAEKIAEGIKST
FT                   GNLDINLFNIIEHDMTELVGEVGSSDAILFGSPTIVNELVEPVRDLMAKLNPVIHGGKI
FT                   AGAFGSYGWSGEAVPRIESRLKELRMNMPVEGLRIKFKPSEEEAQKAFDFGVEIGNALK
FT                   "
FT   gene            complement(334905..335216)
FT                   /locus_tag="CPR_0276"
FT   misc_feature    complement(334905..335216)
FT                   /locus_tag="CPR_0276"
FT                   /note="identified by match to protein family HMM TIGR01167;
FT                   similar to endo-beta-N-acetylglucosaminidase; frameshift"
FT   gene            complement(335129..335710)
FT                   /pseudo
FT                   /locus_tag="CPR_0277"
FT   gene            complement(335925..337115)
FT                   /locus_tag="CPR_0278"
FT   CDS_pept        complement(335925..337115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0278"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87487"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW93"
FT                   /protein_id="ABG87487.1"
FT                   /translation="MKRAYKMEINPTDEQKSKIHQTIGVSRFIYNFYIARNKEIYEKEG
FT                   KFVSGMDFSKWLNNEYIPNNQEMKWIKEVSSKAIKQAIMNGDKAFRDFFKKAKGFPRFK
FT                   KKKNQDVKAYFPKNNKTDWTLERHRVKIPTLGWVRLKEFGYIPVNSIVKSGTVSQKADR
FT                   YYVSILVEEIDIKTSNSNIGIKIFNHNNEGVGIDLGIKEFAVCSDGIKFKNINKNSTVK
FT                   KIEKKLKREQRKLSRKYESLKIRNKKEKGGNVTRQNIQKQIVKVQKLHQRLTNIRTDYI
FT                   NKIVSSIIKQKPSYITIEDLNVKGMMKNKHLSKAIASQKFFEFKTKLMSKCKQNDVELR
FT                   IVDRFYPSSKTCSQCGKVKKDLKLSDRVYKCSCGFVIDRDLNASINLRNAKEYKIA"
FT   gene            complement(337515..337841)
FT                   /locus_tag="CPR_0279"
FT   CDS_pept        complement(337515..337841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0279"
FT                   /product="surface layer protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85319"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW92"
FT                   /protein_id="ABG85319.1"
FT                   /translation="MKFPGAKVESSTEQNPTVTYEKEGVYPVTLTAKNSSGENVETKTE
FT                   LITVANAAKDGLVNLSLNKSAKASSFVNENEAPQYALDGNVKTKWCAVGSAPNTLTIDL
FT                   GDAH"
FT   gene            complement(337838..340060)
FT                   /locus_tag="CPR_0280"
FT   CDS_pept        complement(337838..340060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0280"
FT                   /product="Glycosyl hydrolase family 85 family"
FT                   /note="identified by match to protein family HMM PF03644"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87058"
FT                   /db_xref="GOA:Q0SW91"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW91"
FT                   /protein_id="ABG87058.1"
FT                   /translation="MTNKQKIRKRRRALLCVFAAFAFSFNPLGKIAYATPKQDTSVVNY
FT                   VKTQEETSNSIQNQPISSYWYPEDLLKWSANNDKDAKFNKSTVPLAKRVEKDKLDTIND
FT                   TQNKDVKVVAISIMNANTSGNPSQGSNKFSANTFSYWQYIDKLVYWGGSAGEGLIVPPS
FT                   PDVTDSAHRNGVPVLGTVFFPMTAHGGKMEWLNKFLEKDSNGNFPIIDKLIEVAENYGF
FT                   DGWFINQETEGTEQEPLTPEHAKLMQELIRQFKAKSNGKFEIMWYDSMTKDGNMDWQNA
FT                   LTDKNEYFLLDGDKNKVADSMFLNFWWTYNSLKDKDLLKVSNEKAKEIGINPYDLYAGI
FT                   DVQENGYKTPLRWTHYQRDDQAPFTSLGLYCPSWTYFDAKTQEQFQENESRLWVNEHGD
FT                   PSKATNAQGVDWRGISTYSVEKSAVTSLPFTTNFNMGNGYDFYVDGNKVSTQDWNNRSL
FT                   NDIMPTYRWVISNEENNNVKADIDYTTAYYGGNSIKLSGYLAEGKASTIKLYSSDLTLP
FT                   EGVQFTTTAKANGNTVDMDLVLTFHDGTETTISADKKLSTDWTKLTYDISPYVGKSIKT
FT                   ISYKLSSPVCVDNFLANLGNITIEIPNSSSKVNISNAKLNDVDFKDGIYAGARLSWSPE
FT                   GNSSDVHHYEIYRVMNDGTKVLLGATPNTSYYVSDLRRNDKETNTNFEVVAVNKNYNRG
FT                   NSQSINIEWPSYPSPAASFKVSNTLIAPGQSVTFTNTSSEVTEEIQ"
FT   gene            340430..340735
FT                   /locus_tag="CPR_0281"
FT   CDS_pept        340430..340735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:A96960"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87764"
FT                   /db_xref="InterPro:IPR017016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW90"
FT                   /protein_id="ABG87764.1"
FT                   /translation="MKIVKNLCNEVNLEDKCCKLCYRLIESYFNGTIVYGIEVERKDFK
FT                   DSNLINIERDSVCKISPNKDKVEVLVDKLYKYEVSPIHLIDIIGEDVDNCVADFIL"
FT   gene            340784..341185
FT                   /gene="acpS"
FT                   /locus_tag="CPR_0282"
FT   CDS_pept        340784..341185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="CPR_0282"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by similarity to SP:P96618; match to
FT                   protein family HMM PF01648; match to protein family HMM
FT                   TIGR00516; match to protein family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85846"
FT                   /db_xref="GOA:Q0SW89"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW89"
FT                   /protein_id="ABG85846.1"
FT                   /translation="MIIGIGVDIIEIGRVRQAIRNNKNFLSKLFTEREIDYFISRNMNS
FT                   EVIAGNFAAKEAVSKALGTGMRGFSFKDIEILRNELGKPEVILHNGANLIGNKLVENNN
FT                   SLRVHLSISHNNSSAIAYSVLEGEYYGNI"
FT   gene            341172..342671
FT                   /locus_tag="CPR_0283"
FT   CDS_pept        341172..342671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0283"
FT                   /product="carbohydrate kinase family protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03853; match to protein
FT                   family HMM TIGR00196; match to protein family HMM
FT                   TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86173"
FT                   /db_xref="GOA:Q0SW88"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW88"
FT                   /protein_id="ABG86173.1"
FT                   /translation="MEIFSSNSIRNMDKDYIEKFNMPSIVLMENAIIKFLENIDLTKES
FT                   FTIISGRGNNGGDALGIARHLLNKGKKVYVHILEKEKEGSVDYKTNLTILENLGCYINS
FT                   ISNNKDLEILKNNIINSEIIIDGIFGTGLNKEIAGIYFDTIKCINENSKFTVSIDVPSG
FT                   INSDDGSICGIAIKANKTISFQVYKLGFLNYKSFEYLGDLKIVDIGIPKSIVYKNSNNM
FT                   RFIDKEYIRNIFPYRNKYGHKGTYGRSLIFAGQKGFIGAAYMVGEAAIKTGAGLVTVFT
FT                   HKDVQSELSIKLNEGMTGTYNSKEEYEEFIGGADVIAFGPGMGNNDLTFEVLNNICNLY
FT                   SGALVIDADGINVLERKKYILKEFKGDIVLTPHPGEMARLLGIEIKDVERDRIGIAKKF
FT                   AKENKVTVLLKGYNTIITDGDKVFVNPTGSSAMASGGMGDTLTGIITSLISQGVNSFDA
FT                   AILGAYIHGYIGDELSKENFTVSAMEIIKNIPNKIKELINF"
FT   gene            342732..343325
FT                   /locus_tag="CPR_0284"
FT   CDS_pept        342732..343325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D96960"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85555"
FT                   /db_xref="GOA:Q0SW87"
FT                   /db_xref="InterPro:IPR014584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW87"
FT                   /protein_id="ABG85555.1"
FT                   /translation="MKGKRNAILIILLIIILGVIGGLAIYQRTYNLTPEDILEDMFSIE
FT                   SYETEIIYDVKNSRGQFQEKGRIYYDEEVGTKIVLDDREQLFEKDKIIINYVKDEKTYE
FT                   VGRDYDQFYRFMFINELKDLCNEEHEFTYKWNDENEKSEIILEFKNLNGNENFSREVMI
FT                   IDAKKKVPKEAIIYDRDDLESVYIKFNNFSKVKN"
FT   gene            343571..343813
FT                   /locus_tag="CPR_0285"
FT   CDS_pept        343571..343813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM25326.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86251"
FT                   /db_xref="GOA:Q0SW86"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW86"
FT                   /protein_id="ABG86251.1"
FT                   /translation="MSVSKIKKQDSKKEKKIENFSQLKVRNIIKYSEDKKEDDFYEVMK
FT                   EGYKAMALINSQYAEEGTSVEYFDQIEYETWLCGV"
FT   gene            343819..344172
FT                   /locus_tag="CPR_0286"
FT   CDS_pept        343819..344172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0286"
FT                   /product="PemK family protein"
FT                   /note="identified by match to protein family HMM PF02452"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86935"
FT                   /db_xref="GOA:Q0SW85"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW85"
FT                   /protein_id="ABG86935.1"
FT                   /translation="MASLNVKRGDIFYADLSPVVGSEQGGIRPVIIIQNDIGNRYSPTV
FT                   IVAAITSQINKAKLPTHVEISSEEYGLNRDSVVLLEQIRTLDKKRLKEKIGHMTEEDMK
FT                   KVNKSLLISLNLQ"
FT   gene            344609..345433
FT                   /locus_tag="CPR_0287"
FT   CDS_pept        344609..345433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0287"
FT                   /product="putative transketolase, N-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87683"
FT                   /db_xref="GOA:Q0SW84"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW84"
FT                   /protein_id="ABG87683.1"
FT                   /translation="MSNKIQELKSMSKVIRKDIVTMLTESASGHPGGSLSIADIVTILY
FT                   FDEMNIDPKNPKDPNRDRFVLSKGHAAPVLYSALARRGYFDPAELTTLRKFGSNLQGHP
FT                   NMNDLPGIDMSTGSLGQGISAAVGMALAGKLDNKDYRVFTILGDGELEEGQVWEAAMSA
FT                   AHYRLDNLTAFVDFNGLQIDGDIKEVMNPCPIDKKFEAFGWNVIVINGHDYEEIINAIQ
FT                   KAKSTKGAPTCIVCNTVKGKGVSFMENEAAWHGTAPTKEQCEQAIKEIGGDN"
FT   gene            345433..346377
FT                   /locus_tag="CPR_0288"
FT   CDS_pept        345433..346377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0288"
FT                   /product="putative transketolase, C-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85814"
FT                   /db_xref="GOA:Q0SW83"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW83"
FT                   /protein_id="ABG85814.1"
FT                   /translation="MAKKIATREAYGKALAALANENKNIVVLDADLSKSTKTADFKKAC
FT                   PERFINMGIAEGNMMSVAAGLSTCGKIPFASTFAMFAAGRAFEQIRNSICYPRLNVKIC
FT                   ATHAGLTVGEDGASHQAIEDLSLMRSIPNMTVICPSDAVETEAAIRAIAEYNGPCYVRL
FT                   GRAGVNVINDRPEYKFEIGKGIELKEGNDVTLFATGIMVDVAIEAVEALAKEGINARLI
FT                   NIHTIKPIDSELILKAAKETGAIVTLEEHNIIGGLGSAVAEVVGGEYPVPVVRVGVKDT
FT                   FGESGKPDQLLKAYGLTSEEAVKAAKKAMSLKR"
FT   gene            346496..346588
FT                   /locus_tag="CPR_0289"
FT   CDS_pept        346496..346588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87382"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW82"
FT                   /protein_id="ABG87382.1"
FT                   /translation="MLILKIEGNNINDELIINLKWGEQIKYKSI"
FT   gene            346604..347461
FT                   /locus_tag="CPR_0290"
FT   CDS_pept        346604..347461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0290"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85419"
FT                   /db_xref="GOA:Q0SW81"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW81"
FT                   /protein_id="ABG85419.1"
FT                   /translation="MKISMKTLKEYGIITLGVILLAISLEYFYYPNDIAAGGVSGLALV
FT                   INKITGISQGMFMNVANVILFALAFWLIGGSFGGRSIYAAFGLSITISLIESFLPTFAL
FT                   TENMLLATIFGSVVGAFGIALVFSQNSSTGGTAIVAKILNKYLHIEIGKSLLCADCVVV
FT                   VCALLVFGVDKALFGLIGVFIMGILIDKIIEGFNSCKQLLIISEKSEEISQVIMKEIER
FT                   GCTKIEGTGGYSKEPVTILYVVVNRRQFISLKKKIKEIDPRAFITVNDSKEVFGEGFLD
FT                   LVEM"
FT   gene            347659..348345
FT                   /locus_tag="CPR_0291"
FT   CDS_pept        347659..348345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0291"
FT                   /product="putative cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87302"
FT                   /db_xref="GOA:Q0SW80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW80"
FT                   /protein_id="ABG87302.1"
FT                   /translation="MIEFRNVSKVYNKNVKALTNVNINIDKGEFVFLVGPSGAGKSTFI
FT                   KMLLKEVEPSTGNIVMGNEDLSKIKRRQIPYHRRKIGMVFQDFRLIPTLNVYENVAFAM
FT                   RVVGASPKEIRKRVPMVLSLVGLSDKYKMFPNELSGGEQQRVSIARAIVNNPKVLIADE
FT                   PTGNLDPETAKEIMELIDDINKAGTTVVMATHAKEIVNSMKKRVIAIDKGEVVSDVQKG
FT                   GYEYEV"
FT   gene            348335..349243
FT                   /locus_tag="CPR_0292"
FT   CDS_pept        348335..349243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0292"
FT                   /product="putative cell division protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87439"
FT                   /db_xref="GOA:Q0SW79"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW79"
FT                   /protein_id="ABG87439.1"
FT                   /translation="MKFSTIGYFISDAFKSLKRNRTISIASIATVLTTLFIFGAFLLTA
FT                   LNVKNGVTDVQDKVEVKVFLKDDVTQAQRDAVEAKLKTVQGVKEVEFESKDQAFAKMEG
FT                   SSDYNKEILAGYSKENNPLPASYIVRLESPEVASGVESAMKNNDKFMAGVEDVGNDEAL
FT                   IGTINSFVKVINTVGLVLGVVFVGVSLFLIVNTIKITVYSRRREVGIMKFVGATDWFIR
FT                   WPFVIEGIIIGLVGGILSTLLLFAGYNFLYEKIVSSSSLYMPQFVQPMYVLTTMSWQFI
FT                   LAGIVIGAIGSIIALRKFLDV"
FT   gene            349332..350618
FT                   /locus_tag="CPR_0293"
FT   CDS_pept        349332..350618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0293"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86905"
FT                   /db_xref="GOA:Q0SW78"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW78"
FT                   /protein_id="ABG86905.1"
FT                   /translation="MSHNKDEKNKYNNIIKNLKKKKGFRALAMGVGLTLIIGVSVYAGN
FT                   RLTAFGILPITSVSAVQSSLEKVNDTKNFKKVLEVREMLYRWYDGEIDDSKLAEGAIKG
FT                   MVSSLGDQYTYYMNGKEFSDFKEKSQGNYMGIGIQVAVKDGKIVVISPIQGGPAEKAGI
FT                   KTGDIILKINGEQVSGSELDKAVSMMKGATKENIKLTLYREGKGEFDVDVMRDVIKTVN
FT                   VKSEMIKGDIGYIEVLAFDEGTAKDFETQLKALEEKGMKGLILDLRGNPGGFMKECVDL
FT                   VSNFVPKDKVIVSTIDKYGNKEESVSKGGIAQGMPLVVLIDGGTASASEIVAGAIRDYD
FT                   LGTLVGTTSFGKGIVQVVLDKIGQEKDGTALKVTISKYYTPNGENIHKKGIGPDVTVEY
FT                   PKELKEKTYSRSTDPQFEKALEIIQEKIK"
FT   gene            350641..351921
FT                   /locus_tag="CPR_0294"
FT   CDS_pept        350641..351921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0294"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86608"
FT                   /db_xref="GOA:Q0SW77"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW77"
FT                   /protein_id="ABG86608.1"
FT                   /translation="MNLLIENIRGLSYALVSPTLSLMLIVIAIIFYFKNRKIAFMQKLM
FT                   LGRSIQSPLEMTLLQILIGILGGLIASLLLSILGVTFENSSLIDVILTVSVFSVLYKNR
FT                   FLKFPYIAALLGVIGVLVSKNIKYFGRGFSFSINLTSIIVLIGVFSIVEGILAMIDGDK
FT                   GYLPIFTQKDGKLVGGFGFKRFWALPLCLLVVLGANSGNSIINEVKDLPQWLPFFNGDK
FT                   VRGLMSAAALGTLAAYGATSYEGTTFTQSKRSKTITSGLINIAYGIVVIILAYLLKESL
FT                   IFTISLIILIPLLYEFRIRVELKLESLREPLYFSNDDEICILDVLPNSIAYKKGLRSGD
FT                   KIVKINEEIPKNEKEVFMAIKRNFYGLNLEIRKNNGNIEKHTIAGKDRGKQFGIVLVPK
FT                   GISFDKEIDEFLEKLKKASKDEEVKNK"
FT   gene            352009..353988
FT                   /gene="uvrB"
FT                   /locus_tag="CPR_0295"
FT   CDS_pept        352009..353988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="CPR_0295"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="identified by similarity to SP:P37954; match to
FT                   protein family HMM PF00271; match to protein family HMM
FT                   PF02151; match to protein family HMM PF04851; match to
FT                   protein family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86249"
FT                   /db_xref="GOA:Q0SW76"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW76"
FT                   /protein_id="ABG86249.1"
FT                   /translation="MGEFKIQSKFKPTGDQPKAIDTLVQSIENGNRGQTLLGVTGSGKT
FT                   FTMANIIERTQKPTLILAHNKTLAAQLCAEFKEFFPDNIVEYFVSYYDYYQPEAYVPQT
FT                   DTFIEKDASINDEIDKLRHSATSALLERRDVIIVASVSCIYGLGNPEEYKKLTISLRPG
FT                   MIKDRDEVIKKLIEIQYERNDIDFARGTFRVRGDNLDIIPSSSSSKGIRIEFFGDEIDR
FT                   IREFDVLTGNIIGERQHVSITPASHFAASEETLEKSISIIEDELEDRLKVLTAEDKILE
FT                   AQRLKQRTNYDIEMIREMGYCQGIENYSRILDGRMPGTPPQTLLDYFPEDFLMFIDESH
FT                   VTLPQVRAMYAGDRSRKTSLVEFGFRLPCAFDNRPLKFSEFESKINQVVFVSATPGEYE
FT                   LDHSEIVAEQIIRPTGLLDPVIEIRPIKGQIDDLYGEIQRTVQRGFRVLITTLTKRMAE
FT                   DLTKYLKDLNVKATYMHSDIDTLERMKIIRELRLGEVDVLIGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNSESKVIMYADNITKSMDKSIKETERRRVIQMEY
FT                   NEEHNITPTTVIKGVRDIIEATKVSEEKENYESEVKKAAKKDIPIEKLIEQYEEEMKEA
FT                   AKNLQFERAAELRDIIKDLKENSK"
FT   gene            354250..355101
FT                   /locus_tag="CPR_0296"
FT   CDS_pept        354250..355101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0296"
FT                   /product="degV family protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85495"
FT                   /db_xref="GOA:Q0SW75"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW75"
FT                   /protein_id="ABG85495.1"
FT                   /translation="MAVKVITDSTSCIPKDLAEKYGVEIVSLSVIMNGESYKEVDIDSE
FT                   AFYDELAKCDKLPTSSQPPMDEFYNAFEKFAKDGHDIVAAFISSKLSGTYTTSHIIKDM
FT                   ILEKYPDVKIDLIDSQTSVMALGIGVLEGAKAAQEGKDFDEVSKIVRNTIEESEIIFVP
FT                   GTLENLKKGGRIGGAAALFGKMLKINPILTVKEGAVVVMDKVRTKKRAIDKIVEVVKQD
FT                   LKQKGIKQAVVCHILAEDEAKDLAKRLKEELDLDSMIGEISAVIGVHVGVKSVGIAYAR
FT                   ES"
FT   gene            355337..356062
FT                   /locus_tag="CPR_0297"
FT   CDS_pept        355337..356062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0297"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87008"
FT                   /db_xref="GOA:Q0SW74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW74"
FT                   /protein_id="ABG87008.1"
FT                   /translation="MISLKEVNKEYTQGVKAVDNLNLEIKDGEIFGILGPNGAGKTTTI
FT                   SMITGITEPTMGEIKINNIDISKNPVEAKMQFGYVPDSPDMFLRYKGIEYLNFMGDVYN
FT                   VSESDREERIKDLAKRFEMTNALGDKIQSYSHGMRQKIIIMGVLIHKPSIWILDEPLTG
FT                   LDPKSSYILKEMMREHASEGNTILFSTHVLEVAEKLCDRVGIIKKGKLIFVGTLEELKE
FT                   EFKGDESLEKMFLEITENE"
FT   gene            356055..357653
FT                   /locus_tag="CPR_0298"
FT   CDS_pept        356055..357653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0298"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86005"
FT                   /db_xref="GOA:Q0SW73"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW73"
FT                   /protein_id="ABG86005.1"
FT                   /translation="MNRIKLLLKYFIGNSFYNASSNIKSRNIAIVMYILIIIGISTPIA
FT                   NMIDSMYPNFASIGQEGYLLSIIFLIGSLTLLVLGVYDILDSFFFSQDIEPLMPLPFKS
FT                   GEIMIGKFITCLVDMYIYLSITIIPLISFGLNAKMGFSYFLMIIPVYLFAPIIIVIFCI
FT                   LITMILMSFINVSKYQNAFKIIFGTLGIVLILGVYSLNSTGLNSENVSVALKNKTALVD
FT                   LTNKIFITTTFSVKALLYSNSLKGLLNLGFLILISIVALIIAYFLGKLMYKKILSRNLN
FT                   VYSERKNILENNKDKVVVRSSVRKAMILREIRIILRDPSNFINCVVMIVYMPIFIFIFF
FT                   IKGNILAGDTQLAKDTIIMAATFIVTALTIAGNSVASTALSREGKEIFISKYIPVDYKV
FT                   QIQSKLIVSFIVNGLALILGIAILIYLKASPLVIVMSLLVQMGTIVAISLWGMILDYLS
FT                   PKLEWTDTKNLYSKNFKPLLVMLICLVIGGFNVGLIVTQSPIIVFLIDISILLIVSLIL
FT                   YKILMKKGLKVYKRL"
FT   gene            357875..358879
FT                   /locus_tag="CPR_0299"
FT   CDS_pept        357875..358879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0299"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85442"
FT                   /db_xref="GOA:Q0SW72"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW72"
FT                   /protein_id="ABG85442.1"
FT                   /translation="MKKILKIVGVILLSLIIIMGALAYYFRGQIGFYINIGKEYLEFKE
FT                   NPPSIEELKNIKMSEDMDFKDVVYKDTNGKPQTLDIYGPEKKLRHGSPVILYVHGGSWV
FT                   YGNKEIPDLIAPLLDSFRKEGYTIISVGYELATDKVDFKKQASDVKDAIRWVYKNKETY
FT                   GFNTDEIGVIGASAGAHLSLLATYSGEDEFVDDKELSNYPSKVKYVVDFFGPTELSALD
FT                   MTMASWDLNNSIEKTEKQLRGGESITEYMDKYSPINYVKPNLPKTLIVHGRQDKLVPYS
FT                   NSMNLYNKSRDMGNDIQILTLENSGHDFSQVDVNEVFELGFKVLNFILFNTKF"
FT   gene            359038..360603
FT                   /locus_tag="CPR_0300"
FT   CDS_pept        359038..360603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0300"
FT                   /product="MutS domain protein"
FT                   /note="identified by match to protein family HMM PF00488"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87142"
FT                   /db_xref="GOA:Q0SW71"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW71"
FT                   /protein_id="ABG87142.1"
FT                   /translation="MDKRLLKVLKYDYAVEMDKKRNLKAIRILYDMNEKEEYHIDEQTW
FT                   HDLDLDKVYSKLDRNYSSLGEAALYSMLRNPLNDEKKLNNRREEIEYFKENEEVRFNIM
FT                   GIFFELGRDKKNSLLDMINEKLIESNKFKYYFYTITGKILPLILILTSIFVSISAMLGL
FT                   MAVTFVNIYINSKERDRIKANGLMYLRRVIKASKQIVKINDKNLDDFNIKIKENLKDLK
FT                   SIDRNTRMISFINMCGGLFEFMSVLFLLEETAYYKIADSIEKNKDSILSLYKTLGEMEA
FT                   IISIGSYEEEKKDKITRPKFIKETTLEIKNGIHPIIENPVANSINMSKRGIVLTGTNMS
FT                   GKSTFLRMLGVNMLFAQAFNFVLAEKYEGPIFNIVTSISPNDDLSVGKSFYMAEAESIL
FT                   RIIRALDKNLPVFCAIDEIFRGTNPIERISASAEILTYINNKNSISIVATHDRELVDIL
FT                   KESYEFYYFSENVDSKNGLSFDYKLKRGVSKTRNAIKLLEYIGYPEDIINKSYRRSEKL
FT                   EGFI"
FT   gene            360618..361304
FT                   /locus_tag="CPR_0301"
FT   CDS_pept        360618..361304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0301"
FT                   /product="FCD domain protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86325"
FT                   /db_xref="GOA:Q0SW70"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW70"
FT                   /protein_id="ABG86325.1"
FT                   /translation="MFKPVKNMKVYEQVVDQIKEMVRVGQIKKGDKLPTERVMAEELQV
FT                   SRTSIREAMRALEVVGLIESRQGAGNYIREEFDDVLLEPLSIVFMLQNGTNKDIFELRE
FT                   VLELSTIFLSVMRISDEELKKLGGLVERFKTSRDEEENVKIDSEFHSIIVKGANNVLIT
FT                   NLLEGVSELVDKFISEGRRAILSDERNRGKLLDFHEKIYIAIKNRDAYSAYKHMQEHFQ
FT                   LIKKNI"
FT   gene            361538..363061
FT                   /gene="lctP"
FT                   /locus_tag="CPR_0302"
FT                   /note="CPE0310"
FT   CDS_pept        361538..363061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="CPR_0302"
FT                   /product="L-lactate permease"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85848"
FT                   /db_xref="GOA:Q0SW69"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW69"
FT                   /protein_id="ABG85848.1"
FT                   /translation="MNTYLMFFLALIPIIILIIGLGVLKIPAHKICPIALIITILLSIF
FT                   IWKMPTIDSLTAALEGIVLGIWPIMIVIIAAVFTYNLVVHTKAMEVIKSMLISVSDDKR
FT                   ILVLILAWEFGGFLEAVAGFGTAVAIPVGIMAALEFNPFFAAVICLVANTTPTAFGAIG
FT                   LPVITLANISGIPIESLSYYVVLQLFIFVVLIPFALVALTSKSLKGIKGVFGITLASGL
FT                   SFGIVQVLVAKFLGPELPAVLGSIVSLLVTIFIAKKFYKHNEETKREEKFELKSVLVAF
FT                   SPFILILVIIIGISPLFPGLYNKLSEVRTLVNIYTGVGAKPYTFVWLTTPGILILIASF
FT                   IGGFIQKASFKEMVEILLKTIKQMSKSTITILAIIALAKVMGYSGMVASIATVLVMITG
FT                   SFYAFIAPFIGALGTFVTGSDTSANVLFGSLQAEAANSLGISQAWLGEANTCGATAGKM
FT                   ISPQSIAVATAATGLAGKEGKILNSTLKVCIVYVILLGLISYLGSLIFV"
FT   gene            363156..363944
FT                   /gene="etfB"
FT                   /locus_tag="CPR_0303"
FT   CDS_pept        363156..363944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="CPR_0303"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86259"
FT                   /db_xref="GOA:Q0SW68"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW68"
FT                   /protein_id="ABG86259.1"
FT                   /translation="MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETA
FT                   LRIKEKKGGHIKVISMGPPQAKVVIKEAYSMGADEGTLVSDRKFAGADVLATSYTLSQG
FT                   VKKCGDFHIILCGKQTTDGDTAQVGPEMAEYLGISHVANVRRILDVNDDFIKVEMDMPN
FT                   TIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFEDKDEKKYGLNGS
FT                   PTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI"
FT   gene            363957..365150
FT                   /gene="etfA"
FT                   /locus_tag="CPR_0304"
FT   CDS_pept        363957..365150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="CPR_0304"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87032"
FT                   /db_xref="GOA:Q0SW67"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW67"
FT                   /protein_id="ABG87032.1"
FT                   /translation="MGRLVVHQDKIEDANSVIKICPFGAMEIVNGKVEINASCRMCKVC
FT                   VRKGPKGAFEFVEDENKVLVNKDEWKGIAVYVDHVNGEIHPVTLELIGKARELADKVNQ
FT                   KVYCLFMGNGIKDKAGELLHYGVDEVIVYDYKELENFRIEPYTAVFYDFINKIKPCSIL
FT                   VGATTLGRSLAPRVAARCRTGLTADCTILDIKENTDLVQIRPAFGGNIMAQIVTPNSRP
FT                   QMATVRYKVMSAPEINEECTGEIKYFEIENDKLKSDIEVKEIKQKPKEHSISDAEVIVV
FT                   AGRGVKSEKDLELIKELADLLGGELAVTRPLIENGWADANRQVGLSGRTVRPKLIITCG
FT                   VSGAIQFVAGMNNADYIFAINKDEKAPIFKVAHYGIVGDIYEIVPKLIEKIKEEGVL"
FT   gene            365152..366552
FT                   /locus_tag="CPR_0305"
FT   CDS_pept        365152..366552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0305"
FT                   /product="putative glycolate oxidase, subunit GlcD"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86796"
FT                   /db_xref="GOA:Q0SW66"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW66"
FT                   /protein_id="ABG86796.1"
FT                   /translation="MSYNKINESGIEFIKGIINDNERVFIGEEISEDYSHDELGSEKHM
FT                   PDIVVKAMNRDEIVEIMKYANNNNTPVTVRGAGTGLVGAAVPILGGILLDLSGMNKILE
FT                   LDEDNLTLTVEPGVLIMEIAKFVEEHDLFYPPDPGEKTATIGGNVSTNAGGMRAVKYGV
FT                   TRDYVRGMEVVLPSGEVLELGGKVVKNSSGYSLKDLIIGSEGTLGIITKIVLKLLPLPK
FT                   KVISLLVPFNDLESAIETVPKIIKSKNIPTAIEFMQRDLIISAEEFLGKKFPDSSSNAY
FT                   LILSFDGNSKEEVEGYYEKVADICLKEGALDVFISDTEERQESIWSARGAFLEAIKAST
FT                   SDLDEVDVVVPRNKVAEFVKFTNEVEEKLNVRIRSFGHAGDGNLHIYILKDELSEGEWH
FT                   KKLNEAMEILYRKQRELNGQVSGEHGIGLAKRLYLNESLNKATMDIMRGIKLAFDPNNI
FT                   LNPGKVCE"
FT   gene            complement(366635..367033)
FT                   /locus_tag="CPR_0306"
FT   CDS_pept        complement(366635..367033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO75282.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87537"
FT                   /db_xref="GOA:Q0SW65"
FT                   /db_xref="InterPro:IPR023813"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW65"
FT                   /protein_id="ABG87537.1"
FT                   /translation="MPKLLIPAIIFITLALIFYTIGVWSEHRAGILKKKHVIIFWCGLV
FT                   CDTLGTYTMSRIVAAGTDKGITPTDLLIHQSTGMLAIILMLIHAVWATIVLNRGSEKAK
FT                   AIFHKFSLVVWFIWLIPYFVGMYIGMTS"
FT   gene            367580..367762
FT                   /locus_tag="CPR_0307"
FT   CDS_pept        367580..367762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW64"
FT                   /protein_id="ABG85340.1"
FT                   /translation="MESVRKNIISIVSYNYGIGDGGYIEIHEMISDMKVEVDVGEDKYV
FT                   TKGSTLKLNGEVLYR"
FT   gene            complement(367889..368269)
FT                   /locus_tag="CPR_0308"
FT   CDS_pept        complement(367889..368269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS41741.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86836"
FT                   /db_xref="GOA:Q0SW63"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW63"
FT                   /protein_id="ABG86836.1"
FT                   /translation="MRKKYFILTILTMILGLLSRKFMSYVPSLIAPYLGDVLWATMVYF
FT                   GFRFLLPKLNTNTSFLIAILFSFGIEFSQIYQAKWINNIRATTLGGLVLGHGFLWSDLL
FT                   CYTIGILIGSFIDRLAFIKKKL"
FT   gene            368588..369262
FT                   /locus_tag="CPR_0309"
FT   CDS_pept        368588..369262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0309"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06161"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86050"
FT                   /db_xref="GOA:Q0SW62"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW62"
FT                   /protein_id="ABG86050.1"
FT                   /translation="MTDRVECKLKAKELLRGRWENAVGACLLFFVSTFLLSFLLSPIPV
FT                   FGWIIIALISTFLTGSFIKYCIKLNETEGKVKYLECLISFKTTLKILACDILIGLVVGI
FT                   GWIIFTMIFSVAFIASQSIVVIIVVLIILVALGFFIEAILFPVPMILTEDEGVGVMEAI
FT                   EMSFNITKGYRWKYIVMNLSFIGWMILSFLTFGIGMLWLQPYMMLTYYLFYKGIRSANT
FT                   TI"
FT   gene            complement(369455..370078)
FT                   /locus_tag="CPR_0310"
FT   CDS_pept        complement(369455..370078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0310"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86906"
FT                   /db_xref="GOA:Q0SW61"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW61"
FT                   /protein_id="ABG86906.1"
FT                   /translation="MEFLGSLLTFLINIVGSFGYFGILLIVGLEYACFPLPSEVILTFF
FT                   GLSASQGEISLIGVIIFSIIGGLLGSLICYAIGYYGGVPLQEWLGRKFPSSQKSMLALN
FT                   KWFKKYGKPAVLLARIVPLTRTYVSLLAGAEKFSLKYFILYSSLGISIWNIFLVSLGYF
FT                   IGDNLPLINSIMEKYTFVTLAILIIAVIIFIYLKFFKKEKNTSK"
FT   gene            complement(370175..372832)
FT                   /locus_tag="CPR_0311"
FT   CDS_pept        complement(370175..372832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0311"
FT                   /product="cation-transporting ATPase, P-type"
FT                   /EC_number="3.6.3.8"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86899"
FT                   /db_xref="GOA:Q0SW60"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW60"
FT                   /protein_id="ABG86899.1"
FT                   /translation="MKKVYSKSKEELFKELGVNKDGLNDTEVKSMEEKYGKNELVEGKK
FT                   KSTFQVFLDQFKDMLIIILICAAAISMFLGDIESAAVIIFVLIVNATLGTIQHLKAEQS
FT                   LSSLKALSSPSTKVLRNGERIEIDSKDVVVGDIIFLEAGDYVPTDGRIIENYSLQVNES
FT                   SLTGESESIVKMSEIIKGEEIPIGDRKNMVFSGSLVTYGRATILATAVGMDTEIGKIAQ
FT                   LLNDTKEKKTPLQANLDNFGKKLAIGILVICAIVFALSLYRGEAIIDAFMFAVALAVAA
FT                   IPEALSSIVTIVLSLGTQKMAKENAIIRKLQAVEGLGSVSIICSDKTGTLTQNKMTVKK
FT                   IFVDGKVIDSNELNLEKKIDNDLLTMSLLCNDAITDCEKEIGDPTEVALVNLGDLYRVD
FT                   ELVQRDKFKRLGEIPFDSDRKLMSVVYNIHGENIIATKGAVDVLLKRSTKIETSEGVRP
FT                   ITKEDIAKIEKINQEFSKTGLRVLSFAYRNIESRTDIKLDDENDLTFIGLISMMDPPRE
FT                   ESAEAVKACIEAGIKPVMITGDHKITASAIAKQIGILKDESEAIEGSALDKVSDEELKN
FT                   MVEHISVYARVSPEHKIRIVRAWQEKGNVVAMTGDGVNDAPALKQADIGVAMGITGSEV
FT                   AKDAASMVLTDDNFATIVKAIENGRNIYSNIKNAIKFLLSGNTAGILSVLYASILALPV
FT                   PFAAVHLLFINLLTDSLPAIALGLEPHKKEVMKEKPRKANASILTKDFVTDVLFEGVVI
FT                   TIVTMIAFHIGLNQGGPLLASTMAFATLCLSRLVHGFNSKSKKHVVSKELFSNKYLWAA
FT                   FGIGFVLLNIVLLVPAFEGLFQVAPLTLNNLLTIYGLSLCTFIVVQFVKFIREKFTENK
FT                   TNTAKESNKENRAA"
FT   gene            373372..374169
FT                   /locus_tag="CPR_0312"
FT   CDS_pept        373372..374169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0312"
FT                   /product="conserved hypothetical protein TIGR00266"
FT                   /note="identified by similarity to GB:AAP11760.1; match to
FT                   protein family HMM PF01987; match to protein family HMM
FT                   TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87514"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW59"
FT                   /protein_id="ABG87514.1"
FT                   /translation="MNSHEIDFELFGDDMQFVEIELDPRETVVAEAGAMMMMDSSIEME
FT                   TIFGDGSNSSGSGGFFGKLGGAAKRVLTGESLFMTAFTNMGVGREKVAFASPYPGKIIP
FT                   VDLRNYGGKLICQKDAFLCAAKGVSIGIDFRRKLGTGFFGGEGFILQKLEGDGMAFIHA
FT                   GGTIVRKRLLPGQKLKVDTGCLVAMTKDVNYDIEYVKGIKNAVFGGEGIFFASLVGPGE
FT                   VWIQSLPFSRLASKVVSSAPQVPGSRDVGEGSVLGEFGRLFQD"
FT   gene            374725..375297
FT                   /gene="xpt_1"
FT                   /locus_tag="CPR_0313"
FT   CDS_pept        374725..375297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt_1"
FT                   /locus_tag="CPR_0313"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="identified by similarity to SP:P42085; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01744"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85381"
FT                   /db_xref="GOA:Q0SW58"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW58"
FT                   /protein_id="ABG85381.1"
FT                   /translation="MEALKEKILKEGKVREGNILKVDCFLNHQMDIKFLNEVGKEFRKR
FT                   FEGEKVDKILTIEASGIAIAGIASQYFDYVPVVFAKKTESLNLDKDVYESNVHSFTKKK
FT                   DYKVRVGKQFLNKGERVLIIDDFLAQGCATKGMIDLVEQAGAELVGIGIVIEKGFQDGR
FT                   KVLEDLGVRVESLAIIDKLEDNKVYFK"
FT   gene            complement(375355..376407)
FT                   /locus_tag="CPR_0314"
FT   CDS_pept        complement(375355..376407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0314"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85734"
FT                   /db_xref="GOA:Q0SUB7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SUB7"
FT                   /protein_id="ABG85734.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKEFNVYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDNVLLTLVERKTRYAIIS
FT                   EMPSHSAISVTKTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHP
FT                   YSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE
FT                   IHLDEIYSLY"
FT   gene            complement(376507..377469)
FT                   /locus_tag="CPR_0315"
FT   CDS_pept        complement(376507..377469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0315"
FT                   /product="Initiator RepB protein family"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87145"
FT                   /db_xref="GOA:Q0SW56"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW56"
FT                   /protein_id="ABG87145.1"
FT                   /translation="MEKNYLVTKSNYFIMNSSYDLSLEEQKIILTLASMVQPNDEEFKP
FT                   YIFKISDFMELLGVNTKTKYTEIPKITKDLMKKVFEIEEDDVIIQTAWLSSATYKKGSG
FT                   IVELEFSPKLKPYMLKLNSMFTQYKLANILSMKSKYSPRIYEILKCNEFKKQNFVEIKI
FT                   TELRRLLKAENIYPLYSDFKRYIIIRTKKELKKLSDIWFEFEEIKTGRKVTSIRFYIYS
FT                   NNIENGKKVYNFKEEDAITLIDTQDLSEDDKIFELYNLFKEYKIGFESIKNILFNANGD
FT                   IEKVKKVYEYSKTQDINNFVGFMISMVKKDTFITPKAKA"
FT   gene            378173..378439
FT                   /locus_tag="CPR_0316"
FT   CDS_pept        378173..378439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW55"
FT                   /protein_id="ABG87805.1"
FT                   /translation="MLIVELDTVLKERDLIVKKIKQGDITSDKKSGRKESKLDKIINEP
FT                   ESYIKEYLLNRSIKQIDLMKKYNISINILKKYIKLVKGSVNYI"
FT   gene            complement(378759..378950)
FT                   /locus_tag="CPR_0317"
FT   CDS_pept        complement(378759..378950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0317"
FT                   /product="putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW54"
FT                   /protein_id="ABG86523.1"
FT                   /translation="MENLNLNQLENINGGSTLGWATATATQLGLAAAATAEVPPLSAGL
FT                   AAAGAVLAGGVAVYEAWH"
FT   gene            379345..379890
FT                   /locus_tag="CPR_0318"
FT   CDS_pept        379345..379890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0318"
FT                   /product="lactococcin g processing and transport
FT                   atp-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85917"
FT                   /db_xref="GOA:Q0SW53"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW53"
FT                   /protein_id="ABG85917.1"
FT                   /translation="MLHYVVIHKISEKEIVAADPAKGIVKYKPSDFFNIWTGILLIMTP
FT                   TTEFKKGNEVKGVFTRFFDLLKPQKGLLFNIFLASLLITAFGIIGSFYFKFLLDDIVPN
FT                   NLRQSLTVFSIGFIILSVFKVITEAFRTQLLIHLGQRLDIPLMLGYYDHVVNLPMNFFG
FT                   TREVGEIISRFNDASKIR"
FT   gene            379915..381282
FT                   /locus_tag="CPR_0319"
FT   CDS_pept        379915..381282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0319"
FT                   /product="lactococcin g processing and transport
FT                   atp-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87495"
FT                   /db_xref="GOA:Q0SW52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW52"
FT                   /protein_id="ABG87495.1"
FT                   /translation="MMIDVIMVIVGGGILYYQSSLLFRITIVPLILYGIIVFIFKSNIE
FT                   KVNRETMEGNAKLTSYLVESLNGIATIKAFNAEREVNLETEERFIKFLKAIFKNEYINN
FT                   IQVSLKSLVKGVFAIAILWIGTIQVLNGKISFGELLTFNALLSYFLSPVENIINLQPTL
FT                   QTAVVAAERLSEILDLEIEKSEEEYKKINPETLKGKIEFKNVDFRYGTRQLILKNINIT
FT                   IDKGERIALVGESGSGKTTLAKLLLNFYQCENGEIIVNDYNLLDINVETLRDKIAYISQ
FT                   ETFLFNGTIIENLMLGNPYLTYEEIIEACKKAQIHDFINSLPLRYNTLVEENGSNFSGG
FT                   QKQRLSIARAILRNPEILIMDEATSNLDSITEKAIERTIHEFSKGMTTIIIAHRLSTIK
FT                   RCDNIYILEKGEIKEKGNHKELLDKKGRYYELWKEQLPEVDNIEQVQVKEVVEVEV"
FT   gene            381323..382297
FT                   /locus_tag="CPR_0320"
FT   CDS_pept        381323..382297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0320"
FT                   /product="putative bacteriocin ABC exporter accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87136"
FT                   /db_xref="GOA:Q0SW51"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW51"
FT                   /protein_id="ABG87136.1"
FT                   /translation="MESKPNKLMFIFLYIIIALIVTFFIWSWFSEKEIIVKVNGVVRPD
FT                   NEIKAVSNIVQGEVESVKMKNGESVSKGEVLFKIKSTELENKKNQIDEQIEYINTDNEN
FT                   LEKLNKSINDNTNYFENNDKEKEYYYKFQSYEAGNKVSFEEKNNIFSSKDELNNQKVEL
FT                   ETLSKSISENKNLNKEGSTYSDQYESYISSREMIQNKIEQLENNKKALNEKIEENNKEK
FT                   NKLNDENRKTIIDDKDKQINNQISQIDLEIKNNNEQLDKLKSDTLAQIKGSIDKINQNL
FT                   NKLESTLSSLDESANISKDKNKTTFLAQIEEKINILNCNIKLN"
FT   gene            complement(382323..383375)
FT                   /locus_tag="CPR_0321"
FT   CDS_pept        complement(382323..383375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0321"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85762"
FT                   /db_xref="GOA:Q0SW50"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW50"
FT                   /protein_id="ABG85762.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKEFNVYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIIS
FT                   EMPSHSAISVTKTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHP
FT                   YSSFEKGTNERHNGLIRHFIPKGKRISDYSLETISFIENWMNTLPRKLLNYKTPEELFE
FT                   IHLDEIYSLY"
FT   gene            383974..384552
FT                   /pseudo
FT                   /locus_tag="CPR_0322"
FT                   /note="membrane protein; contains frameshift; identified by
FT                   match to protein family HMM PF00892"
FT   gene            complement(385434..386738)
FT                   /locus_tag="CPR_0324"
FT   CDS_pept        complement(385434..386738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0324"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04087"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87797"
FT                   /db_xref="GOA:Q0SW47"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW47"
FT                   /protein_id="ABG87797.1"
FT                   /translation="MSITKERFFNEFKKDQATYDEIHENILDGVNIGGANFIILMCAII
FT                   IASVGLNMNATAVIIGAMLISPLMGPIIAIGYSVGIYNLKLLKKSAIILIIEIFISITT
FT                   ATIYFSLSPISSAGSEILSRTAPNIWDVIIAFTGGIAGIIGITRKKSGNILPGVAIATA
FT                   LMPPLCTSGYGLATKNIHIFLGAGYLFFINSFFIALSNLLVVKFMKIPTRNTLSEVKQK
FT                   KLKKMIIVSTILITIPSLMSAATMVNSFLNSTNLSNFIENEMPSEYILNKEINTKNKTI
FT                   ELVVIGNTIDNSEEEKLQEALKYYNFSGYKLIIQQSTDNFPELKMYLDKIKEQDSGFIG
FT                   DLEINKGKNNSSINNNVTSALNSVTSSLPGKFDDITKVYSGVLDNELPVFIINHSKDYI
FT                   DKDAINAYILSNPELKNAKIYFEKEDSNKENTKPQ"
FT   gene            387010..388395
FT                   /locus_tag="CPR_0325"
FT   CDS_pept        387010..388395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0325"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85978"
FT                   /db_xref="GOA:Q0SW46"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW46"
FT                   /protein_id="ABG85978.1"
FT                   /translation="MLSKDNIKKVLSVALSTGGDFAEVFVEEKLNNNIVLTSGAVKDII
FT                   SGKDYGIGIRIFKGLKCIYAYTNDDSLMSLVNTAKKAALALGDVIDGHTVNLNLVERIN
FT                   TNIHPILYVPSSISSAKKIEKIKEAYKGAKGYSHEISQVTVTMKDEDQRVLIANSEGLF
FT                   TEDRRIRSRIAISSIASNGVDNQAGTRSPGASMGFEFFDTIDLSNLGKEASKSAVTMLH
FT                   ADYCPAGKMTVAIENSFGGVIFHEACGHSLEATAVAKGNSIFCDKLGMQIASKKVTAID
FT                   DGTIANAWGSLNIDDEGEPTRRKVLIENGILKSYMIDKFNGRRMGMPSTGSGRRESYKY
FT                   APTSRMTNTFIANGEDDNEKIIKSIENGLYAKQMGGGSVNPITGDFNFNVLEGYLVKNG
FT                   VIDRAVRGASLIGNGSDILMNIDMVGKNLDHGQGVCGSLSGAVPTNVGQPLLRVKEITV
FT                   GGR"
FT   gene            388411..389760
FT                   /locus_tag="CPR_0326"
FT   CDS_pept        388411..389760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0326"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86334"
FT                   /db_xref="GOA:Q0SW45"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW45"
FT                   /protein_id="ABG86334.1"
FT                   /translation="MEFKDFKERLFNRAKELNFEKYELYYGKSEALNITSSNGEVERYG
FT                   LSTSIGVSFRGIYKGKMGYSYTEKLDDESIEILLLKAIECAELVESEDEEFIFGDKAKY
FT                   VEVNSYDENISKLTPKEQIEKALKLSTEPSKINFEIIKSEYTKFNTTKLERVIVNSEGI
FT                   DLKEEKTIVQASISPIAKDGENMIVDGVSRVSTKLNDVNIDELMKKAINNTLRKKGATS
FT                   IKSGKYKVIIDGEVMASLIRTMEDNFLGHIAQENKTLLKDKIGEKIASNKVTLVDNPFL
FT                   KGGISTCSFDDEGVPTRVKNIIENGVFKGFLHSLKTAKKSKVNPTGNGFKSGFKSTVKA
FT                   SPTNLYIKEGEKSFEELLSYVENGVYIIDLAGLHSGANAVTGDFSLAAEGIKIENGVLK
FT                   GAIKHITIAGNFFDLLNNIEEVGNDLEESGVTSGYGSPSIIIKELSVAGE"
FT   gene            390069..391655
FT                   /locus_tag="CPR_0327"
FT   CDS_pept        390069..391655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0327"
FT                   /product="L-aspartate beta-decarboxylase"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87243"
FT                   /db_xref="GOA:Q0SW44"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022518"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW44"
FT                   /protein_id="ABG87243.1"
FT                   /translation="MITKDLEKKLEGLGAFEISSKMLKLAKNNEKHNKFLNAGRGNPNW
FT                   INTEGRLALGRIVEFGVFESRRTIHEGNLAGYTNLDGIYERLMDFLNGGHEVDKFLRDA
FT                   IDYSIKTLSVNKDELVKEFVDGAIGNDYPVPNRCLVNTEKILKLYLEKELFGGVKLANE
FT                   TNVFPTEGGTAAICYIFNSLKENGLIKAGDKIAINTPIFTPYLQIPELKDYEMVEVDLI
FT                   SKEENNWVIEDSELDKLRNKEIKALFFVNPSNPASKALSEEALNHIADIVKERKDLMII
FT                   TDDVYGTFVENFKTIYSVAPHNTLLVYSFSKLYGVTGWRLGLIAANENNVFDELISKLT
FT                   EEKLQDLDKRYGLVTFEPRKFKFIERIVADSRSVGLYHTSGLSTPQQIQMALFALTSLI
FT                   TKGRDPYIESSKKLVRDRYHDLCNTLGIKEDDSRENAKYYSLINIYDLARDLYDVNFKE
FT                   YLKNNFKPIDFLLRLAEINGVVLMEGVGFGADPGILRVSEANLPDEAYKKIAKQILEML
FT                   SEYYNQYKLEK"
FT   gene            391776..393941
FT                   /gene="recQ_1"
FT                   /locus_tag="CPR_0328"
FT   CDS_pept        391776..393941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ_1"
FT                   /locus_tag="CPR_0328"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM PF09382;
FT                   match to protein family HMM TIGR00614; match to protein
FT                   family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87392"
FT                   /db_xref="GOA:Q0SW43"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029491"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW43"
FT                   /protein_id="ABG87392.1"
FT                   /translation="MNRAKEILKSFYGYSEFRKGQEEIINEIISGNDVVAIMPTGGGKS
FT                   ICYQIPALILEGVTVVISPLISLMKDQVDAINSMGIESAYINSTLSNEEINNIFQSVKD
FT                   GHIKILYVAPERLESMEFLNLVSNIDISQVAVDEAHCVSQWGHDFRSSYKFIGRFINIL
FT                   RKRPVVSAFTATATEEVRKDIVKLLELNNPKVFVSGFDRDNLKIIIEKGVNKAHYILDY
FT                   LKENKDVSGIIYCSTRREVDSLCELINSRGIGCTKYHAGLSDEERKKNQEDFVFDKVSV
FT                   MVATNAFGMGIDKPNIRYVIHNNMPKNIEGYYQEIGRAGRDGEKSECILIFSPGDVQTQ
FT                   KYIIETGTLNPERKINELSKLQTMMDLVYCNGCYRRFILNYFGEDLEEDCHNCSNCEME
FT                   GELVDKTIDAQKVISCVYRMKRPFGIGVIIDVLRASKNKKIIELGLDQLSTYGIMKDYS
FT                   KEGLKDFINTLISHRYIDYIGEYPVVRLNQSSIDILKGNEKVMFKEKIKAKRVSKNNEL
FT                   FDLLRSLRREIASEEGVPPYIVFGDNTLKEMSVRMPVNESQLSEISGVGEKKILKYGEM
FT                   FLNVINEYVKVNNIEIKWESGLKINKDELEKKFKKGNGKDGKKKSFEITIDMLREGKKF
FT                   HTIVKERELSITTLLSHIQQYLEEGNKIDFEIDFDSLFSKREEKLILDAIDKVGYSKLK
FT                   PIKENLEEDVSYEKIRFIVTKFIINMI"
FT   gene            394570..397389
FT                   /gene="uvrA"
FT                   /locus_tag="CPR_0329"
FT   CDS_pept        394570..397389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="CPR_0329"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by similarity to SP:O34863; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86546"
FT                   /db_xref="GOA:Q0SW42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW42"
FT                   /protein_id="ABG86546.1"
FT                   /translation="MKDKIIVKGAKVHNLKNVSLEIPRDKLIVFTGLSGSGKSSLAFDT
FT                   IYAEGQRRYVESLSSYARQFLGQMDKPDVESIEGLSPAISIDQKTTSRNPRSTVGTVTE
FT                   IYDYLRLLYARVGVPHCPKCGKEITQQSVDQIVDQIMELKERSKIMILAPIIRGRKGTH
FT                   EKVLENIKKQGFVRARIDGEIYDLTEDQIKLEKNIKHNIEAVVDRIIVKDGIEGRLTDS
FT                   IETSLKMAEGLVLVNIIGEEDRLYSEHFACADCGISIDELAPRMFSFNSPFGKCERCDG
FT                   LGTLMEIDEDLVVPNKDLSIRGGAISTWGDSRMKEESWTYCVLKALMEKYNFDLDTPYK
FT                   DLPKKVQEVLMYGEPEKLKVTYTKENVTAVYNHSFEGEINNLRRRYMETNSDTMKAEIE
FT                   KYMSDNPCPKCKGARLKPEALAVTVGGKNIFEFTSMAIREELDFINSIDFSEKDKIISS
FT                   QIIKEIQSRLSFLINVGLDYLDLARKAGTLSGGEAQRIRLATQIGSQLMGVLYILDEPS
FT                   IGLHQRDNDRLISTLKQLRDVGNTLIVVEHDEDTMREADYIVDIGPGAGEHGGEIVAKG
FT                   TLDEIMRNENSLTGKYLTGAKKVKLPEKRRKGNGNFITVKGAKENNLKNVTTKFPLGTL
FT                   TMVTGVSGSGKSTLVNEILYKGLNKIVNKAKDLPGKFKEITGYENIDKIIDIDQSPIGR
FT                   TPRSNPATYTGTFDIIRELFSQTQEAKMRGYKPGRFSFNVKGGRCEACSGDGIIKIEMQ
FT                   FLSDVYVPCEVCKGKRYNRETLEVKYKGKNIADVLNMTVEEALEFFENIPRIKNKLQTL
FT                   MDVGLGYIRLGQPSTQLSGGEAQRIKLAYELSKRSTGKTLYILDEPTTGLHIHDVNRLV
FT                   KILQRLVDGGNTVIVIEHNLDMIKCADYIVDLGPEGGDKGGTIIATGTPEKIAETKESY
FT                   TGKYLKKYL"
FT   gene            397724..398158
FT                   /locus_tag="CPR_0330"
FT   CDS_pept        397724..398158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0330"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86273"
FT                   /db_xref="GOA:Q0SW41"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW41"
FT                   /protein_id="ABG86273.1"
FT                   /translation="MFSKLMTWVFGIIFIIILYSIIYYALKIMYKDVKGGKKKKAPGKK
FT                   AHGLEVLKTISDGTLGIGSVIPVTSTISIGRREDNSIVLNDQFVSSYHAKIYVKNNDFY
FT                   LEDLASTNGTFINDSKVEGRVRLKVNDQVRMGSTVFKVIG"
FT   gene            398172..399401
FT                   /locus_tag="CPR_0331"
FT   CDS_pept        398172..399401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0331"
FT                   /product="cell cycle protein, FtsW/RodA/SpoVE family"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85489"
FT                   /db_xref="GOA:Q0SW40"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW40"
FT                   /protein_id="ABG85489.1"
FT                   /translation="MNTTLKYEKRMLLLVYLLCLALFTNIAIKQTPIDKMAFIIAGILI
FT                   LIIGFSHFIIRKFYPDGDKYMLIFAAVLAVVGIAVLYRLDPKLAIKQLIWFSLGIALYM
FT                   GIVIVMPDLKSFAKYKYIYMGGTLIFMAMAMIIGRTVNGSKNWVYIGSFGFQPSEIGKI
FT                   FFILYLASALMKYEKKDNIKYEFKQLLEPALIVMYSLGFMVLQKDLGSALMFFFVSITM
FT                   LYIATCNWKYVGTGLVLFSLGGTASYFLFNHVKKRVMIWKDVWKYANNESYQIVQGFYA
FT                   MSLGGMFGTGLYNGYPKLVPFASTDFIFTLIAQELGLVFGIGLLLLYFLLFYRGIRAAL
FT                   NTDDPFSQLNAVGFSTLIVAQVLVIIGGVFSVIPLTGITLPLVSYGGTSMLTVFIALGI
FT                   LQKISEEGLR"
FT   gene            399402..400865
FT                   /locus_tag="CPR_0332"
FT   CDS_pept        399402..400865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0332"
FT                   /product="putative penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85890"
FT                   /db_xref="GOA:Q0SW39"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW39"
FT                   /protein_id="ABG85890.1"
FT                   /translation="MAKKKDLSGSIKKVMFVYLVLLVGLISYIAYFQLIQVPKIAEMDS
FT                   NSAVMAAQNEVIRGEIKDRDGNVLAKSTKSGDLTQKREYPYGEIYSHPIGYASGIYGNA
FT                   GLEGAYSKELTTYENVSLKAFLKSFNLKKDFKERNESDKKVGNSIVTTLDTDLQKAAYA
FT                   ALGANRGAVVALDPKTGAVLASVSKPGFNPNNMKETYEIANNPNGNPKDAILVDRALNG
FT                   QYPPGSTFKVVTLTSALENLPGVIERTFNDTGSINVGTKDLPNENGNAYGNISLRKALS
FT                   VSSNVIFGGILGEELGNKKLRETAEKYGFNKDLYLGNLKAYSGNFPDRKTIDKGLIAYD
FT                   AIGQGEVLASPIEMAMVAATVANNGVRMEPYIVSKVLDKDGDTVKEFSSTKKDTVMSKE
FT                   QAQIINEYMQGVAKDRINDNWGYFKGMNVAAKTGTAQVPDGNSHAWLIAFAPADDPKIA
FT                   VATIVENGGSGSKVAAPVTARVMQAYFNK"
FT   gene            400975..402837
FT                   /gene="uvrC"
FT                   /locus_tag="CPR_0333"
FT   CDS_pept        400975..402837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="CPR_0333"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF08459; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86302"
FT                   /db_xref="GOA:Q0SW38"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW38"
FT                   /protein_id="ABG86302.1"
FT                   /translation="MFDFQHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYFQ
FT                   NSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPFIK
FT                   ITTNEDFPRVYVTRNFAKDGNRYFGPYTNGTAVYEVMGLIKKLFPLRTCKKAIVEGGEP
FT                   TRACLNYHINLCKAPCAGYISKAEYWKMIDEIINILNGTDTSIIKNLKLEMEKAAEELE
FT                   FEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGKVTGRE
FT                   HFMIENISDDPVKEVISSFIASFYGGTAQIPKTIYVPEEIEDQELIEKFLTEKRGSKVW
FT                   IKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALIELADVLGLDSLPTRIE
FT                   AYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILSRRFSHGLE
FT                   EVNKIKERNLEYSKGKFCIFPDLIMMDGGKGQVNIALEVLKDFGIEIPVCGLVKDDKHR
FT                   TRGIIFNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHSILEDIPRIGE
FT                   KRRRNLLMKFGSIDNIKKASMEELLDTPGIDKRAAESIKQYFSS"
FT   gene            402987..403901
FT                   /gene="murB"
FT                   /locus_tag="CPR_0334"
FT   CDS_pept        402987..403901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="CPR_0334"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by similarity to SP:P18579; match to
FT                   protein family HMM PF01565; match to protein family HMM
FT                   PF02873; match to protein family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86626"
FT                   /db_xref="GOA:Q0SW37"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW37"
FT                   /protein_id="ABG86626.1"
FT                   /translation="MNQYMEFYKLLGEFYNEEDITVDSPMSEHIYFRVGGPADILVTPV
FT                   NEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVVIKFNKLNKITTEGNCVTAQS
FT                   GALLKDVSKAALENNLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDENCN
FT                   IKNLTKEELELGYRSSIVMKKGYVVIEATIELESGEYASIKDKIDDLTNRRESKQPLEY
FT                   PSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVLDVIAH
FT                   VQKTVKENFDVELHTEVRIIGRD"
FT   gene            404139..405023
FT                   /locus_tag="CPR_0335"
FT   CDS_pept        404139..405023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03668"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87779"
FT                   /db_xref="GOA:Q0SW36"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW36"
FT                   /protein_id="ABG87779.1"
FT                   /translation="MRFVIVTGLSGAGKTEATRSLEDLGYFCVDNLPPKLIPKFAEACV
FT                   QSEGKIDKIALVIDIRGGIFFDDLFESIEYLKANDFNYEILFLEASDEVLVKRFKETRR
FT                   SHPLSPDGRIITGISEERMRLRELKDRADNIIDTSNYPIRNLREKINLLYGDGKPVEQN
FT                   LSITVLSFGFKYGIPSDSDLVFDVRFIPNPFYIPELKPFSGEDEPVKNYVLAQEETKGF
FT                   LSRLSDMAEFLIPNYIKEGKRQLIISIGCTGGRHRSVAIANALYKDLLCKNFHVTLEHR
FT                   DINEDINRGDRKL"
FT   gene            405020..406366
FT                   /locus_tag="CPR_0336"
FT   CDS_pept        405020..406366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q97LP2; match to
FT                   protein family HMM PF01933; match to protein family HMM
FT                   TIGR01826"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85503"
FT                   /db_xref="GOA:Q0SW35"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW35"
FT                   /protein_id="ABG85503.1"
FT                   /translation="MMMKKMLKPGIKVKRYIFLALASIITMAVAIAKLIDERHVTTIHD
FT                   KAVFIILIIFSGLVGYKSIVWCVKSVVSLVNKGYINLSIEEDDLEDLIEDDRLLIKGPK
FT                   IVVIGGGTGLSTMLRGLKHYTSNVTAIVTVGDDGGGSGILREDLGILPPGDIRNCILAL
FT                   ANTEPLMNELLQYRFNDGRLKGQSFGNLFLAAMDGISENFEDAVQKMSSVLAVKGEVLP
FT                   VTLENMVLEAELMNGHRVRGESLIGEEVIDQSSPIKKLKIIPEDAKALDRALEAIEDAD
FT                   AIVLGPGSLYTSVLPNLLVKDISKAIKKSKAFKIYNCNIMTQPGETDGFKVSDHVQVIL
FT                   DHCGKDMVDCIIANSKDISEELKEKYLDKNSELVELDINKLKKMGLCVVDGDLTKVKGD
FT                   YIRHNSDYLAQLLIETVMEKHLLYDRKKILEYIYLSQRIKKREGSNRKE"
FT   gene            406369..407319
FT                   /locus_tag="CPR_0337"
FT   CDS_pept        406369..407319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:B96963; match to
FT                   protein family HMM PF02650; match to protein family HMM
FT                   TIGR00647"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85998"
FT                   /db_xref="GOA:Q0SW34"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW34"
FT                   /protein_id="ABG85998.1"
FT                   /translation="MSFSAKVKGEICRYIDISKEEALAQISAIMKVCGTLAFSGRQISF
FT                   KMTTENPASARLMFTILKDYFDIHAKLMVKKSNSLKKNNIYMVVVTEEMGVKKLLEITG
FT                   ILREIDGIMSLDYHIDENLVDTEEKKKAYIRGAFIGGGSISNPEKTYHLEFVTHSQEYA
FT                   EDLGKLINTFGLKAKVIQRKNSYIVYIKEGEQIVDLLNIIGAHTALLELENIRIMKEMR
FT                   NNVNRLVNCETANLSKTVNAAVRQVESIKLIEREIGLARLPKNLREVAELRLTYPEESL
FT                   KELGEMLEPPVGKSGVNHRLRKIEKIAEELRTGNF"
FT   gene            407492..408046
FT                   /locus_tag="CPR_0338"
FT   CDS_pept        407492..408046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0338"
FT                   /product="putative lioprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86646"
FT                   /db_xref="GOA:Q0SW33"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW33"
FT                   /protein_id="ABG86646.1"
FT                   /translation="MTRNFKKTIWLLVGVMIFGIIGMVGCTKKTNEMTENSGLSATTPA
FT                   EYKTMLEEKIKTYIGDANLGTEYDFSKVTEDTKQATYEEYEKYYKNLDTELTNLKNELN
FT                   SKVSPSDGKVNDANRKIVESIDNLKMSISTVKSDLDANRNKILAMPKDEFISAMKDIEK
FT                   SAYDARVKVQESIDAVKNSFK"
FT   gene            408436..409686
FT                   /locus_tag="CPR_0339"
FT   CDS_pept        408436..409686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0339"
FT                   /product="DNA polymerase III, subunit alpha (dnaE)-like
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02811;
FT                   match to protein family HMM PF07733"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87545"
FT                   /db_xref="GOA:Q0SW32"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW32"
FT                   /protein_id="ABG87545.1"
FT                   /translation="MGDKKFCHLHLHSGYSLLDGSGKIKPLIKRAKELGMESIALTDHG
FT                   VMYGCVDLYKEAKAEGIKPILGCEVYVVPKSRKIKSNDEDNKTYHLVLLVKNEKGYENL
FT                   MKIVSVASIEGFYYKPRIDREYLKEHSEGIIALSACLGGEVQKAILNGNIDKAREAATF
FT                   YRDTFKDGFYLELQNHGIEEQKKVNEVNIQLAKELNIPLVATNDVHYINQEDSKAHDIL
FT                   MCIQTGKTVDDPNRRRYPSDQFYLKSPEEMWDMFDYIPEALENTLKIAEECNFDYEFHV
FT                   SKLPKFPLPEGVEPFEYLRKTCFDGLIDRLEELKPLKEKEIYDIDKVYEIGENNEKVKE
FT                   DIERLEYELGVIKQMGYVDYFLIVWDFIKYANDNGIPTGPGRGSAAGALVAYTLGITKI
FT                   DPMKYSLLFERKLRCAV"
FT   gene            409999..412350
FT                   /locus_tag="CPR_0340"
FT   CDS_pept        409999..412350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0340"
FT                   /product="DNA polymerase III, alpha subunit,
FT                   interruption-C"
FT                   /note="identified by similarity to SP:O34623; match to
FT                   protein family HMM PF01336; match to protein family HMM
FT                   PF07733; match to protein family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85546"
FT                   /db_xref="GOA:Q0SW31"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW31"
FT                   /protein_id="ABG85546.1"
FT                   /translation="MFLNPERVSMPDIDSDFCYEGRQRVIDYVVEKYGHDNVSQIITFG
FT                   TMAARACIRDVGRAMNYTYAEVDRIAKQIPTVLGVTIDKALDLNPELKTIYDTEERVKE
FT                   LIDVSRRLEGLPRHSSTHAAGVVIASQPLVEYVPLQKNDESIVTQFDMTTLEELGLLKM
FT                   DFLGLRTLTVMRDAVDMIKYNRGVDIDLDNLDFDDKEVYKMIGEGNTVGVFQLESAGMT
FT                   SFMKELKPDCLEDIIAGISLYRPGPMAEIPRYISGKRDPKSVEYIVPELENILNVTYGV
FT                   MVYQEQVMEIVRKLAGYSMGRSDLVRRAMSKKKHKVMEEERKNFIYGIEDENGNIEVPG
FT                   CLRNGISAEAANKIFDSMMDFASYAFNKSHAAAYAVIGFQTAYLMRYYPVEFLAAMLNS
FT                   VMGNSDKVSEYIRSAEKLGIQVLPPDINESYTKFTVKGDTIRFGMGAIKNVGVNVVENI
FT                   AKSRDEKGKFTSLMDFCNKIDLSIVNKRSVESLIKAGTFDSLNVYRSQLLSVFEKIMDG
FT                   VYSQRKKNIDGQMSLFGALQEESESNLEIRYPNIKEFNKKYMLAMEKEMTGLYMSGHPL
FT                   DDYEKPLKEQTSITIEKIIEAQKNLNEQKNVELEDLVLDSSLTDGTRVIIGGILTNVSR
FT                   KVTRNNTLMAFAKVEDLTGYLECVIFPKTLEKCNALVNEDSFVLIRGRVSLKEDEEPKI
FT                   LCEDIQPLELINSSKVYIKVEDREKANMIVKPLRVLLSQYKGDSPVYIFAAKEKASFRL
FT                   NRDMWVDLDTDVIDFLISKFGEGNVKVVEG"
FT   gene            413062..414021
FT                   /gene="pfkA"
FT                   /locus_tag="CPR_0341"
FT   CDS_pept        413062..414021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="CPR_0341"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365;
FT                   match to protein family HMM TIGR02482"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86409"
FT                   /db_xref="GOA:Q0SW30"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW30"
FT                   /protein_id="ABG86409.1"
FT                   /translation="MKKIAVLTSGGDAPGMNAALRAVTRMALHHGLEVMGVQRGYAGLI
FT                   NGELFKMDRKSVSEIINRGGTILRTARCLEFKQEEVREKAAQILKAYGVEALVVIGGDG
FT                   SFMGAKLLSKLGVKTVGLPGTIDNDLSYTDYTIGFDTALNTVVDAINKLRDTSTSHERV
FT                   SIVEVMGRNCGDLALYAGIAGGAEAIIVPEMPFDKDELIKTILEGRTNGKTHSIIVVAE
FT                   GVGGSAELAKEIESVTGIETRATILGHIQRGGSPTADDIVLASRMGAKAVEVLLEGKTS
FT                   KVIGIKENRIFDMDIDEALDIERSFDESLYEMASAINK"
FT   gene            414114..415517
FT                   /gene="pyk_1"
FT                   /locus_tag="CPR_0342"
FT   CDS_pept        414114..415517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk_1"
FT                   /locus_tag="CPR_0342"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86807"
FT                   /db_xref="GOA:Q0SW29"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW29"
FT                   /protein_id="ABG86807.1"
FT                   /translation="MRRTKLVCTIGPASENEEILTKIIEAGMNASRHNFSHGDHEEHKG
FT                   RMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDIIGDTT
FT                   KCSVTYAGLAKDVKAGDTILIDDGLVGLEVVSVEGNAVKCVVRNTGLVGTHKGVNVPGV
FT                   SIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLVANGGADIQIFSKIE
FT                   NQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVITATQML
FT                   DSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATKSEEMLS
FT                   YELASSKAKKHIPAVPGVISRAACNAAHELKSAAIVSLTQSGATAKRISQCRPDAPIVT
FT                   VTPNERVAKKVALCFGVYPVVAENATMENAVEIAKNAGFVKANDTAVVVAGVPANEGNT
FT                   NIVKVEVVK"
FT   gene            416096..416452
FT                   /locus_tag="CPR_0343"
FT   CDS_pept        416096..416452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:A96964; match to
FT                   protein family HMM PF07561"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87506"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW28"
FT                   /protein_id="ABG87506.1"
FT                   /translation="MTRLACSAHNCVNYVNGMCSALTIEVDGESAENKQETCCNTFAPR
FT                   TFVNAIKSAFNTNYVGTIMQALDSQEDVDHKIKCYAMNCTYNVGMTCTSTDIQVFGPEA
FT                   TTSTSTECETFYKK"
FT   gene            416580..417377
FT                   /locus_tag="CPR_0344"
FT   CDS_pept        416580..417377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0344"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85461"
FT                   /db_xref="GOA:Q0SW27"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW27"
FT                   /protein_id="ABG85461.1"
FT                   /translation="MNELGKIAVITGATSGIGKEYAFQLAKKGYDLILVGRRVEKIKAV
FT                   AEEIENNFKVKTHVEILDLTDDNKLDDFIKRLEKKDNIEFLVNNAGYGADDSFTRNEYS
FT                   KQYDMAKVHMLVTMKLCHSLSKKMKENNKGYIINVSSMAGFNVFPSSAMYCSTKAFLIS
FT                   FTQCLAMELLENNIKVQCLCPGFTRTDFHSKLNMEESKLQNKGFVRWMSTREVVEISLK
FT                   NINKKLNVIVIPGFCNKFLYFVSKFTPRWLYYKVAIKGWELMD"
FT   gene            417548..419083
FT                   /gene="cls"
FT                   /locus_tag="CPR_0345"
FT   CDS_pept        417548..419083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="CPR_0345"
FT                   /product="cardiolipin synthetase family protein"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:O66043; match to
FT                   protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85871"
FT                   /db_xref="GOA:Q0SW26"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW26"
FT                   /protein_id="ABG85871.1"
FT                   /translation="MEKFLKKLLSRAFIVGFLIFIQFVILMGAIWKVSEDFIYVYFLFI
FT                   FISIVVFIYIVSRKDNPSYKLAWAVPVLLVPVFGGLFYLIFGGNKTSKKFRKQIKASYD
FT                   ETAHLLYDDRTVLEELENLDKSIANQSRYIADYSQFPVYKNTTTEYLSPGEVFFERLKE
FT                   ELKKAKHYIFMEYFIVHEGVMWNSILEILEEKVKEGVEVRFVYDDMGCLGTLPYKYNEV
FT                   LESKGIKCMVFNPFVPLLSLRMNNRDHRKITVIDGHTGFTGGINLADEYINEIVRFGHW
FT                   KDASIMLKGDAVWNLTVMFLQIWNFYSERKEQYEKYYPYFHHEDEFESDGYVQPYGDSP
FT                   LDDEIVGENVYLNIINKAKDYVYINTPYLIIDNELVTALTLAAKSGIDVRIVTPHIEDK
FT                   WYAHIVTRAYYPQLIESGVKIYEYTPGFIHSKTFVSDDEIGIVGTINMDYRSLYLHFEC
FT                   GVWLYKTKSVEQIKDDFLKTLEKCQRITLEDCAKVKVPTRILRSIIRVFAPLM"
FT   gene            complement(419301..419459)
FT                   /locus_tag="CPR_0346"
FT   CDS_pept        complement(419301..419459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F97334; match to
FT                   protein family HMM PF07561"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87553"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW25"
FT                   /protein_id="ABG87553.1"
FT                   /translation="MKHNSSIGCTVNECKYHCNEDNYCTLNKIEVVKNTAEACSTECTD
FT                   CGSFERK"
FT   gene            419726..421285
FT                   /locus_tag="CPR_0347"
FT   CDS_pept        419726..421285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0347"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86128"
FT                   /db_xref="GOA:Q0SW24"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW24"
FT                   /protein_id="ABG86128.1"
FT                   /translation="MFKNLTFNENEKKYIQIARYIRELINRGVLIEGSKLPSSREISSI
FT                   LSIGRNTVMSAYEILESEGFVETIKGKGTFVKKEFSNEKSTKVSSIKKENSEIREDKWN
FT                   IDWKYKTNEYGVLAESLDIIKSEEKWEKGMISFKSIAPPGNLFNIEELKRSFSNRIALE
FT                   KHKIVNYGYAVGYKPFIDYLKDYMKEKGAYSEEKEIIVTNGFTEGLDMMLSAFTKDGNY
FT                   ILCENPTHNTALKIMKTHKLNIIGVKMTKDGMDIEDLNKKIEKLGEKIKFAYLIPSYHN
FT                   PTGVVASIKKREEVYNILKDAGIPIIEDGFNEELLYESSPTIPLASLDRESNGVIYIGS
FT                   FSKILFPGLRIGWVYGDKKIIGILESVKRCRNIHTSFLDQGILYDFMISGAFEKYIKKV
FT                   RKVYKEKYKFTKRVIEKYIKDAEIWGEGGLYMFLKIKGVDTRELLKRCYDRGVLFMPGD
FT                   LFYIDNDLYLEKENRVFSLEEHNIKGREKRDTLRIGFTRLSEEEIEKGIKIIGEEVKST
FT                   LT"
FT   gene            421587..422954
FT                   /gene="rumA_1"
FT                   /locus_tag="CPR_0348"
FT   CDS_pept        421587..422954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA_1"
FT                   /locus_tag="CPR_0348"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87034"
FT                   /db_xref="GOA:Q0SW23"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW23"
FT                   /protein_id="ABG87034.1"
FT                   /translation="MVEKNKEYIFDIISQGYEGEGIAKIDNKYPIFIEGALKGEKVKVR
FT                   IVKVNKNFAYGKLMEVLEASEERVNPPCAIYKRCGGCKLQHASYKAQLDFKWDRVKDCV
FT                   SKIGKLDPSIVKYPLGMEEPWRYRNKVQLPIGLINGEVKIGFFAPRSHDIIDMESCLIQ
FT                   DEIGDKVVKLTREWIEKFNIRPYNVDGEYDEKGIVRHIMIRRGFTTNEVMVVLVTNGEN
FT                   LPHKEEFVDLMVKNIPGIKSVIQNINSKKTNVILGLESKTLWGEDTISDYIGDFRFNIS
FT                   PLSFFQVNPTQTEVLYGKALEYANLTGNEEVFDAYCGTGTITLFLSQKAKKVYGVEIIP
FT                   QAIDNAWINAKENKVENVEFFVGESEVVIPDLINKGVKADVVVVDPPRKGCDKKLLDAI
FT                   TNIDAKKIVYVSCDPSTLGRDLKVLEENGYKTLEVQPVDMFPNTAHIENVALLIKK"
FT   gene            423429..424142
FT                   /locus_tag="CPR_0349"
FT   CDS_pept        423429..424142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0349"
FT                   /product="DNA helicase II related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86457"
FT                   /db_xref="GOA:Q0SW22"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW22"
FT                   /protein_id="ABG86457.1"
FT                   /translation="MDKFTLEETRYNTDVNIVNKLKEDLDNSYEIYYKPNLNGDRPHIL
FT                   IMKKRIGIYIIKISDWDLRKYSYEKKENDTKKYFYEKNTHKRFRSPFDQVNSCKNNLFE
FT                   FYSKKLMERKIFNKKYYGVVSCGVYFQHFKESEFKHHIPLSKFMKFNKYINVWGYDSNI
FT                   VKDIKRWGEDKKYNLFDTEIYDEIFNFINPAIHLEGDGACISFDKKQKSLIESLENKKV
FT                   KIKGVAGSGKSLVLA"
FT   gene            424236..425420
FT                   /locus_tag="CPR_0350"
FT   CDS_pept        424236..425420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0350"
FT                   /product="DNA helicase II related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86690"
FT                   /db_xref="GOA:Q0SW21"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW21"
FT                   /protein_id="ABG86690.1"
FT                   /translation="MVRKKFDWSKFEINHFHFFINQKINQYGGTIAHVDYGEDNYYEED
FT                   KYYETIIEQLEVIKEKIKKYNAIFIDEGQDYDKRWFDIIEKYFLANNGEFVIFADEKQN
FT                   IYNRVELDEDKRIKTNIRGRWNELNKTFRIGIEFSRLAGEFQKEFLKDRYNLDDIKVPD
FT                   EEEINMFDQIDKNLSDNLNQDSIFNYLNIIDYKDIFKDIEEYVRKKNIEYGEICILGEN
FT                   IDNLRALEKEVRDSYNIESEITFETEEEYKSIKCSVDEIIQYDTLNCVFKNNNYYSKLL
FT                   KSRLDEVRRNKKYSFKVVSENLKISTIHSFKGWEIDTLVLILDENTDENVNEELIYTAI
FT                   TRCKKNLIIYGLRNSKYYKFFSENFKQVNDLQFSMYPVLPEFEFSMSKNNELIW"
FT   gene            425575..425802
FT                   /locus_tag="CPR_0351"
FT   CDS_pept        425575..425802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW20"
FT                   /protein_id="ABG87338.1"
FT                   /translation="MNLNDIEVKIKNLIDNKTYKNSEFIYEFLLCFDLPKASITRLKKG
FT                   DYNIAKDKTDILWKKKIFFKECSNNIYEEY"
FT   gene            426313..426726
FT                   /locus_tag="CPR_0352"
FT   CDS_pept        426313..426726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW19"
FT                   /protein_id="ABG87430.1"
FT                   /translation="MSEHYNQNYTREEVEVILNKIKGCIKDNQYIISQNQNRLENIQFI
FT                   NEYRLDEKKRKDILLSIEINDFCHSLNNTNQGYEHEVLYVFCPQRYLFDAFDEEEFVDI
FT                   YIKFNIIEYRNSKKRVVTISFHKRNKPIEYLFR"
FT   gene            426758..427765
FT                   /locus_tag="CPR_0353"
FT   CDS_pept        426758..427765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0353"
FT                   /product="putative prophage ps3 protein 01"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85715"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW18"
FT                   /protein_id="ABG85715.1"
FT                   /translation="MSEKITFCEYCRDDVSYIEKEEYMISKLKGETYKYYGKKAICKEC
FT                   NNEVFVSEINDYNLNQLYNEFRKQNNIISLEHILEIPNKYKIGKRPLSLLLGWGEQTFS
FT                   RYCDGDMPTKQYSAILEKIYKEPSYYLELLEENKDRLKPIAYDKSKEATEILISEQQNL
FT                   ENSKIESVVNYLLCECEDITPLALQKILYYIQGFYYAFLKKFMFEENCEAWVHGPVFRN
FT                   IYYKYKEYRFDPIKEESINKQFDLSISEKVIIDSVIKNLGCYSGKVLEAFTHAEMPWIE
FT                   TRGDLSASIGTDRIIDKRLIADYFNSVKEKNNMINPSDIGDYSKKMFEQILDNN"
FT   gene            428005..429006
FT                   /locus_tag="CPR_0354"
FT   CDS_pept        428005..429006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0354"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86588"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW17"
FT                   /protein_id="ABG86588.1"
FT                   /translation="MSLSSFKRKRIELDELEKLFKIDTYCDLYVKVNELISENKIKPII
FT                   SSGQNGKSPTLYKRYTIIDIKEDNKELIDEIEYKLISKFNIEYYRNHLEKYIDHRKYIL
FT                   QLNDFFINKSEFLNYPVSMNERAFQIWGREKFLQKEEGKSILKNLGIDLGMLNYYDTSE
FT                   PLAYYSRSKNTPQNVLIIENKDTYYTLRNYLISNNKILGKEITTIIYGAGKNVWKAFKD
FT                   FRVSVENHVSNKNNKFFYFGDLDYEGILIYEKFYHMFSEEYNIRPFIKGYEKMVEKSEM
FT                   MEINLPKTKAGQNRNIENVFLQEFSEKLDGKILKILENNLYIPQEIINLTDL"
FT   gene            429015..430664
FT                   /locus_tag="CPR_0355"
FT   CDS_pept        429015..430664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW16"
FT                   /protein_id="ABG87165.1"
FT                   /translation="MDFDFLDVQHIRMKRIGAYALLFRNSIAKGTWKKYGFSEGYEQDN
FT                   LIFAVLLYIMEEALKDDMCTIDNIGYFIDEINSIHFKKELSYEECKELAEFIVNTILCD
FT                   EGKAMYFKAYNFKKVQYEDINISFIKNSMKYIDDVRRVVYSLTDDGYSFILSTLEVEEN
FT                   LKITIHEILLKMHLEKASYDKAVDDIKNIFNQYRIRVKSIEDAIRKIKENPLSYTTEDY
FT                   EKMMSGNLNLLNEIKKQLIIHRGMVELRINEFLERDIHIRKLNKKEEENLNNLKIIQNY
FT                   LGRTIDEDQKLLKKHFDLKDVYGMELETISKMALIERFNFRNEVYDKILDNPNKLEDID
FT                   IFLRPLLKRELPKKYNINKSLEYQKNINKNYSEEDEELSFEESDFIDEINKKKIEKLKK
FT                   YNNVIKLILELSMKQGGISLREIQGLIKESNELMKKLIPTVEIFREVIIEMLKHRNINI
FT                   NEIREERKNAIENGEIEFQLNKSILEVLDNNSELDSIKEINIKKLIDKDDIKLEGVKTE
FT                   DGEFKNFICSDILFEAIKEDKNGLFYGRNKNK"
FT   gene            430630..431337
FT                   /locus_tag="CPR_0356"
FT   CDS_pept        430630..431337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86738"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW15"
FT                   /protein_id="ABG86738.1"
FT                   /translation="MAYSMEEIKISNKIFYYLLKHGELKEEENDLYKSYSENNNVTELV
FT                   KELGESSECYIKKYGGVVYLIPREENDFLGYSKGELKKILCRSNANDKDYYLSQFVILT
FT                   LLVTFYNSKGVSSKGRDYMKIGEFLNIITDRLNEGAERTKEEDSSGIAFSNILERFEAL
FT                   KSSDKRSTSKTTKEGFINNILDFLEKQGLIDYIKNDDMIKTTKKLDNFMDWNILNKNNY
FT                   NRVLKALGESVDE"
FT   gene            431330..435721
FT                   /locus_tag="CPR_0357"
FT   CDS_pept        431330..435721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0357"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87324"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW14"
FT                   /protein_id="ABG87324.1"
FT                   /translation="MSKINKLRFVNLNYNHNTMKIDDETFYLDGQDTMLNLRNGGGKSV
FT                   LVQMVMAPLVNKRYRALKDRTFESYFTTNTPTYIMIEWILDDGAGYLLTGMMVRKKDVL
FT                   SDEDSKDKLDIINFIHEYKEKNEYDIKRIPIVEINNGKKMVKSFLNSKKLFEELKKNKE
FT                   VRFNYYDMNNTVTTKNYFEKLQEYKINHKEWETIIKQINLKESGLSELFIKAKDSSGLV
FT                   KSWFLPAVENKLRKDEDRIKNYRNLVKRYIEQYKANKANIDKKEKIELFNKLSEDIKNS
FT                   CDEFILTIEERKGLENKIANIIRILKNNYEDKENEEKELECLINQLVEKIAELFYEEYS
FT                   IKIYRKEDKIEELEEYVKELDNLVNKSEEEKKALNRKNEILECSKIHKEYQSRSQELQS
FT                   LESELKILTKKKDDNTPHINNIGFTIREILNKEISDMKEKVDERKTDINVLEFEKEKLK
FT                   NILNENRLLINKLKGREGFLKASLESFDKIQSNFNDKYNENIIRNISGYFNEESLLSIR
FT                   RNIEDYNFDLNKNMKNITEDIFYNKEILKSKNNEKERNIKLMFDFENQLKNNESLIEEL
FT                   DEKVKICIDVIKYIDFGEERVFDTEDILNAFYTKIDFLEREKSKLIRQEEDILDELDKL
FT                   EGGRVLELPKEIKKKLEYKDIKIIYGMEWLKKNGYSTEKNIEVVKNNPFIPYSLIMNSS
FT                   EIEILKREGLDIFISNPISIINRLDLESNFLEVDQSMVSFNKLNFFVSFNNKLLDEKEL
FT                   IKLIEEKKQYLESIRSNIENRKNEIRFLEKKKEIIQYSKLDKEKYENVKREKTFLEKKI
FT                   IEIRENEISIAREFGKIEINISELENTKKVLEENIRKNLEKINSFNELIEEYNKYKDNK
FT                   DELSLIEFKIEEINKFLKENENRELEIDKTLKDINNIMVSYNNSLEKLKSEAIEFSFYK
FT                   EGLFIKKDKEDLLAEFYVLNKQITASEKDLKKRREEKSRAFKEIEDELNAKANKYNVAE
FT                   AEYINEVYNINRDFELKDLIEKEDKNYNYLKDKRSNILQEIASEKSNVENLYESLEKDL
FT                   GKTKAKSKALLYDKNFKEEIAKLKIEKASNEKKIKEVINEKNKIDKYLIDLSQFNEFVI
FT                   EKEEDIFIDIKDLDNTIGSIKRDLFEKKDLELKREAKLNNCIVDIENKDSFRNENIFKS
FT                   SIQSLKSLVSKPIKFKEHLNLVINSYNSIIEKLLIDIKLIEDEEEKILDSILEYIEEVN
FT                   KNISIIDDNSTININNKRVKMLNITVQDFEKNKINYRLKLKDYIEAIRERAIKELEKNN
FT                   SIEEIISNNITLFKLYDEIIGVENVEIKLYKIEENRQRIISWDEVSKNSGGEGFLSAFV
FT                   ILTSLLSYMRKDENDIFSRKEDGKVLIMDNPFAQTSSSHLLKPLMDIAKKSNTQLICLT
FT                   GLGGDSIYNRFDNIYVLNLVSSKLNNSIKYMKSEHIKGDKEEKTEIIVSSRLKIEEQTS
FT                   LF"
FT   gene            436049..436771
FT                   /locus_tag="CPR_0358"
FT   CDS_pept        436049..436771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0358"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85354"
FT                   /db_xref="GOA:Q0SW13"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW13"
FT                   /protein_id="ABG85354.1"
FT                   /translation="MYFAYTGEALHSSRFSPSQIISIKTLYNYVDLGLLPIKNIDLPAK
FT                   LHRNKKSTRVRNDKKKLGTSISDRPNSIENREEFGHWEIYCILGEKSNKDKVLLTLVER
FT                   KTRYAIIFEIPSHSAISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTK
FT                   TKLYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLNY
FT                   KTPEELFEIHLDEIYSLY"
FT   gene            437050..437607
FT                   /locus_tag="CPR_0359"
FT   CDS_pept        437050..437607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87566"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW12"
FT                   /protein_id="ABG87566.1"
FT                   /translation="MSNLDCFLSLLIGNFDNSEQFKDFENNGVKDFPFAEHVNTVCNNK
FT                   IKNLPENFKGKFLLEESYYTSNGKTHASPHLFLFTEETKGIKLTSYEIPEGYDKKSFNY
FT                   ENMSLVDYSDLKISEKFTPAFYVFKENFWEGGSVSNFSPIMKFTLFERFSERQLEVSET
FT                   IEVNGKRTFGYDNPIIYKRINK"
FT   gene            438044..440602
FT                   /locus_tag="CPR_0360"
FT   CDS_pept        438044..440602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0360"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF01204; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85323"
FT                   /db_xref="GOA:Q0SW11"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW11"
FT                   /protein_id="ABG85323.1"
FT                   /translation="MQFNLKRKVLITTALTTTLLTGFCNLNAYGSVKNTSVNDFRNVLN
FT                   VQGNPQVNLNDSYSTNVSNPFSDMGAWHAYYLPEKGATNLYGGFAGPLIVGEEYPINLS
FT                   DTISKITLTNNDTGEVYDLSKAKNIMFDFYPGKLVQTYELDDFNLKLELIFATNRSALI
FT                   KTEIENKKNTDLNLNLEWSGNIFNKSPYTISVNENGEKNYDLGQTLEATKNGVQVNFSN
FT                   IRSTWSFFSTDQTKFNVEYDGNTSTSINGNTYVTKLDNVVNIKPENTFKTFSTQSYTFT
FT                   TEEFNNEQVKINDLLENGDTYFNDNTNRWQNYLNKAFSNTEKDSDPHYKDAAVKSIITL
FT                   TTNWRSAAGAIKHDGIVPSLSYKWFVGMWAWDSWKQAVATANFDGELAKNNIRALFDYQ
FT                   IKGDDSVRPYDKGTIIDAIFYNKDEQRGGEGGNWNERNSKPPLAAWAVWNVYKETNDIE
FT                   FLKEMYPKLVDYHNWWYTNRDHDKNGIAEYGGMVHPANNSEDEIILAAAWESGMDNATR
FT                   FDKEGFGSDDAGVHVFENKDNNGNTVGYSINQESVDLNSYLYAEKGFLKSMADILGKTE
FT                   DSQKYEIEAKNVGAYIRNNMFDKETDFFYDLQINEDGSEKKLLVNRGKGTEGWMPLWAK
FT                   VATQDEGELVKENIMDPSKFNTYMPLPTASKDNPKFNPNKYWRGPVWMDQALYGIESLQ
FT                   NYGFKDEAKTLTKKLFDNAEGLIGDGPIRENYNPETGQGLHTKNFSWSASAYYLLYKNV
FT                   LTSNNTTCQESLPILESDNITPPEDDFQKPTPPVIEEEKPETPPANDSSEQEKPVVKPE
FT                   ENNDNINSLPNTGNMFGNTSLLIGAFSMLGAGIYFLKKRN"
FT   gene            441124..441693
FT                   /locus_tag="CPR_0361"
FT   CDS_pept        441124..441693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0361"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86376"
FT                   /db_xref="GOA:Q0SW10"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW10"
FT                   /protein_id="ABG86376.2"
FT                   /translation="MAQQYTKKMIRSVFIELLNERPLNKITVKDIALSCGINRNTFYYY
FT                   YSDMYELLSELFQTELQNVIDEYNDTMSWEESFVLATRFALGNKKVIYHVYNSMQREEL
FT                   VNYIYNVSGNMMERYVKKLSQGINASEYDMKLIATFYQCALTEMVIQWISSGMKEEPDA
FT                   TIRRIGELFDGNIKLSLQRSEKLNRI"
FT   gene            442098..443891
FT                   /locus_tag="CPR_0362"
FT   CDS_pept        442098..443891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0362"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06100"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86099"
FT                   /db_xref="GOA:Q0SW09"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW09"
FT                   /protein_id="ABG86099.1"
FT                   /translation="MKLKTHDDRLTLTNGSYHALVHARKPKGIENKSAYLIGTGIGALA
FT                   AGCFLIRDAHMDGSKITFFEQLDLPGGSLDGEVLQNLGYVARGGREMGHHFEVLWDLFS
FT                   SLPSTEDPNMTVLDHFFYTNYDDPNYSNCRITHKNGERYDNAKFNLGQDLAKELAEFVL
FT                   ISDEELQDKSIDEIFSEELLNTDFWTLWRTMFAFENWHSALEMKLYMNRFIHHVGGLPT
FT                   LSALQFSRHDQYTSFVKPMVKFLKENGARFEYGVHVENVEFDISDDKKVAKKIVAKDKN
FT                   GKDISVNLTENDLVFITNGSMTEGSGYGDDNTPAPFNKEPQGCWELWRNIAKQSDEFGH
FT                   PDKFCTDTEKSNWESCTVTCHDERVPKYIEKITKRSPYGGKTVTGGIVTAVDSSWLMSW
FT                   TINRQEQYYGQPEKDVVVWVYGLFSDVEGDYIRKPMRDCTGKEITKEWLFHIGVPVDEI
FT                   EELAESCTAIPVMMPFITSQFMPREFGDRPYVVPKNAVNFAFLGQFAETLDDPGRDTVF
FT                   TIEYSGRTAMEAVYVLTGVEKGVPEVYASRYDIRYLLNAGVCLLDGEKPKVHIPFLLKR
FT                   KLMKQISGTDIEKLLKEYGII"
FT   gene            444282..446015
FT                   /locus_tag="CPR_0363"
FT   CDS_pept        444282..446015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0363"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86842"
FT                   /db_xref="GOA:Q0SW08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW08"
FT                   /protein_id="ABG86842.1"
FT                   /translation="MKLILKYLKNYKSIFILNFISVFGFALVELGIPTIMAKVIDIGII
FT                   NNDISYIKKMGLVIVVISIVGVMGTILLGYCSSKISTGITKDIRNDIFKKAQEFSHTEY
FT                   DEFGVSSMITRTTNDPFVILQFTNTLLKMALITPVMFTISLVMILKTSLSLSLVLAVVI
FT                   PIIILGVILIAKTSEPLSEKLQKRLDKLNRISRENLTGIRVIRAFGNEKYEEKRFDETN
FT                   ESYAEVAKKLNKLMAISQPLFFFLLNIAIIVIFWISSKMINVGTLQVGQLVAFIEYLFH
FT                   AMFSIMLFSMVFVMYPKAQVSANRIMEVLNTEPIIKSPKNGIKDTENKGTIEFENVSFT
FT                   YPNGEEPVIKDVSFSGKKGEVIAFIGSTGSGKSTLINLIPRFYDVTKGSIKIDGVDIRD
FT                   YDLKYLRKKIGFIPQKTLLFTGSIANNIKFGKKDAEYKEVEDSAKIAQAYEFISNKPNK
FT                   FDELITEGGSNVSGGQKQRLSIARAIVRKPDIYIFDDSFSALDFKTDAILRKELRSETK
FT                   DAIVLIVAQRIGSIMDADKIIVLNEGEVVGIGTHKELIKNCPIYHEIATSQLTEEELAN
FT                   E"
FT   gene            446008..447789
FT                   /locus_tag="CPR_0364"
FT   CDS_pept        446008..447789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0364"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="CAC2392; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87552"
FT                   /db_xref="GOA:Q0SW07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW07"
FT                   /protein_id="ABG87552.1"
FT                   /translation="MNKFKSVVKKISPFVGKYKWAFLGAILFIISAAVFTAIAPRTEGL
FT                   IITQLTKDFEGIIRGVSGASVNFNYIFKVLILLFLVYAGGTGSTLIASFLLTNAIQNTM
FT                   KNIRNEVEKKINRLPIRYFDGNSYGDVLSRITNDVDTISNALQQSFVQVINAFLSVGLA
FT                   LIMMYSINIKLALIATLIIPLSILITKIIVSKSQKLFNSQQKALGNLNGKVQEMYTGFN
FT                   ELKLYGKEDDALNEFVKVNEELRETGFKAQFISGIMSPLISLVTYLGIAVVGVVGSIIA
FT                   IGGGITVGNLQAFIRYIWQINQPLSQVTQLSSAIQSAVAAANRVFEFLEEEEEVKDLNN
FT                   AIKIENPKGDVTFEHVKFGYKEDKPLIKDLSVDVKSGQMVAIVGKTGAGKTTLINLLMR
FT                   FYDVQGGSIKIDGVDIRDMKREDLRAMFGMVLQDTWLFNGTIYDNIRYGRFDATKEEII
FT                   EAAKVANVHHFIKTLPGGYNMLLNEEASNVSQGEKQLLTIARAILKDPAILILDEATSS
FT                   VDTRLELLLQKAMRNIMKDRTSFVIAHRLSTIRSADLILVMNDGNIIEQGTHEELMKQG
FT                   GYYESLYNSQFASKEVN"
FT   gene            complement(447873..448271)
FT                   /locus_tag="CPR_0365"
FT   CDS_pept        complement(447873..448271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0365"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:H72370; match to
FT                   protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85940"
FT                   /db_xref="GOA:Q0SW06"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW06"
FT                   /protein_id="ABG85940.1"
FT                   /translation="MKQNGNEVLLKLQQGELDAVLVYRKLAELSSSEEEKNVLLSIAAD
FT                   EGRHASIIREYSKEILKPCNKSSEEIEAAYKNLGKDKVFEMLINAEINGGPVYEKLGEE
FT                   FPRLKEIAKDEIKHGNLLKGLIEKSNLN"
FT   gene            448493..448891
FT                   /locus_tag="CPR_0366"
FT   CDS_pept        448493..448891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0366"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85368"
FT                   /db_xref="GOA:Q0SW05"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW05"
FT                   /protein_id="ABG85368.1"
FT                   /translation="MENIINYIKWGIVSLGTLFTWIFGAWDIPLITLLVFIFLDYLTGV
FT                   IKGCKSKELCSNIGLRGIAKKGLILVVLLVAVMLDRLLGNGTWMFRTMIAYFYITNEGI
FT                   SILENCSALGVPIPEKLKQALKQLNNKK"
FT   gene            complement(449054..449974)
FT                   /locus_tag="CPR_0367"
FT                   /note="CPE0384"
FT   CDS_pept        complement(449054..449974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0367"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="similar to yxkH B. subtilis; identified by match to
FT                   protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87081"
FT                   /db_xref="GOA:Q0SW04"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW04"
FT                   /protein_id="ABG87081.1"
FT                   /translation="MKKIKHKGFLIALVSALIISSSFIACDMKGNKSNVENEKANLENN
FT                   TQKDEASSNKENPTDNTSKKSNSNAEATKNRFEGLKTTSEDMNIPVLCYHDVTPNNPNN
FT                   NELLVNPEKFKEQLQYLKDNNYTPITLDELYDYLRNNKPIPEKSVVITLDDGYKGNYEY
FT                   AYPLLKEFKFPATIFVISNYVGAQDYMTADQLKEMSNNGIEIESHTFKHDDLSTLDEAK
FT                   QLETLKDSKVALEKIIGKPVDFVAYPFGRYNSSTRVAAEKAGYKLGFNLNGNFTDRKDN
FT                   NFNMDRIYVSNNDSLQKFESRLTGK"
FT   gene            450192..450485
FT                   /locus_tag="CPR_0368"
FT   CDS_pept        450192..450485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0368"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:CAC17805.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87645"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW03"
FT                   /protein_id="ABG87645.1"
FT                   /translation="MVLDYARYGIRVNAVNLGTTDTPMYNEALEFLKNKREATEKAGVK
FT                   VEAGIVSGKVNSPQNRVARAEEVADVILFLASPEASNVTGIFMPVDGGFTAF"
FT   gene            complement(450508..451239)
FT                   /locus_tag="CPR_0369"
FT   CDS_pept        complement(450508..451239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0369"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86510"
FT                   /db_xref="GOA:Q0SW02"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW02"
FT                   /protein_id="ABG86510.1"
FT                   /translation="MEILTVNKHKELLYVTVYDKLFKMINEGTFPENSRLPSEPELAKR
FT                   LGVSRSTLRQALALLQDDGLIKNIRGKGNYIIKENKTDTTGLEKIGHPVYKCLDLETNN
FT                   IELDFKIDPPSDYYKKILGDSSVATVCIDRWYLDDNLAIAYSYTIIPIEVISKFNIDLS
FT                   DKNNLLKFIEEESYKECSKIKSTIKFTTSGNFVTKRHPIPDESQFYLIEEAIYSNSELP
FT                   VIFNKHYLPMKHSTIKVNPMK"
FT   gene            451473..452258
FT                   /gene="udp"
FT                   /locus_tag="CPR_0370"
FT   CDS_pept        451473..452258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="CPR_0370"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /note="identified by similarity to SP:P12758; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR01718"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85721"
FT                   /db_xref="GOA:Q0SW01"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SW01"
FT                   /protein_id="ABG85721.1"
FT                   /translation="MIYTQGSDKQFHIDVAPGEVGKYVIMPGDPKRCAKIAKYLDNAKL
FT                   IADKREYVTYTGYLDGEKVSVTSTGIGGPSAAIALEELVKCGADTFIRVGTCGGIDLNV
FT                   KGGDLIIATGSIRAEGTSREYAPIEFPAVANLDVINALVKGAKELKVPYHTGVVQSKDS
FT                   FYGQHSPETKPVSYDLLNKWEAWKRCGCLGSEMEGAALFIVGSYLRVRVGAVFLTIANQ
FT                   ERQKEGLDNPQVHDTELAIKAGIEGIRNLIKEDKMKNNA"
FT   gene            453718..454908
FT                   /gene="deoB"
FT                   /locus_tag="CPR_0371"
FT   CDS_pept        453718..454908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="CPR_0371"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="identified by similarity to SP:P46353; match to
FT                   protein family HMM PF01676; match to protein family HMM
FT                   PF08342; match to protein family HMM TIGR01696"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87402"
FT                   /db_xref="GOA:Q0SW00"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SW00"
FT                   /protein_id="ABG87402.1"
FT                   /translation="MSKYKRIFTIVIDSLGIGAMNDSEKYGDVNVDTLGHIAESVDTFN
FT                   IPNLQKMGIANLHPIKHVAPVENPIGYQAKMAEASVGKDTMTGHWEMMGLHITKPFKTF
FT                   TDTGFPQELLDELTARTGHKIVGNKSASGTEILDELGEHQIATGDMIVYTSADSVLQIC
FT                   GQEETFGLEELYRCCEIARELTLKDEWKVGRIIARPYLGTKKGEFKRTSNRHDYALKPY
FT                   GRTVLNELKDNNFDVISVGKIKDIFDGEGITEGNKSKSSVHGMEQTLEIMDRDFTGFCF
FT                   INLVDFDALWGHRRNPQGYAEELEKFDVNLGKVLEKLHEDDLLIITADHGNDPTYTGTD
FT                   HTREYVPFLAYSPSMKGHGQLETPKTFATIGATIADNFGLKMPEGTIGESVLNKLV"
FT   gene            complement(455320..456765)
FT                   /locus_tag="CPR_0372"
FT   CDS_pept        complement(455320..456765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0372"
FT                   /product="putative arginine/ornithine antiporter"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF01490; match to protein
FT                   family HMM PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86187"
FT                   /db_xref="GOA:Q0SVZ9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ9"
FT                   /protein_id="ABG86187.1"
FT                   /translation="MNDNKKLGVIALAGVVISAMLGGGVYNLPQNMAQSASAGAILISW
FT                   IITGIGIWFIANTFRILAAARPDATTGIYTYGELGFGKFTGFLMAWGYWICNSFANVGY
FT                   AVLLMDSLNYFFPPYFKGGNNWLSIACGSLVIWIIFFIVLAGVKQASALNVIGTIGKLL
FT                   PLAIFLLVLLFSFKFSTFFTDFWGLKTVVKVHDTNLGGILPQVKSTMLVTLWVFTGIEG
FT                   AVVVSGRAKSQKDVSKATFLGFITCLLIYTLLSLLPLGVYSQGEISKMAPPSTAAVLMD
FT                   LIGNWGSVIMNLGVIIAILSSWLIWTVMLSQLPFAAAQSGTFPKIFAKENKNESPSFSL
FT                   LASTIIMQIILILVHFAGNAWNMMLSITSVMALPCYLVSTLYLFKITYKNENYPTDIFA
FT                   KRKYAMITAILGSIYGVWLIYAAGINYMLIAIVIYALGIPVFIKARCETSPNEKEFTKV
FT                   ERYFAIVLIILALIGLVYLFKFM"
FT   gene            complement(456811..457773)
FT                   /locus_tag="CPR_0373"
FT   CDS_pept        complement(456811..457773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0373"
FT                   /product="histidine decarboxylase, pyruvoyl type"
FT                   /EC_number="4.1.1.22"
FT                   /note="identified by similarity to SP:P04194; match to
FT                   protein family HMM PF02329; match to protein family HMM
FT                   TIGR00541"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85619"
FT                   /db_xref="GOA:Q0SVZ8"
FT                   /db_xref="InterPro:IPR003427"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="InterPro:IPR016106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ8"
FT                   /protein_id="ABG85619.1"
FT                   /translation="MNKNLEANRNRTLSKGIHKNIKVRAPKIDKTAISPYDRYCDGYGM
FT                   PGAYGNGYVSVLKVSVGTVKKTDDILLDGIVSYDRAEINDAYVGQINMLTASSFCGVAG
FT                   QVWGHDLAIHDSIANNEIKPLYELKQFDGTPLKVYDAKPLLDAGIELFGTEKNRRFTTA
FT                   PGAHVICANKSATAYRPKENRPLKEGEAYGVWSFIALSLSNDRDHCADLFIEDAGLWKK
FT                   NDNPEDLKKFLEDHRKAVTWSVVECGRDSHVVFERTYIGFAYVIMKPGEIGNALTCAPY
FT                   VTLARDAIPSEGFPSLNRISLSQWLDDMNFDSLVNPSKK"
FT   gene            458241..459074
FT                   /locus_tag="CPR_0374"
FT   CDS_pept        458241..459074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0374"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85827"
FT                   /db_xref="GOA:Q0SVZ7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ7"
FT                   /protein_id="ABG85827.1"
FT                   /translation="MEILLGALGITLVTGFFYYENNVISTTNYEVDCGIGKDINVVHLS
FT                   DLHGKEFGKNNEKLKMLILKEKTDLVVATGDMIDSSLKNMEGVIDFLSDLSKCVKVVYI
FT                   SGNNEQRCKKAEYIFGSLKSKGVIVLRNEIITLSLSGVKVNILGMFEKPKGDLYSSIKK
FT                   INGSYAYEDSHKLFKRLESLEGLKIVLSHYPELFEAEYSKYDFHIMFSGHAHGGQFRIP
FT                   IVKRGLIAPGQGFFPKYTEGMHGNKNKLIISRGLGNSTKITRLFNRPEIVNVKIK"
FT   gene            459199..459351
FT                   /locus_tag="CPR_0375"
FT   CDS_pept        459199..459351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87802"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ6"
FT                   /protein_id="ABG87802.1"
FT                   /translation="MNKNMEMMKKLIEEKKNKGKNTKSNVRAQKTIGFAQGGRKSNNGG
FT                   GLFDK"
FT   gene            459666..460571
FT                   /gene="nadA"
FT                   /locus_tag="CPR_0376"
FT   CDS_pept        459666..460571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="CPR_0376"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="identified by match to protein family HMM PF02445;
FT                   match to protein family HMM TIGR00550"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87252"
FT                   /db_xref="GOA:Q0SVZ5"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVZ5"
FT                   /protein_id="ABG87252.1"
FT                   /translation="MDIRDKILKLKKEKGAIILAHYYQIPEIQEIADYVGDSYYLSKIA
FT                   KDCEENIIVFCGVKFMAESAKILSPEKTVILPVMEAGCVMADMATEEGLAKLKEEHPNA
FT                   KVVCYINSSTEVKALSDVCCTSSNAENIINNLEEKEIIFLPDRNLGSYIQEKTPDKKFI
FT                   LWNGFCIVHEAIQKEEILRLKREHEGILTVAHPECSKEIRDISDFIGSTSEIINFVNNS
FT                   SNKKFIIITEEGVLHQLRKNGEEKEFYIPYGKMVCRNMKMTTLKDLYESLLKMENKIEI
FT                   DEDLRLKAYNSLKNMHKLGG"
FT   gene            460576..461871
FT                   /gene="nadB"
FT                   /locus_tag="CPR_0377"
FT   CDS_pept        460576..461871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="CPR_0377"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86042"
FT                   /db_xref="GOA:Q0SVZ4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ4"
FT                   /protein_id="ABG86042.1"
FT                   /translation="MKRVADVLIVGSGVAGLYASLNLREDLEIIMVSKKTVNLCNSSLA
FT                   QGGIAVARGKEDFHSFIEDTLKAGKYENNIDSVRVLVEESMNNINKLMDLGANFEKDEN
FT                   GVLFTKEGAHEINRIVYHKDITGKHVEDILLENVKRRKNIKIIEECEMVDIYHRDNRCI
FT                   GALFNKDEENLSIYAKVVILATGGIGGLFKKSTNERIITGDSIGIAIRNNIEIKDLSYI
FT                   QIHPTAFFSKKSEEKRFLISESVRGEGGKLLNCNGERFVDELLPRDIVAKKIYEEMKKT
FT                   NSNNVFLDVSFMEKSFLQNRFPNIYNKCLEEGIDISKEPIPVAPAQHYFMGGIKVDLNG
FT                   KTSMENLYAFGETSCTGVHGANRLASNSLLEALVFSRRGALEINNYIDNLEIIIEEREY
FT                   EDLDKYRLLNRKILIDEICRLRGDIKDELVTC"
FT   gene            461852..462691
FT                   /gene="nadC"
FT                   /locus_tag="CPR_0378"
FT   CDS_pept        461852..462691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="CPR_0378"
FT                   /product="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by match to protein family HMM PF01729;
FT                   match to protein family HMM PF02749; match to protein
FT                   family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87493"
FT                   /db_xref="GOA:Q0SVZ3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ3"
FT                   /protein_id="ABG87493.1"
FT                   /translation="MNWLLVEENVKRALNEDLQYGDITTESVVLDHKIAKVDIIAKEKG
FT                   IIAGTEVFKMVFKILGDVEVDFSVNDGEEVEKGQHFGQVSGDAKKILMGERVALNYMQR
FT                   MCGIATLTREFVERLEGTKVKLLDTRKTTPNMRIFEKYAVKIGGGTNHRFGLSDGVMIK
FT                   DNHIEAAGGIKNAVSLARKNSPFVRKIEVEVESIEQLKEALEAKADIIMLDNMDIKTLK
FT                   ESVKLIDNRVEVEASGNVTLDNIREIAKTGVDFISTGSVTHSFKVLDISMKNFRYID"
FT   gene            462821..463873
FT                   /locus_tag="CPR_0379"
FT   CDS_pept        462821..463873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0379"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86348"
FT                   /db_xref="GOA:Q0SVZ2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ2"
FT                   /protein_id="ABG86348.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYNKNRLKSNRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIIS
FT                   EMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHP
FT                   YSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE
FT                   IHLDEIYSLY"
FT   gene            complement(464151..464378)
FT                   /locus_tag="CPR_0380"
FT   CDS_pept        complement(464151..464378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85320"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ1"
FT                   /protein_id="ABG85320.1"
FT                   /translation="MEEVQKLSLEESIKYFFGVINSDFYYSIADNIFELSFYETIKYAK
FT                   DYKFYNQTYKKLKLLIDNNPNENLYKNLLE"
FT   gene            complement(464981..465940)
FT                   /gene="cpe"
FT                   /locus_tag="CPR_0381"
FT   CDS_pept        complement(464981..465940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpe"
FT                   /locus_tag="CPR_0381"
FT                   /product="enterotoxin Cpe"
FT                   /note="identified by similarity to SP:P01558"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85760"
FT                   /db_xref="GOA:Q0SVZ0"
FT                   /db_xref="InterPro:IPR003897"
FT                   /db_xref="InterPro:IPR038585"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVZ0"
FT                   /protein_id="ABG85760.1"
FT                   /translation="MLSNNLNPMVFENAKEVFLISEDLKTPINITNSNSNLSDGLYVID
FT                   KGDGWILGEPSVVSSQILNPNETGTFSQSLTKSKEVSINVNFSVGFTSEFIQASVEYGF
FT                   GITIGEQNTIERSVSTTAGPNEYVYYKVYATYRKYQAIRISHGNISDDGSIYKLTGIWL
FT                   SKTSADSLGNIDQGSLIETGERCVLTVPSTDIEKEILDLAAATERLNLTDALNSNPAGN
FT                   LYDWRSSNSYPWTQKLNLHLTITATGQKYRILASKIVDFNIYSNNFNNLVKLEQSLGDG
FT                   VKDHYVDISLDAGQYVLVMKANSSYSGNYPYSILFQKF"
FT   gene            complement(467148..467603)
FT                   /locus_tag="CPR_0382"
FT   CDS_pept        complement(467148..467603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0382"
FT                   /product="IS1469, transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87616"
FT                   /db_xref="GOA:Q0SVY9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY9"
FT                   /protein_id="ABG87616.1"
FT                   /translation="MDTNSLAHTKWNCKYHIVFAPKHRRKEIYGEKKQEISEILRQLCE
FT                   WKGVRIVEAHACVDHIHMLVEIPPKMSVSSFVWVLKCKSSLMIFEKFANLKYKYGNRHF
FT                   WCMGFYVDTVGKNKKAIEDYIRNQEQEDMIADQISLKEYMDTFKCSK"
FT   gene            467936..468988
FT                   /locus_tag="CPR_0383"
FT   CDS_pept        467936..468988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0383"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85343"
FT                   /db_xref="GOA:Q0SVY8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY8"
FT                   /protein_id="ABG85343.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYKKNRLKSNRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIIS
FT                   EMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHP
FT                   YSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE
FT                   IHLDKIYSLY"
FT   gene            complement(469142..470500)
FT                   /locus_tag="CPR_0384"
FT   CDS_pept        complement(469142..470500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0384"
FT                   /product="uracil-xanthine permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801; match to protein
FT                   family HMM TIGR03173"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86061"
FT                   /db_xref="GOA:Q0SVY7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY7"
FT                   /protein_id="ABG86061.1"
FT                   /translation="MEKQNLKNTEVNLIYGVDDDLDLPKKVLFGLQHIFAAFGGIIVVP
FT                   LVIATSLGFDSKVTTALISASILGSGLATIIQAKGVGKVGARVACIMGTDFTFVSPAIS
FT                   VGSVLGLPGIIGATILGSLFEVILSFFIKPLMKFFPPLVTGTVVALIGLTLLPVSIDWA
FT                   AGGAGSANYASLENLAVAMFVLIITLLLNNYGKGMISSASILIGIVVGYIVCIPLGLVD
FT                   FTSVKEASWLSFPKILEFGVTFDAKAVMAFIPAYFVATIGTVGCLKAIGETSNIDIGDK
FT                   RVAAGVLSDGVGSALGGLVGSCPNTSFSQNIGIISLTKVASRHVAVMAGILLVILGFLP
FT                   KVAAIITGIPNPVLGGVGIMMFGTVAAAGIRTLSNIKLTERNLLIIAISMGLGLGVTFR
FT                   PDVIHNLPEAIRMIFSSGISTGTIAALILNAVLKESPTSMEFENMYDEETKAS"
FT   gene            471091..471408
FT                   /locus_tag="CPR_0385"
FT                   /note="CPE0401"
FT   CDS_pept        471091..471408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87389"
FT                   /db_xref="GOA:Q0SVY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY6"
FT                   /protein_id="ABG87389.1"
FT                   /translation="MQITDEKVKNSFVIRALKQIGTFFIFTMVFAIVFSFLQPRVYKTH
FT                   SEYLSIKEKYDNLQKEYDSLNEKISNDTNALNSKKEDLTKSNEDLQNKLNSLNKEIQSL
FT                   N"
FT   gene            471421..471708
FT                   /locus_tag="CPR_0386"
FT   CDS_pept        471421..471708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0386"
FT                   /product="putative dna repair protein rad50"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85488"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY5"
FT                   /protein_id="ABG85488.1"
FT                   /translation="MIKEIIKFIKNHKIALILALILGISPNLMVKDYSKEFNEVAPKVN
FT                   ELEYKILALKNNTELKSIQEEIDKLQNENNTLSKEVENKQKYLDNLNINK"
FT   gene            471719..472252
FT                   /locus_tag="CPR_0387"
FT   CDS_pept        471719..472252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86284"
FT                   /db_xref="GOA:Q0SVY4"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY4"
FT                   /protein_id="ABG86284.1"
FT                   /translation="MSDKKLFTIKTSINKKDYSRFLYIATFLRNKFTIPAIIVITALMA
FT                   GFVSYNNRTFELKSFLIYWLILLIITLFAIVVKIEFQSREREKADKAGVLKSIETLEFF
FT                   DDILVIKSTAFKGKSKIKYYKFYEVIESKNYFIIYFNRGQASIIRKVDLEDSLVDELID
FT                   LLTGKIGNKYKKLF"
FT   gene            472816..474153
FT                   /gene="brnQ_2"
FT                   /locus_tag="CPR_0388"
FT   CDS_pept        472816..474153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ_2"
FT                   /locus_tag="CPR_0388"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86359"
FT                   /db_xref="GOA:Q0SVY3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY3"
FT                   /protein_id="ABG86359.1"
FT                   /translation="MKDLSRKDLLLVSLMLFSLFFGAGNLIFPPFLGQAAGSSTWITIL
FT                   GFFVTAVGFPVLGVIAVAKSGGLHALASRVNPVFATFFTVLIYISIGPGLGIPRAGSLP
FT                   FEMAVAPFLPEGLISNNLALFLYTFVFFAVAYWLSLSPAKLVDRMGKVLTPSLLVLIGL
FT                   IFVASIFKPLGAYGDVTGVYKESPFISGFLDGYMTMDTIAALNFGIVIALVIKSKGVKE
FT                   EKFVVKTSVKAGIIAGGLLIVIYSMLAHLGATSGGRFGLTENGAQTLSNIITYIFGKPG
FT                   AILLAVIFTLACLTTCVGLITSCSQYFQTLTKKINYLSWVRILTLTSMVLANMGLNKIL
FT                   AVSVPILNAIYPMAIMLIVLAMLDKYIKGNSVVYTTTIAFTTIVSVIHALSGTGINIEF
FT                   LNSIFENLPFYSEGLGWILPALFGLGLGLVLKSFFEKNKEKVLEVS"
FT   gene            474429..475280
FT                   /locus_tag="CPR_0389"
FT   CDS_pept        474429..475280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD47718.1; match to
FT                   protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86280"
FT                   /db_xref="GOA:Q0SVY2"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY2"
FT                   /protein_id="ABG86280.1"
FT                   /translation="MYQVVYRITAIILFGALAGIGVNFFLTPAHIYSSGVTGISQLLSS
FT                   IGGDFFNINIDISTWVLILNLPLAYLSFRKLGKKFTLYSFLSIISLSFFIGIIPTRAVT
FT                   NNQLLNSIFGGVLMGAGVGMCFRAGFSTGGTDIIVLVVQKMTGKSVGQLGFIVNGIILL
FT                   VAGLVYGWELALYSLVSIYVTTKVIDLFYIQQYKLTVTIYTKKEKEIVDSLIKSQMRGV
FT                   TIGRNLYGGYTNEPLSSITTVISKHELLIVKKNVMDIDPEAFVNIQPTVEVMGNFYDNS
FT                   LI"
FT   gene            475454..478411
FT                   /locus_tag="CPR_0390"
FT   CDS_pept        475454..478411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0390"
FT                   /product="polysaccharide lyase, family 8"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF02278; match to protein
FT                   family HMM PF08124; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85527"
FT                   /db_xref="GOA:Q0SVY1"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY1"
FT                   /protein_id="ABG85527.1"
FT                   /translation="MKKSRKKINSLISMAIASCMVMGVSYENVLALENKSQNNSEKLVK
FT                   YDNETEYIKNIRLRWKEDLVGNSSLDTSNATISKKIISYVNNTDKLVAKLNMDPKAQWL
FT                   WEDLKDYKQNPARITSMFNNLVTMTMAYSLPNNKYYKNEDLKNKIIYSLDWINKNAYNE
FT                   NIDQYGNWWDWMIGIPARLNNIVVLMYDDLTEEQVKNYMNAIQKFLPSIEPGSKYHTGA
FT                   NLADVCMNKLLQGVNENDPEKIKEASEDIIGVFDYVTSGDGFYKDGSYLQHGMVAYTGS
FT                   YGNVLIEKISNIMFLLEKTPWSIKSESKDNVYKWIFDSFNPIIYKGYVMDMVRGRAISR
FT                   YNANGYLQASGIIEGMIKIGMISDGDKASEINSLVKKWATEAKSVLDFGTRFKSINVID
FT                   EFYGIMNNDNIKPLEEGNKHYALNSMDKTVHKRENFALGISRSSSRISKYEFMNKENLT
FT                   PWFQGDGMTYLFNNDLNQFSGNFWATVDPYRMPGTTVDTRKREPKEILPGLDPGASQQN
FT                   EIYYELGKSNWSGGSKLGAYGVAGMEIDNKYDSLKAKKSWFMFDDEIVALGSGITNPED
FT                   FETETIVENRKIKSDGSNKFIVDGKERVSKLKEKDKVDNAKWAYLEGNVSGSNIGYYFP
FT                   EGSNINLIKDEREGNWINVNSSKPEADKVVKDNYLTMYIDHGKAIKNQKYSYVLLPNKT
FT                   EDKVKEYSENPNVEIIQNDDVAHSVKHKKLNIEAANFWKDGKNTAGNITSTGKSSIIIK
FT                   ENKDNTLSIAVSDPTFLEKKLSVEINKPAMEVIKSDERISNINLENGKIKFDVNTENLS
FT                   GSPLELLVKLGKKNNGDNENNNEIKNEAPVIEGQDANLFVGDKWDKSLHKLKATDKEDG
FT                   DLTKNIKIKDNQIPLNDQFEVTKPGTYPVTFEVSDNNGKKAEKKLNVLVKEKEENKPEN
FT                   KPENQENKPNIKPEDQENNNTEKLPNTGGASSLSLAAIGVLLATVGTMFTKKRKK"
FT   gene            478518..479348
FT                   /gene="kduI_1"
FT                   /locus_tag="CPR_0391"
FT   CDS_pept        478518..479348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduI_1"
FT                   /locus_tag="CPR_0391"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="identified by similarity to SP:Q46938; match to
FT                   protein family HMM PF04962"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85981"
FT                   /db_xref="GOA:Q0SVY0"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVY0"
FT                   /protein_id="ABG85981.1"
FT                   /translation="MRNRYANNPKDSKRYDTEELRENYLVEGIFKDDQIELVYSHVDRI
FT                   IFGGIKPVYKGLKLKAGKEMGVDYFLERRELGIINIGGKAIVTIDETEYELKEKDGLYV
FT                   GKGNKEVSFKSVNPEEPAKLYVNSVPAHKEYETVKIDIEKANPVRLGDNKTLNKRTIYQ
FT                   YVHPNVCESCQLLMGLTMLEPGNAWNTMPCHTHERRMEVYFYFDMDEDTRVFHLMGEPT
FT                   ETRHLVVKNEECVISPSWSIHSGVGTSNYTFIWGMCGENKTFDDMDHISMDILR"
FT   gene            479364..480140
FT                   /gene="kduD"
FT                   /locus_tag="CPR_0392"
FT   CDS_pept        479364..480140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="CPR_0392"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01832"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87138"
FT                   /db_xref="GOA:Q0SVX9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX9"
FT                   /protein_id="ABG87138.1"
FT                   /translation="MNMEKFSLDFFKLDGKVAIVTGGNTGLGMAYVEALAKAGADVLVT
FT                   TFDNNTEEVKNIVESLGRKIVFVQGDLTKKETRDKVVSTCLEEFGKIDILVNNAGTIRR
FT                   APLLEYKDEDWQAVMDINLNSVYYLSQAVAKVMAKQGYGKIINIASMLSFQGGKFVPPY
FT                   TASKHGVAGITKAFANELADLNIQVNAIAPGYIKTANTAPIRADKARNQEILSRIPAGR
FT                   WGEVSDLMGTVVFLSSKASDYLNGHILAIDGGWLVR"
FT   gene            480137..480778
FT                   /locus_tag="CPR_0393"
FT   CDS_pept        480137..480778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0393"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="includes 4-hydroxy-2-oxoglutarate; identified by
FT                   match to protein family HMM PF01081; match to protein
FT                   family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87851"
FT                   /db_xref="GOA:Q0SVX8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX8"
FT                   /protein_id="ABG87851.1"
FT                   /translation="MIKKIKTLINLINEAFVLVLRTNTKDEGIETAKAAIKGGCNIIEV
FT                   TFTIPNADKVIEELIKDKNEEVVIGAGTVLDAETARIAILAGAEFIVSPSFDRETATLC
FT                   NRYGVPYIPGCFTPREIKEAREFGSDVIKLFPGSAFKPTIVKDLKAPIKGIAVMASGGV
FT                   SFENMDEWFNNSCDIVSIGSAIIKLKDPAKIEAETRKYIERVKKLRIQRG"
FT   gene            480782..481801
FT                   /locus_tag="CPR_0394"
FT   CDS_pept        480782..481801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0394"
FT                   /product="kinase, pfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85711"
FT                   /db_xref="GOA:Q0SVX7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX7"
FT                   /protein_id="ABG85711.1"
FT                   /translation="MKKVLVLGEMLMRLTPPNNNKIGQANTFNVCFGGAEVNVAVGLSN
FT                   LGIETRVLTALPDNEIGNFAKFFLKSQHVDCDFIISKGDRLGLYYYEEGCSARKAKVVY
FT                   DRKHSSITELQYEDIDVESLFKDIELLHISGITFGLSEEVSGVALKLVNEAKKRGIKIS
FT                   IDLNYRSKLFESYEEFVRIMTPIVQDAYLCFGWLNKENEPFKVLDASTTELSDEDFIER
FT                   FRYTIEDLKVKNIVTTLRSGTPYNYHTLQGVFYDGKRVYKSSKYDFSMISRIGGGDAFA
FT                   AGVIRTLIENKWEDLSHVIEFGTAAAVLKQTQLGDVSVSSNEEVLDLINNKNLGSVNR"
FT   gene            481964..482794
FT                   /gene="kduI_2"
FT                   /locus_tag="CPR_0395"
FT   CDS_pept        481964..482794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduI_2"
FT                   /locus_tag="CPR_0395"
FT                   /product="4-deoxy-l-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="identified by match to protein family HMM PF04962"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87448"
FT                   /db_xref="GOA:Q0SVX6"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX6"
FT                   /protein_id="ABG87448.1"
FT                   /translation="MRTRYANNPRDSKRYDTEELRENYLVEDIFKDDQIELVYSHVDRI
FT                   IFGGIKPVYKELKLEAGKEMGVDYFLERRELGIINIGGKAIVTIDETEYELKEKDGLYV
FT                   GKGNKEVSFKSVNPEEPAKLYVNSVPAHKEYETVKIDIEKANPVRLGDNKTLNKRTIYQ
FT                   YVHPNVCESCQLLMGLTMLEPGNAWNTMPCHTHERRMEVYFYFDMDEETRVFHLMGEPT
FT                   ETRHLVVKNEECVISPSWSIHSGVGTSNYTFIWGMCGENKTFDDMDNIPMDVLR"
FT   gene            482811..484001
FT                   /locus_tag="CPR_0396"
FT                   /note="SP0322"
FT   CDS_pept        482811..484001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0396"
FT                   /product="putative glucuronyl hydrolase"
FT                   /note="similar to Streptococcus pneumoniae (strain TIGR4);
FT                   identified by match to protein family HMM PF07470"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87664"
FT                   /db_xref="GOA:Q0SVX5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX5"
FT                   /protein_id="ABG87664.1"
FT                   /translation="MIKEIRVEEIAKKDEFLKTKLLTRAEVKNAIDLVIKQIDANIEYF
FT                   KDKFPSSATKNNEYGIIENIEWTDGFWTGLLWLAYEYTGDEKYRELADKNVASFKNRVE
FT                   KDIELDHHDLGFLYSLATVSGYKLTGSEDAREASIKAANKLTSRYQEKGEFIQAWGELG
FT                   RKDHYRFIIDCLLNILLLYWASDETGDAKYRNIANKHFVTSCNNVIRDDASAFHTFYMD
FT                   NETGKPLRGVTRQGYSDDSAWARGQAWGVYGIPLNYRYTRNESCFNLYEGMTNYFLNRL
FT                   PKDNVCYWDLIFNDGDDHSKDSSAAAIAVCGMHEMNKYLPEVDENKEVYKYAMHNILRS
FT                   LIENYMNPEIEPGKPVLLHGVYSWHSGKGVDEGNIWGDYFFLEALIRFYKDWNLYW"
FT   gene            484017..484505
FT                   /locus_tag="CPR_0397"
FT   CDS_pept        484017..484505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0397"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85657"
FT                   /db_xref="GOA:Q0SVX4"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX4"
FT                   /protein_id="ABG85657.1"
FT                   /translation="MGVNIEMMRIDERLIHGQGQMWLNSLGVNTVIVANDIASEDKIQQ
FT                   TLMKTVVPKSIAMRFFSIQKTCELIHKASPQQKIFLVCKTPEDALKLIAGGVPVKEINI
FT                   GNIHNAEGKEQVTRSIFLGKEDKDALRELSEKYNVKFNTKTTPRGDDGAMQVDITKYL"
FT   gene            484554..485345
FT                   /locus_tag="CPR_0398"
FT   CDS_pept        484554..485345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0398"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86521"
FT                   /db_xref="GOA:Q0SVX3"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX3"
FT                   /protein_id="ABG86521.1"
FT                   /translation="MEITLIQCILIGLWTAFCLAGMLLGLYTNRCIILAFGVGIILGDI
FT                   PTALAMGAVSEIAFMGFGVGAGGTVPPNPMGPGIIGTLMAITMKGQGMDPATALALSFP
FT                   FAVAFQFLITATYTFATGLTQFANKGIEEGNWIKFKIGANATIWVFAIVGFIIGFAGVF
FT                   STTGLQAAVEMIPAWLIGGLSVAGKMLPAIGFAMILSIMAKTELIPFVLLGYVCIGYLN
FT                   LPVMGVAFVGAIFALIEHFRGNNSNNSSDSNDEEVVFEGGI"
FT   gene            485311..486144
FT                   /locus_tag="CPR_0399"
FT   CDS_pept        485311..486144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0399"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86727"
FT                   /db_xref="GOA:Q0SVX2"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX2"
FT                   /protein_id="ABG86727.1"
FT                   /translation="MMRRLYLKVESRVLTKSDYIKTSLRAFFLQNGFNYGNYQGLGYAN
FT                   ILYPALKKIYRNNEEGFKKALGENVEFFNSNPHFLPFITSLHLVMLDSGRSSEEARTIK
FT                   LALMGPLAGIGDSLSQFCLAPLFSTIAASLAQDGLIAGPILFFVAMNAILLTIKLLTGI
FT                   YGYKLGTSIIDVLSEKMAQISAVASMIGVTVISGLAVSFTKIQIAYKYTAQMPDGAEKV
FT                   VSIQEMLDKIAPALLPALYTILIFYLIKKRKWTTYHLVILTIVLGILGSVLKILA"
FT   gene            486214..486627
FT                   /locus_tag="CPR_0400"
FT   CDS_pept        486214..486627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0400"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIA
FT                   component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87284"
FT                   /db_xref="GOA:Q0SVX1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX1"
FT                   /protein_id="ABG87284.1"
FT                   /translation="MKILVVGHGEYSTGIKSVIKLLTGVEENIDAINLNGELTHDEFTV
FT                   KVKKYIEDNNDLIVFADITGGAPFQITSREILLNEKSENQYVVGGVSVACILEVIMNTL
FT                   VLENNENHRGVIEEALNKLPEMSSVICRKDLVD"
FT   gene            486630..486908
FT                   /gene="yajC"
FT                   /locus_tag="CPR_0401"
FT   CDS_pept        486630..486908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="CPR_0401"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87277"
FT                   /db_xref="GOA:Q0SVX0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVX0"
FT                   /protein_id="ABG87277.1"
FT                   /translation="MNERVLWLIILVLATYTIIISFISPMIHKKRMKEQEKARDIYLSK
FT                   LKPGDKVIIISGIYGIIKGINNNIVKLEISKGVIIEIDKESIMGVLN"
FT   gene            487046..489064
FT                   /locus_tag="CPR_0402"
FT   CDS_pept        487046..489064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0402"
FT                   /product="heparinase II/III-like protein"
FT                   /note="identified by match to protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87833"
FT                   /db_xref="GOA:Q0SVW9"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW9"
FT                   /protein_id="ABG87833.1"
FT                   /translation="MSNYSNKIEELKAKINKYMQGYDTEFVRYYINHNCKKEIDKKLIG
FT                   ANLILNNSFIFDDEWDMEQCKIPYLNRNLDWNFTPNGDEEWVFMLNRHEYFEKLIASYY
FT                   FSNDEKYLDKLKELIFNWIENNEIKECGGPTIRTIDTGIRCFSWIKSLLHLIHENKLED
FT                   EEILKIIFSIKEQLEYLKKSYIDKYVLSNWGVLQTTAIITCSLWLKDFIEDEELYKWAL
FT                   EELYREINLQVLEDGSHWEQSVMYHIEVLNYSMATIHYVKYFNVDLDEEFLEKIHSMAK
FT                   YLVYCGDSNSIQVAQGDSDRSDIRDVLLRASILFNDPHLKFRAYETMDLTSILLFGRDG
FT                   FLKYTNMDAEEITMLNKSFIDSGNIYIRSGWDKEASFTYLQNGTLGSGHGHSDLCHFSI
FT                   HYGGEPFLIDSGRYTYVESDFLREYLKSVKAHNVSIIDDSPFAIPKNSWKYNKYPDVMK
FT                   NYFNEKDNIAYAEMAYLATLSDGTPYTVIRKVLVISPDIWVIVNDIRCSGKHICKNYYN
FT                   LDYKVKVIKEEGYFRCVNKESEIKIYNNNVDKKYIENTLISTNYNSINNSKKIVTQCTF
FT                   ENNFVNYDIILGQNLKSIEIKDPSIVQYNSKEKINTSVAITKEFVINENESYTIIIFNK
FT                   ETFKGAKVYIYDSLVLYGKVIVVHRFKDEREIIRLKA"
FT   gene            489098..490111
FT                   /locus_tag="CPR_0403"
FT   CDS_pept        489098..490111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0403"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87163"
FT                   /db_xref="GOA:Q0SVW8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW8"
FT                   /protein_id="ABG87163.1"
FT                   /translation="MVNEGAKLTINDIAKKAKTSKTTVSFYLNGKFDKMSPDTKRRIEQ
FT                   VIEETNYSPNIMARSLKLKKSNLIGVVVADITNPFSSNIVKGIGEITRRKGYQILVGST
FT                   NLDYYNEEEYFKKMLDMGVDGFIVQPTKNFDKLYPAIKNKGKKIVVLDSVSSRYTGKWV
FT                   KTNNYEIVYEAVLKLAEKGYEEFILVTEAPDKLAARMERKTGFEDAVNKINCKSFIEII
FT                   NENTEVDEIAEMLKINISNNKKTLVFAINGKILQKVFKAVKMEGFDVPSHVGIIGFDKW
FT                   DWTMYANPSVTTIDQPTYEEGKYAAKMLIEMIEENDDFYKSEVFKCNINWEESTDL"
FT   gene            490411..491757
FT                   /locus_tag="CPR_0404"
FT                   /note="CPE0406"
FT   CDS_pept        490411..491757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0404"
FT                   /product="probable reticuline oxidase"
FT                   /EC_number="1.5.3.-"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF08031"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86451"
FT                   /db_xref="GOA:Q0SVW7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW7"
FT                   /protein_id="ABG86451.1"
FT                   /translation="MEKVDFSKLTGDLVTRENIEYEKSIESWNRAIKKYPLGIVFCNNI
FT                   DDVKNALEWAKENNIPFRIRVGRHNYEGYSIGNDVLVIDLSKMNNIIIDEENMKVTIEG
FT                   GVKNEEIYEALGVLGYPFPGGGCPTVGVVGFTLGGGWGYSSRLLGLGCDNLLEVKFINS
FT                   KGKIVIANEYDNSDLFWATKGCGGGNFGVVVSMTFKIPQKIEMATLIDIDYPNAEKEEL
FT                   VYVIRTLQKKFKNLDRRMNLKTAIYNSKDKGIGVKITGLFYGHKEEANEILLPFKLPTR
FT                   VNFNLSYMRVLEANRKIEYSHPPYEKYKSTGRFVFRDYDNSEIEKLIDIVSNRAEGAYY
FT                   TAISFYGLGGAVKDIHKNSSAFYYRDARFIMGIQSVWEDDIFAEENIKWIKNNFKYIES
FT                   ITTGSFINFPFKDLKDYEEEYYGENKERLREIRKKFDENKFFFFEQIIK"
FT   gene            491792..492145
FT                   /locus_tag="CPR_0405"
FT   CDS_pept        491792..492145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO80898.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85518"
FT                   /db_xref="GOA:Q0SVW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW6"
FT                   /protein_id="ABG85518.1"
FT                   /translation="MTYKSSIILNKEKYNSYFDNTFKNSIVHHIKCLLLGVFTLGLAYP
FT                   WIICMKYESTCKHTVICGKRLKFIGDPKELIGHWIFWWILIVITFGLYGFVVKTKFQQW
FT                   TNANTIFDDVQIK"
FT   gene            492464..492781
FT                   /locus_tag="CPR_0406"
FT   CDS_pept        492464..492781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0406"
FT                   /product="ISCpe2, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87609"
FT                   /db_xref="GOA:Q0SV46"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV46"
FT                   /protein_id="ABG87609.1"
FT                   /translation="MFGDVDKSLKEIILKIASDNNFEISEMETDKDHIHLLIECSPQHQ
FT                   IPNIIKALKGVSARLLFLKHPEIKRYLWGGNLWNPSYFVATVSENTEEQIRNYIQNQQE
FT                   K"
FT   gene            492792..493286
FT                   /locus_tag="CPR_0407"
FT   CDS_pept        492792..493286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0407"
FT                   /product="ISCpe2, transposase orfB"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86673"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW4"
FT                   /protein_id="ABG86673.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGA
FT                   GYDKYYKKTGGRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKRIKLPKLGLVKIENSE
FT                   M"
FT   gene            494288..494848
FT                   /locus_tag="CPR_0410"
FT   CDS_pept        494288..494848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0410"
FT                   /product="Carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85941"
FT                   /db_xref="GOA:Q0SVW1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW1"
FT                   /protein_id="ABG85941.1"
FT                   /translation="MRRLEEILDFNKNFVKNKEYEKYKATKKPEKKLVILSCMDTRLTE
FT                   LLPKAMNIKNGDAKIIKNAGATIMHPFGSIVRSILVAIYEFNAEDVLIVGHHGCGMSNL
FT                   NSKDMIKKMESRGISEETILTIKHCGIDVEKWLHGFGCVEESVKKSVTSLKNHPLMPSD
FT                   VNVHGLVIDPQTGELNVIVNGYE"
FT   gene            495026..495664
FT                   /locus_tag="CPR_0411"
FT   CDS_pept        495026..495664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN58407.1; match to
FT                   protein family HMM PF06541"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87289"
FT                   /db_xref="GOA:Q0SVW0"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVW0"
FT                   /protein_id="ABG87289.1"
FT                   /translation="MNISYELNIYKIIWIFTIGSILGYCVEMLWCYIRNGHFESRKGLI
FT                   YGPISPVYGIGGVALTVLLYRLINYNGIIIFFITAIIGGVFEYLCSWFQEKLFSSVSWE
FT                   YSSKALSIHGRTSVEYSVFWGILGVFFLRDIYPLFDKFMGLFSFQTVKTITLIFLVLLI
FT                   PDIIISSLAVRREVARMKGIKAKNALDRFLDKKYTDEFLKKIYPNMIFK"
FT   gene            495689..496078
FT                   /locus_tag="CPR_0412"
FT   CDS_pept        495689..496078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO36906.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86740"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV9"
FT                   /protein_id="ABG86740.1"
FT                   /translation="MFFIGIFGIENKQKEVKQLENIYCKTCSTRTMGTLIKSYEYFHIF
FT                   FIPIFRWNEKYYVMCKRCNSIYEISKERGKAIENGEINEVNLEDMTLIQEGQVYGKRAV
FT                   KKVFPNCGKTLEGDYNYCPYCGSEI"
FT   gene            496222..498093
FT                   /gene="hsp90"
FT                   /locus_tag="CPR_0413"
FT   CDS_pept        496222..498093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp90"
FT                   /locus_tag="CPR_0413"
FT                   /product="heat shock protein"
FT                   /note="identified by match to protein family HMM PF00183"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86071"
FT                   /db_xref="GOA:Q0SVV8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVV8"
FT                   /protein_id="ABG86071.1"
FT                   /translation="MEKREFKAESKRLLDIVINSIYTNREIFLRELISNASDAIDKVYY
FT                   KTLGDSSLTFNKDDYYIKIKPNKEERTLTISDKGIGMTEKELDENLGVIAKSGSLQFKK
FT                   ENEIKDGFDIIGQFGVGFYSGFLVADKITVITKAFGADKAYKWESDGVDGYTISEAEKD
FT                   SFGTDIILHLKANDEDENYDEFLEEYKLKSLIKKYSDFIRYPIKLDVTKSRVKEGTENE
FT                   HEEYVEEETVNSMVPLWRRNKNELTDDDYNNFYVEKRFGFDKPLRHMHISVDGMISYNS
FT                   ILYIPENIPYDYYTKEYEKGLELYSNGVLIMEKCSELLPDYFGFVKGIVDSQDLSLNIS
FT                   REMLQHDRQLSRIAKNIKTKIKNELESMMKNDRESYEKFYKSFGRQLKYGVYDDFGMNK
FT                   DELKDLLMFYSSKEKKMVSLAEYVERMAEDQKYIYYAVGESNERIEKMPQTEMVLDKGY
FT                   EILYFTEDVDEFAIKMLMNYKEKEFKSVSSGDLGIESEEENKKENEENKGIFEAMKEAL
FT                   GEKISAVKASSRLKNYPVCLSSEGEVSIEMEKILSAMPNNQGVKAQKVLEVNTNHEVFN
FT                   SLKDALENDRDKFNLYTKLLYNQALLVEGLSIEDPVDFTNDICKLMK"
FT   gene            498265..499842
FT                   /locus_tag="CPR_0414"
FT   CDS_pept        498265..499842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F97297"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85341"
FT                   /db_xref="GOA:Q0SVV7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV7"
FT                   /protein_id="ABG85341.1"
FT                   /translation="MRKCKSCGRIIEGNDRFCLICGAKIEEVKEELNNNETDVKTYEKE
FT                   KLENSNEELKESTEKPLKCEKNIYDNREKNKKSPLKGRSNKLILISLSLFGILFFSYKQ
FT                   LGAYMSNPQNVIEKFKVSILDKNEQKLIDLLDTESSSLKIDEEGAKVIIDYFNKNLDAL
FT                   DETINYLIRDSKLINKNDELSNMLNLNTDNEKKLFYIKNSKKGFLGLNKIKVYINPIFI
FT                   NVNSKVEGVKFFINGKEMCESDKRDFNLKVGPLVPGEYELSYKFNNEYVSLEQTETVDL
FT                   IENFSLYDNEFIYEMGNELKYVTLKTSEKSKEATVYIDGKNTGKKAYELSDIGPILYNT
FT                   KISIEIKQEDNIFKSDEVEVGKRKELYIDLDSQLYEYEIKNNKEEDKIGKVSSNFDNDY
FT                   SELYYNVENLVKDYTYNFTVAVNNNNFEAIKKYLYQGEDLYDSQESIVKQFYNDGIREE
FT                   LIDIKIEKINILNEQELSGTVEAIERYSIKQNDEEQEKLFNVLYEFKFNNISGNYELTN
FT                   IKHLDKLN"
FT   gene            499872..500678
FT                   /locus_tag="CPR_0415"
FT   CDS_pept        499872..500678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86101"
FT                   /db_xref="GOA:Q0SVV6"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV6"
FT                   /protein_id="ABG86101.1"
FT                   /translation="MYCSKCGKEIPEESVFCPECGSRCKLSADKKNKEIDTKEIKELII
FT                   NLIFSPINTMKNGNINLSSKNKIIYILITTLIMPLITVLFLRSSSFNLIKSIPSTIAKF
FT                   SGSSSWNINDSIEFKNQFNMIMQNLFPTGKIYFLSLSSYILNYALLLGIIYIVFKFIIK
FT                   DNFDKINILNILFIISTFNVLLKIISSIALILGLLPWVALKLFSVILMIVLVYSLLNTF
FT                   IESREKLIYVYPATLVIVYLINMKFIFSIVVFIMSDMFLNNFLNFM"
FT   gene            500889..501881
FT                   /locus_tag="CPR_0416"
FT   CDS_pept        500889..501881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0416"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85374"
FT                   /db_xref="GOA:Q0SVV5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV5"
FT                   /protein_id="ABG85374.1"
FT                   /translation="MKVTIKDVAREANVAPSTVSRVLSDSHKISEETKIKVNKAIKKLN
FT                   YKPNAIARSLVNNKTKILGVVLPNEADDSFKNPFFVEAMRGMSMSAEENEYYIMYAFSK
FT                   NDEDELKTIKEFSSNNLLEGLCLLSVREEDKTIKYLKDINFPFVVIGRPDEEDVLWVDN
FT                   DNFQAMFKLVDKFIKDGQSDIAFIGGKKSWNVSKDRLSGFKGAFKANNLNYDKTIVIEG
FT                   IDFSEECGYLAMREIISKKNPKIVVTTDDLLALGATKFLNEEGIEGVKIVGFNNTPMTK
FT                   YQNPPISSIDINARELGYEATNLLIDYLNGNLVGRKKYCIVDTQFINRG"
FT   gene            502193..503857
FT                   /locus_tag="CPR_0417"
FT   CDS_pept        502193..503857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0417"
FT                   /product="putative oligo-1,6-glucosidase"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87811"
FT                   /db_xref="GOA:Q0SVV4"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV4"
FT                   /protein_id="ABG87811.1"
FT                   /translation="MNKKWWKELIAYQIYPKSFMDSNGDGIGDIQGIISKLDYLKDLGI
FT                   DLIWLCPMYKSPNHDNGYDISDYKDILDEFGTMDDFNELLNEVHNRGMKLIIDLVINHT
FT                   SHEHPWFIESRSSRDNPKRDWYIWREGKGYEEPNNWESIFKGSAWEFCENSEEYYLHLF
FT                   AKEQPDLNWENKEVRRELYNMINWWLDKGIDGFRVDAISHIKKEEGLKDMDNPEGLKYV
FT                   SSFEKHMNVEGINSHLKELKEETFSKYDIVTVGEANGVSANEADHWVAEDEGTFNMIFQ
FT                   FEHLNLWNYEEGQGFDVKAYKDVLTNWQNSLEGKGWNALFIENHDIPRVVSTWGNDKEY
FT                   LTECAKAFGAIYFLQKGTPFIYQGQELGMTNVKYHSICEYDDVKTINTYNERIESGVSE
FT                   EIALKEAWVTSRDNSRTPMQWNSSKNAGFTCGKPWIGVNENYKTINVEVEERDENSVLN
FT                   FYKKLIKLKKSNEALIYGVYDLILEEDENIFAYTRTLNNDKFLIMANLTGENAKYVYEK
FT                   EKLNSKDLILNNYEVCEHKNLTEFILKPYECRVYKLS"
FT   gene            504021..505676
FT                   /locus_tag="CPR_0418"
FT   CDS_pept        504021..505676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0418"
FT                   /product="PTS system, IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87099"
FT                   /db_xref="GOA:Q0SVV3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV3"
FT                   /protein_id="ABG87099.1"
FT                   /translation="MKKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYIDV
FT                   DFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGVIF
FT                   SVSNAMLASDSTATVQSFTGQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALYNKY
FT                   YNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATSKDTA
FT                   PIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGGVYHILTGPTAGQVVAGQDPLWLAW
FT                   ITDLNNFKQAGDITSYNQLIGSVVPARFKAGQVILSSASLIGVALAMYKNVDPDKKKKY
FT                   KSVFFSAAIAVFLTGVTEPIEFMFMFISPILYVVYAVIAGLGFAIADIINLRVHAFGFI
FT                   ELVTRSPLMINAGLTKDLINFIIVAVVFFFLNYFVFSFLIKKFKIATPGRMGNYIDNED
FT                   ENANKASSNSKASMDELAVKAIELLGGKENIVDVDACMTRLRVTVKEIEKVGDEKAWKD
FT                   NKALGLIVKDKGVQAIYGPKADVLKSDIQDILGI"
FT   gene            505687..506478
FT                   /locus_tag="CPR_0419"
FT   CDS_pept        505687..506478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0419"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86424"
FT                   /db_xref="GOA:Q0SVV2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV2"
FT                   /protein_id="ABG86424.1"
FT                   /translation="MKLLTLNCHSWLEEEQLYKIKYLAKTIVEEKYDVIALQEASQSIK
FT                   ASIKEGNLKEDNYGLILIEEINKLGGEKYHLVWDYSHIGYDIYEEGLCILTKHKIVNSE
FT                   SFYISKSHCKTFWRSRKIVKATIDINNENIDFYSCHMGWWHDKEESFTFQVENLLAHAK
FT                   ESKNRAFFMGDFNNNAFLKNEGYDFLKSNGLIDTYDLAENKDSGVTVNKNIAGWEDNTG
FT                   ELRIDIIFTNRNTKVYDSRVIFNGKNKEVVSDHFGLEIETT"
FT   gene            506819..507562
FT                   /gene="glpQ"
FT                   /locus_tag="CPR_0420"
FT   CDS_pept        506819..507562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="CPR_0420"
FT                   /product="glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="identified by similarity to SP:P37965; match to
FT                   protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85655"
FT                   /db_xref="GOA:Q0SVV1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV1"
FT                   /protein_id="ABG85655.1"
FT                   /translation="MKKILNVAHRGLSGLYPENTMIAFRKAIEVDCDGIEMDVHLTKDG
FT                   VPVVIHDEEVDRTTNGSGYVKDLTYEQLCNLDAGIKFSDEFKGEKIPTLKEFFDFMKDN
FT                   DKLINIELKNSIIHYEGLEEKVYKEIENYGFEDRVIISSFDHYSIRKCIRLNKNIKTGI
FT                   LYCDCIFEPHNYCKVVGSSALHPEFNSITEEIVKAAHEDFQQINVYTVNEKKDMEKMID
FT                   LKVDMIITNYPNILKEVLENKYNKV"
FT   gene            507618..510230
FT                   /locus_tag="CPR_0421"
FT   CDS_pept        507618..510230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0421"
FT                   /product="helicase/exonuclease"
FT                   /note="identified by similarity to SP:P56255; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   PF00929; match to protein family HMM TIGR00573"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85682"
FT                   /db_xref="GOA:Q0SVV0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVV0"
FT                   /protein_id="ABG85682.1"
FT                   /translation="MINLNEEQQKVVNEQKNNIILLASAGTGKTNTLAKRVTSIIKNGN
FT                   SKPSEILCITFTNKACKEMSDRVMKIVGGEAKDITIRTFHSFCFDVVRTYAKRNTDIFS
FT                   DFTIFDEDDCREVISKLSYYYATSNLMATNMQIQRVIDFIKVERARIETLEDRVLDEYK
FT                   TVIDEIFKFREEKINGVCTNKGNLNLNLKNYIKFHGHELVTLYDSKLREDHALDFNDLI
FT                   ILTKELFKDEKVVRALKNKFKYINIDEVQDTSIIEYSIIEKLFEGNNVLICGDFFQTIY
FT                   SWRGSDPEMIFNKFKEKYNPVEIVFSKNYRATQNLNKASLEFLNNAFSSKVSTMYKDGI
FT                   LAESKEKGEKILLKETRGGREEARFIFDYANKLCEKGEDLKRVCVLTRDNNYNIGLSEE
FT                   LYQIGGYEGADFEFILVDQFKFFRRQEVKDILAFLKLIANRYDSLSLKRIVNRLPTGIG
FT                   MRTLEAIESYKYKEVGIRLADYIDPLVLEYGEKFSLLINEFEKENIIVFDVESTGVDVT
FT                   EDEIIQIAAIKLNKNVEVVDKFEKFLKNKKSVKDSYYVHGFSDEMLQRIGEEKEKVLKE
FT                   FVEYSKDSIIVGHNVQYDINILCSELERNNLGKPKFKTFYDTLDIYRRFYPGNINYKLE
FT                   NLSKVYDTKHKPSHDAMDDIIATGELLVRAINEKIKETSMERMALMSKHLKAFTAISKK
FT                   LNELFQIAERKRPYELVACVINGFNIKSMYAGDENKEKLNRLRDLYALFRDLDDKSKGN
FT                   RDALLDIIRITGLSNGELESLIINRTKKPRIPIITVHQAKGLEFDTVFLAGIQNNTFPS
FT                   YMAIKEGNLAEEKRVFYVAITRAKKRLVITYNSQGKYGHRNEISQFINYIPKEFFKII"
FT   gene            510406..511065
FT                   /gene="trmB"
FT                   /locus_tag="CPR_0422"
FT   CDS_pept        510406..511065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="CPR_0422"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86310"
FT                   /db_xref="GOA:Q0SVU9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVU9"
FT                   /protein_id="ABG86310.1"
FT                   /translation="MRMRRKPWARPELEACDFFVANPKENKGNWKNTFKNTENPIYLEL
FT                   GCGKGTFMAVHGSDHPNINYIAIDIKDEVLVLAKRNIEKAYEEKNKALDNVKLMPQEIA
FT                   LIDTILDSNDKIERIYINFCNPWPKDRHKKRRLTHPRQLTKYRDFLVDGGEIHFKTDDD
FT                   ELFEESLEYFKECNFEITYITRDLHNSGYEYNVVTEHEEMFSKQGIKIKFLIAKKL"
FT   gene            511510..512793
FT                   /locus_tag="CPR_0423"
FT   CDS_pept        511510..512793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AG1527; match to
FT                   protein family HMM PF06824"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85786"
FT                   /db_xref="GOA:Q0SVU8"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU8"
FT                   /protein_id="ABG85786.1"
FT                   /translation="MSLSTNELKEIVRKIGKDLSAKIEDKKLQELFYNCFINTMDTTVE
FT                   VSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYA
FT                   NAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDDIKK
FT                   AFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDA
FT                   CEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADGLREEIDNAIEKHGKVYKEGF
FT                   GEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEG
FT                   KAAKGIGSPHTPDQYIWHIALSIQGLTTNNQEEIEELIKLLKETDAGTGYMHEGFHVDD
FT                   PTKFTRDWFAWSNSLFSHFIYEKVINKK"
FT   gene            513258..513836
FT                   /locus_tag="CPR_0424"
FT   CDS_pept        513258..513836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0424"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86361"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU7"
FT                   /protein_id="ABG86361.1"
FT                   /translation="MKKVSLILINIILVCNLIACGAQVNEIAINFIDNEIEVEENEKRD
FT                   ITIQSKDKHKQFRNSNTKIKKEALKTYFYNDKTLKDFEVPKKTIEEYENWFINMARDRG
FT                   ESAKDISDAFRSVDMLIGEDVVKFPVIIDTVNFNDKEAYAIAYLCEEGENLDMEAQETM
FT                   ELKRFDEVLIIGVYKDSSDIFYKDKYSLK"
FT   gene            514065..514220
FT                   /locus_tag="CPR_0425"
FT   CDS_pept        514065..514220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87238"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU6"
FT                   /protein_id="ABG87238.1"
FT                   /translation="MPKDSQPDNKVARMEKCNFQTPITSEEGKNHNRTAKKHSVKREGF
FT                   QSPHIN"
FT   gene            514615..515142
FT                   /locus_tag="CPR_0426"
FT   CDS_pept        514615..515142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87791"
FT                   /db_xref="GOA:Q0SVU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU5"
FT                   /protein_id="ABG87791.1"
FT                   /translation="MVNEKFGILAKIFLLILILVPITFRVYDLYYLNSSWDINSKVVKR
FT                   GKVYRDYIKEKKLTGVPNIYYKYNSLTPEEMMTLDVLANTKGYNIEEVLPEVEKYVLSK
FT                   NNEKNGAKLNEYEKIELNKCVKKIKDGVNENLEKNSSYIYWMKMLMSVFTALMIVLSIY
FT                   AIYMTNVFINEK"
FT   gene            complement(515230..515772)
FT                   /gene="lepB"
FT                   /locus_tag="CPR_0427"
FT   CDS_pept        complement(515230..515772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="CPR_0427"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85441"
FT                   /db_xref="GOA:Q0SVU4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU4"
FT                   /protein_id="ABG85441.1"
FT                   /translation="MNLLSESNISTLNKKSHLKIKNLILFSVIVFLCSYFLTNYLIFKA
FT                   YIPTGSMRPTIMEEDEVIVSKIYTSINRGDIFVFSHESSEELLIKRVVGLPGEKVEVKD
FT                   GLLYVNDVFIDEPYVKNNESMNKTFYVPEGNYLFFGDNRAISEDARRWENPYVPKKNLD
FT                   GKALFTVYPRDRIGLLK"
FT   gene            515971..516813
FT                   /locus_tag="CPR_0428"
FT   CDS_pept        515971..516813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:D97241"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86021"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU3"
FT                   /protein_id="ABG86021.1"
FT                   /translation="MNEISDLAKITSILGIAATTYLVYENNSIFINEYELFTRKTPNSF
FT                   RGFKILHLNNLYGKTFGSENYRLIEKINSLKPDIIVTTGNMLTSSLDKDFVFLELCKNL
FT                   RSFYPIYYSVEGCKNLSGKKYEKYRDYLKGLMDIGVILLNNSKVSLIKKEDKLNIYGLY
FT                   IEDEIKSFSFKEGFKKENIFSKKDVVNKLGKPNKSEFNIVLANDVINFEAYVKWGSDIT
FT                   FSGYTRAINRYIFNNLMERKKGIFIEKDSSMILSRGLGNDFLKMRIMNRPEITLITIR"
FT   gene            517425..518264
FT                   /locus_tag="CPR_0429"
FT   CDS_pept        517425..518264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0429"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86897"
FT                   /db_xref="GOA:Q0SVU2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU2"
FT                   /protein_id="ABG86897.1"
FT                   /translation="MLYYKVVNNKYLHKDKEWIMMLHGIGGNLNIFKKQIDVLSENYNL
FT                   LLVDLHGHGNSQNYTLKNMKKTKGEISFKYICEDIVEILDKLNIEKVNVLGISLGTIVG
FT                   MQFEKYFPNRVSSMILGGGIVGMNLKSKFFLNLALVTKNIIPREMFYKIVAYMSMPCKN
FT                   HKLSRNIFLNAAEKLDKNECFRWVELMREHLENYKYVKNNVKKIFIMGDQDHVFLPTIK
FT                   KFVPEEDIVVIKNCGHICNIDSFKTFNHLTLNFLINNHGYMFGAKERRKYVYKYNFT"
FT   gene            518721..519200
FT                   /locus_tag="CPR_0430"
FT   CDS_pept        518721..519200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0430"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85771"
FT                   /db_xref="GOA:Q0SVU1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU1"
FT                   /protein_id="ABG85771.1"
FT                   /translation="MESQENSKKSSVAKNKLEKIYSTFLHDGYRFTEFRIGDENNWAYI
FT                   QYSAGVFEDYQLAIRRIFKEENSLKGNIKNRCVFLENKNGERIGTIMIVPSLSEEDGVQ
FT                   EIKYLALLPKYQDKGLGKLLISKAYKMVDDIEGATRINLEAYNDKSIVLFENLEF"
FT   gene            complement(519269..519604)
FT                   /locus_tag="CPR_0431"
FT   CDS_pept        complement(519269..519604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:G97099"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87379"
FT                   /db_xref="GOA:Q0SVU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVU0"
FT                   /protein_id="ABG87379.1"
FT                   /translation="MYIDLNFIYLLLALLGCIAIVYLILILNKVLKLVSNINSLLDQNK
FT                   DNLTKTIKDLPKIADNVNDACQNIKDISDVATETTADLIVAKENIESNVETVKEIAKII
FT                   NQVFFKK"
FT   gene            complement(519610..520026)
FT                   /locus_tag="CPR_0432"
FT   CDS_pept        complement(519610..520026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="BH3244"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86679"
FT                   /db_xref="GOA:Q0SVT9"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT9"
FT                   /protein_id="ABG86679.1"
FT                   /translation="MSLAKLIDEKRKAKARAERNKKAKVAVTGAAVGTLAGVLGGLLLA
FT                   PKSGKETRNDIKEGSKKAAQKLNDKSVELKENLNTQVAKGKENISDAKSKIKEYLNSKK
FT                   CKNIEEAVEENLNVPVEVADEATSLETEEVKESN"
FT   gene            520567..521904
FT                   /locus_tag="CPR_0433"
FT   CDS_pept        520567..521904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0433"
FT                   /product="CBS/transporter associated domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86140"
FT                   /db_xref="GOA:Q0SVT8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT8"
FT                   /protein_id="ABG86140.1"
FT                   /translation="MDPSPSILPKIILILVLILINAFFAAAEMAMVSVNKSKIKMLAEK
FT                   GNKKALLLKKVLKSPGNFLSTIQIGITFAGFFASASAATSISETLAQFMYKLNIPYGNE
FT                   ISVILITVLLSYITLVFGELLPKRIALQKPEEIALMAIRPINVISKISTPFVKILSAST
FT                   NLFIKILGLNKSEDKETVSKDEIKSMISIGQESGVIDKAEKDMLDNIFEFDHKVVKEVM
FT                   TPRGEVFAIKSTTPNETIAKKLISEQFSRVPVYSETRDNIVGILYLKDFFEAVVKVGVD
FT                   NIKLDQLIRPAYFVIENKAIDDLFKELQDSKQHMAVIIDEYGGFSGIVTIEDLIEEVMG
FT                   DILDEYDDSENYIDKIDNNTYVVDGLLTLDKLNDYLNLNLESQNIETIGGFVVNLIGNI
FT                   PQSENQMVEYDNLSFQVCKTNKKRIEKLKIYLNNSTSFNSDVILNN"
FT   gene            522152..522811
FT                   /locus_tag="CPR_0434"
FT   CDS_pept        522152..522811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0434"
FT                   /product="putative sulfite/nitrite reductase"
FT                   /note="identified by match to protein family HMM PF01077;
FT                   match to protein family HMM PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85735"
FT                   /db_xref="GOA:Q0SVT7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017220"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT7"
FT                   /protein_id="ABG85735.1"
FT                   /translation="MVSGTHYGNLQKVRGGKRTFGITPHIPGGFITPEQLEKIAKVTKK
FT                   YNGVIKITSGQRLLITNLKGEDLPKIWDELGMEPAVKKQNSVKNVEMCPAGFCKRSKFN
FT                   TIGTGMKLLNKYKHMDMPCRTKIGVAGCRNACGSVYSKDVGVIADKTGFLVTAGGSAGH
FT                   NPRMADILIKDVDEKEALRIVDKIFEVYKGEAEAGEKLGDFIDRIGIEVFKEKTLA"
FT   gene            523001..523174
FT                   /locus_tag="CPR_0435"
FT   CDS_pept        523001..523174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0435"
FT                   /product="BFD-like iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87152"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT6"
FT                   /protein_id="ABG87152.1"
FT                   /translation="MSNVCLCKGVSEEKIVEAVKNGALSFEEVGEKTGAGTGACCGARC
FT                   KCKIEELIEENK"
FT   gene            523441..523812
FT                   /locus_tag="CPR_0436"
FT   CDS_pept        523441..523812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0436"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86578"
FT                   /db_xref="GOA:Q0SVT5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT5"
FT                   /protein_id="ABG86578.1"
FT                   /translation="MNIVVSNTSGVPIYEQIAKAIKNEILSGDLKENSALPSIRSLASE
FT                   LRVSVITTKRAYEELERDGFIYTLPGKGSYVAEQNKELLMEEKLREIEEKLGEAIDIAN
FT                   SIGLNFNDLVGMLKTLKEL"
FT   gene            523846..524709
FT                   /locus_tag="CPR_0437"
FT   CDS_pept        523846..524709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0437"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87271"
FT                   /db_xref="GOA:Q0SVT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT4"
FT                   /protein_id="ABG87271.1"
FT                   /translation="MENVLEIKNISKNYKGFSLKDVSFNIPKGFVMGLIGPNGAGKTTT
FT                   IKAIMNLINLDSGEIYIFGEDIKKNEISIKDRIGFVYDDCCAFEDFTIKENKKIISKFY
FT                   SKWDEEKFKYYVEKFELNENKKLKQLSKGQKMRFSLALALSHKAELLILDEPTSGLDPV
FT                   FRSELLDILFEIIGEEEVSILYSTHITTDLEKLADYITFLNKGKVEFSLEKDLLLEEYF
FT                   LVKGPLDILNKDLEKELIGLRKTRYNFEGLTNNMRNLKELFGEKIIFEKATLDDIVVYY
FT                   SKKDVK"
FT   gene            524711..525334
FT                   /locus_tag="CPR_0438"
FT   CDS_pept        524711..525334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0438"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86695"
FT                   /db_xref="GOA:Q0SVT3"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT3"
FT                   /protein_id="ABG86695.1"
FT                   /translation="MKELIKLDFFIQKKYIKSLLIMFLFLIVIFSVNGKIENSLYSLGL
FT                   FVVFYLVIVPIELEKRNKFNLCLNSIPIRKRDYIMAKYISSILYLVIVNILITLICLII
FT                   SLILRNTNEINFSMVLMFVAFESMYVAVIQPLYIFMNYKYYRIINIITVIISITLGEAL
FT                   FNILKKGIELTNNNISVILLILGIISIIISFFITLFFYKRSEVK"
FT   gene            525336..526025
FT                   /locus_tag="CPR_0439"
FT   CDS_pept        525336..526025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0439"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86756"
FT                   /db_xref="GOA:Q0SVT2"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT2"
FT                   /protein_id="ABG86756.1"
FT                   /translation="MKNLIIKDLKGAKWTLIAYSILLCFIYLPLLNKNAPIVKDYKENV
FT                   FDFFTNLNLFYFSSLFLMIAINFIIIRNTNKKSNTNKLLRSLPIMTKSIIGSVFIEPIL
FT                   LFLIFILVGLGINTIFSLFIGTHTKISLGILIIIFIMFYIYASTMLALALVYPESSVVS
FT                   YLRSVPMFLLIIIVALFDRLIKNLNINIDIFDRYIPLAIGILFIIGILITIFMYKFSIN
FT                   KFLAKDL"
FT   gene            526263..526643
FT                   /gene="gloA"
FT                   /locus_tag="CPR_0440"
FT   CDS_pept        526263..526643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="CPR_0440"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="identified by similarity to SP:O33393; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86193"
FT                   /db_xref="GOA:Q0SVT1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT1"
FT                   /protein_id="ABG86193.1"
FT                   /translation="MASKMLHTCIRVKDLDKSLKFYKEALGLVETRRRDYPEYKFSLVY
FT                   LSDKEDGYEVELTYNYDQEKPYDLGNGFSHIAVGVEDIEAERERHISLGYEVTPMKGLS
FT                   DGAATYYFVTDPDGYKVEVIKL"
FT   gene            complement(526779..527345)
FT                   /locus_tag="CPR_0441"
FT   CDS_pept        complement(526779..527345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0441"
FT                   /product="transcriptional regulator, araC family domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85626"
FT                   /db_xref="GOA:Q0SVT0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVT0"
FT                   /protein_id="ABG85626.1"
FT                   /translation="MDRFDRQLELADGIETEYLRILYYTFEKNYKDTYKSYEYKRLCTI
FT                   VDGEKNVRINNGKNIIYDSSKYMLLPPNSSVEMKIEKPTKALVLELNEDLINTVSEIAY
FT                   DLNMSLPSFSSKFKKIMGMTPNDYLTNLKLNEAARLLKFSSVTEVAYDLGYENISHFIK
FT                   LFKKKFGLTPKQYSLKYSGEVIKIQ"
FT   gene            527534..528682
FT                   /locus_tag="CPR_0442"
FT   CDS_pept        527534..528682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0442"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87625"
FT                   /db_xref="GOA:Q0SVS9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS9"
FT                   /protein_id="ABG87625.1"
FT                   /translation="MSYKFFMPAISLMGADCLKDAGDQLGELGFKKALIVTDKVLGQIG
FT                   IVKKVTDVLDNKNIEYAIYDETKPNPTVKNVNDGLALLKEKECDFVISLGGGSAHDCAK
FT                   GIALLATNGGEIKDYEGVDKSKKPQLPMVGINTTAGTGSEMTLFAIITDEERHIKMALV
FT                   DKHLTPIIAVNDPMLMLAMPKSLTAATGMDALTHAIEAYVSTAATPITDACAEKAIELI
FT                   SNYLVNAVENGQDVEARDMMAYAEYLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNA
FT                   ILLPHVQEYNKSTSASRLAKIAKIMGGNIEGLTDEQGADLCIDMIKSLSQTIGIPEGLG
FT                   VLGVKESDFETLATNALNDACSLTNPRKGNLEEVIAIFKKAM"
FT   gene            528996..529319
FT                   /locus_tag="CPR_0443"
FT   CDS_pept        528996..529319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35553.1; match to
FT                   protein family HMM PF08821"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86303"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS8"
FT                   /protein_id="ABG86303.1"
FT                   /translation="MSIAIMACRKVIGKCAASGCFKAYNNSTAAFSIYGENKEDLASFF
FT                   YCAGCKDTLVEGENWTHKVKQLKKNGVETIHISHCIESKCDDLKKYEKILEKEGFKIVH
FT                   GTH"
FT   gene            529431..529829
FT                   /locus_tag="CPR_0444"
FT   CDS_pept        529431..529829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0444"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85731"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS7"
FT                   /protein_id="ABG85731.1"
FT                   /translation="MNLKKIHHVAIIASDYKKSKDFYVNLLGLKIIREVYREERDSYKL
FT                   DLEIGDSQIELFSFKNPPKRPSYPEACGLRHLAFEVENIEEQVRELKDKGIKVEEIRID
FT                   EFTGRKFTFFSDPDDLPIELYERGCIKI"
FT   gene            complement(530074..530859)
FT                   /locus_tag="CPR_0445"
FT   CDS_pept        complement(530074..530859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0445"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87733"
FT                   /db_xref="GOA:Q0SVS6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS6"
FT                   /protein_id="ABG87733.1"
FT                   /translation="MDKYFSIGEVSKITGLSIDRLRNYDKIGLLKPSYIDPKSGYRYYS
FT                   ENKFRKLRIIKYLRKIGTPLKEIDLILNKNIDSQEFAKFLELKIRDIEKEIESLNMIKE
FT                   DISEIKHTFECNFKLSNINYIHKKYIDERYVVKKSLNKNITFVVSHREQVFSKFKSEIN
FT                   TLEPPRSLEKGLYLHSLEDLENNNTEVYMLLKDYENIHNFIIPSGNYLCLSYKENERDK
FT                   AIFKLKSYIEENHIKIKGPILNLVLTTLPKEEFQFQILI"
FT   gene            530972..532792
FT                   /locus_tag="CPR_0446"
FT   CDS_pept        530972..532792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0446"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87325"
FT                   /db_xref="GOA:Q0SVS5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS5"
FT                   /protein_id="ABG87325.1"
FT                   /translation="MTIKQMNIKRFKLPLIFAVLSVVLMGLYKTIFGVENTIIGLIIAM
FT                   ASYAFLRLDLTSYPIYKSIIFLILNLFLAISAYISAINPFVGLIINFLILFTVSFIYTT
FT                   EFKNVISYIFLLLYVYMLEYPISLDELPKRLVAMGVGVFIIIGIHILFNRRNFKKNSNN
FT                   IIIRSIRNIQKEICHIINESYRERENIYIDSELRKLLILIEGRNNNKFIENHKDDIYFN
FT                   IVLILERINSIINKVGKVNNKSKDVIDYLNSLNHDLENITLFLERKVECINEEKDDLNK
FT                   SYMINNWAEKEYAFLGECTELIRLLEKNINNLYKYNRKKSRKRIKLKFNLKELLIGNSS
FT                   LKMKNLRVAYSLKLAIAVSLIMFIVDLFKIHQGRWIVTSVYVVIQPYEEETLTKAIKRF
FT                   KGTIIGVIIYISIFTFFPHIIPLELLLLILMFLYFVQKDYEKKVVCTALMALSFGLSRS
FT                   TVGYLAFYRFFFVIIGIVIALGVNKLIFPQSIKNSIYDLKERYLELTSKLLCELKSILY
FT                   EEGYNGNTVKLLLDCNLIESKLIENKLIAENLELKDLVDKQSIILSKIRCLVLFINYSN
FT                   WGISSKHINVDKNLLNVIFNKIEEELREIY"
FT   gene            533095..533604
FT                   /locus_tag="CPR_0447"
FT   CDS_pept        533095..533604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0447"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86020"
FT                   /db_xref="GOA:Q0SVS4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS4"
FT                   /protein_id="ABG86020.1"
FT                   /translation="MDFGTITNYFAEYGLLFLFVIILLEYMNLPGLPAGIIMPAVGVLV
FT                   SRSEMSLITALLVSVIAGLIGSWILYCIGRFGGELILQKYLNKFPSHESFVNRKIDYLR
FT                   EKGYTGILISKLIPMARTVISIPAGVLKLNFLKYSAYATLGIFIWNTVLISSGYFLGEE
FT                   LLKFLG"
FT   gene            533921..534625
FT                   /locus_tag="CPR_0448"
FT   CDS_pept        533921..534625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0448"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87570"
FT                   /db_xref="GOA:Q0SVS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS3"
FT                   /protein_id="ABG87570.1"
FT                   /translation="MEKYNVLVVEDEKEIAEAIEIYLKNQGYNVFKGSNGLEGLEIVEK
FT                   EEIHLAVVDIMMPKMDGATMVMKIRERYDFPIIMLSAKSEDMDKILGLNIGADDYVTKP
FT                   FNPLELLARVNSQLRRYSKYLSMVKKDEKKTNSYAIGGLEVNSDRKEVILDGDVVKVTP
FT                   IEFKILQLLIKSPGRVFSAEEIYERVWNENAVNTDTVMVHVRNIREKIEIDPKNPKYLK
FT                   VVWGVGYKIEKQ"
FT   gene            534600..536831
FT                   /locus_tag="CPR_0449"
FT   CDS_pept        534600..536831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0449"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87002"
FT                   /db_xref="GOA:Q0SVS2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS2"
FT                   /protein_id="ABG87002.1"
FT                   /translation="MAIKSKSNKENLQVNKENRTNKTKWIFTIITLILIGIISVCLLLS
FT                   YPIIKKNTPNYITSYGLFNNYNFREKIIDTNYGIYYDYLEKKAEENEKEMNPMEDLFTL
FT                   KSENRYEDKESYEYSLKEDTRLLNERVKSLINGLHDLGNLRVYAMDEEGNTVYETKGDQ
FT                   NWLLEALAKGSYIENGDLENYYRFYMVLKYNNRGKVSLEKIYGEDSHRVSNLLLDMDSQ
FT                   YFAYHNEYEAKPIENMTYVYAVPKTLEYQDNLYYSEMDNKIMALGSASAPFIMIGIIVT
FT                   CLLALLIPFKYTREVLGFNKFLKIPFEINFIIASIMLAFTIESGSLIISPTLQGGLSEA
FT                   LKMTSLPHLDIVTNIINVLYWMVIYGFVFFEVIYVKYIFNIGFKNYIRKHLLVYKLKDI
FT                   IFVILRKLINYIKGIDLNKNSDKVLLIILGINFVIVSILCSVWFFGIFGVVIYSGVLFY
FT                   FGRKYIDKWKKDYNKILEKTKEISNGNLDSKDDEDCGFFNPMRDELNNIQKGFKAAVEE
FT                   EVKSQRMKTELISNVSHDLKTPLTSIIAYVDLLKGEEDEEKRKAYLETLERKSQRLKDL
FT                   IEDLFEVSKATTGNINLNIMDVDISYLMKQVVLELDDKINEAGLDIRLSLPEEKVILPL
FT                   DGQRTYRVFENLIINVVKYALPNSRVYIDIKEGRENVDVTIKNISADEITFNINEISDR
FT                   FVRGDKSRNTEGSGLGLAIVKSFVELQGGKFHIEVDGDLFKAIISFKKN"
FT   gene            537134..538171
FT                   /locus_tag="CPR_0450"
FT   CDS_pept        537134..538171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0450"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85436"
FT                   /db_xref="GOA:Q0SVS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS1"
FT                   /protein_id="ABG85436.1"
FT                   /translation="MIESIKKNLKPKILISNLILIIGIVIFVTLYGAAFGGNNSLIGVC
FT                   AITAMLMFVDVHLSLKLNEAIITTVLSFVLMGVSSQIASINPFLGFVINFISIFVVSYL
FT                   VTNVTETKAYLPFILCYVFVEGTPITWSELPRRLIALFVGGALISLVYYFSHRKKDDSD
FT                   HMNISEMIKAMNKDTLQFNFSLRMALAVSIAMLLGSIFGFQKSMWISITAMSITQPHFD
FT                   DTKTRVKERFFGTLIGAAIFVLIFVYLVPQQFSSIVLLILSYIYTFIKEYKIKMIFITM
FT                   SSLGAAMILFQPGVSIPMRIAFIVVGIVIALVVNKVIYGRLKLEKSNEELDETIKDIDK
FT                   VNDEF"
FT   gene            538889..539302
FT                   /locus_tag="CPR_0451"
FT   CDS_pept        538889..539302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVS0"
FT                   /protein_id="ABG85982.1"
FT                   /translation="MSLCKGTVKIGKKNLKRGTNKYFFKRYLKKNYEFTVSEFKDRNKF
FT                   ELLEPVNVEGLDFLVDVEFRGIRPKEIDLRSIDNLEKYQFERYEQWVSNNLGISLENSK
FT                   WKNKEFNWGNLNVKLSKTVKEDLGCITIKVVYK"
FT   gene            539783..540481
FT                   /locus_tag="CPR_0452"
FT   CDS_pept        539783..540481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0452"
FT                   /product="capsule chain length determinant protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87233"
FT                   /db_xref="GOA:Q0SVR9"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR9"
FT                   /protein_id="ABG87233.1"
FT                   /translation="MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQY
FT                   EAKTKLFIGKQETSQNAANYDNNDIMMYQKLMKTYAELAKTSDLVTKAVKNAKLDYNQN
FT                   EIKGVLNNLNVTPSADTQILDLSFKGKNPKEVLKVTEAITDEFISESKELIPNGNVQVI
FT                   QKPQLPENPVSPNKKLNILIAFVLGLMIGVGIVLLLEYLDNTFKSREELEKTLDLPIIG
FT                   AIPDYDSIEK"
FT   gene            540495..541148
FT                   /locus_tag="CPR_0453"
FT   CDS_pept        540495..541148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0453"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM TIGR01007"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87749"
FT                   /db_xref="GOA:Q0SVR8"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR8"
FT                   /protein_id="ABG87749.1"
FT                   /translation="MLILEKNPKSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEG
FT                   KSTTSANLALSFAQDGKKVILIDCDLRKPVVHKEFQISNSRGLSEFLIGNVEFSKVVYK
FT                   HESGLHVLPSGLVPPNPAEMLASRSMEHLLTQLEEKYDYIILDTPPVNAVTDSKILSTK
FT                   VDGTILVVKYGYTKKDGVIEAVKGLRAVKANIIGTVFNGEENQRGKYYHYYKKD"
FT   gene            541348..542016
FT                   /locus_tag="CPR_0454"
FT   CDS_pept        541348..542016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0454"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86814"
FT                   /db_xref="GOA:Q0SVR7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR7"
FT                   /protein_id="ABG86814.1"
FT                   /translation="MYESMEKIQEGKEYIKVDQGNRVYLFFKRVMDILGSGFGLITLSP
FT                   LFLIVAIAIKFEDSKGSVLFSQKRVGQYGKEFNMYKFRSMVSNAEELKAKLMEQNEMSG
FT                   PMFKMKHDPRITKVGKFIRKTSIDELPQLINILKGEMSLVGPRPSLPKEVAKFEPWMLE
FT                   RLEVKPGLTCYWQVMGRNDIDFEDWMKLDIKYVHDRNLFLDIKLIFKTFFVLFGDESAS
FT                   "
FT   gene            542031..542165
FT                   /locus_tag="CPR_0455"
FT   CDS_pept        542031..542165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR6"
FT                   /protein_id="ABG85732.1"
FT                   /translation="MEKIKFISIFSTRQENTKKIKTSNIYGCVKVYLRIIDAKVESLN"
FT   gene            542179..543408
FT                   /locus_tag="CPR_0456"
FT   CDS_pept        542179..543408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0456"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85427"
FT                   /db_xref="GOA:Q0SVR5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR5"
FT                   /protein_id="ABG85427.1"
FT                   /translation="MKKLNVIGLGYIGLPTALSFAGVGIAVIGTDYNKEIVDTLNNGKV
FT                   TFKEDGLYDLYKEALNKGVEFSSEYAKTNKYIITVPTPYIKESKKLDAQYVISAVESVL
FT                   DVCDKGTILVIESTVSPGTMDKFVRPIVENRGFKIGEDIHLVHAPERIIPGNMVNELKN
FT                   NSRTIGADNIEIGYEVKRWYETFCEGEIVVTDIKTAELSKVVENTFRDINIAFANELSR
FT                   ICRKENIDVYKLINIANKHPRVNILTPGPGVGGHCISVDPWFLVGDYPEIVNIIKAARE
FT                   VNDSQPDFVIDRIRDVMNENGITDISKVGLYGLTYKENVDDLRESPTLQILEKLERYFV
FT                   KGIKLYDPWIEEKKFENQYNNFNEFLDDVELVVLLVAHDHIKEFKDMLNEKIVLDTKNI
FT                   LKLSKNIYTL"
FT   gene            543421..543846
FT                   /locus_tag="CPR_0457"
FT   CDS_pept        543421..543846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0457"
FT                   /product="putative Bacterial transferase hexapeptide"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85962"
FT                   /db_xref="GOA:Q0SVR4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR4"
FT                   /protein_id="ABG85962.1"
FT                   /translation="MLNAISIWRVSNWFYKRNIKILAKILKFIIFLLYNSSIPYECHIG
FT                   KGTKLGYSGIAVVIHKKAIIGENCMIAQCVTIGGQGGGKEGVPKIGNNVYIGAGAKVLG
FT                   DIKIGDNVIIGANSVVTKSFGDNVIIAGIPAKIIRKN"
FT   gene            543856..544596
FT                   /locus_tag="CPR_0458"
FT   CDS_pept        543856..544596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0458"
FT                   /product="putative
FT                   beta-1,4-N-acetyl-mannosaminyltransferase"
FT                   /note="identified by match to protein family HMM PF03808;
FT                   match to protein family HMM TIGR00696"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87820"
FT                   /db_xref="GOA:Q0SVR3"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR3"
FT                   /protein_id="ABG87820.1"
FT                   /translation="MKRIKFLNTYVNPITMEETLDYIVDSIENKRCIQHVVINAGKVNL
FT                   MNKNLELTKIVNECPIINADGQSIVWGGRFLGYDIPERVTGIDIFENLVKISAEKGYKP
FT                   YFFGAKQEIVEKVVLNFKERYPNLNVAGYRNGYFSENESDEIANKIRESGADLLFVAFS
FT                   SPMKEFWIKDNIEKMKVPFCMGVGGSFDVISGKTKRAPKFMQKLGLEWFYRFIQEPRRM
FT                   FKRYIVGNINFLVILLKYKFKRIE"
FT   gene            544598..545650
FT                   /locus_tag="CPR_0459"
FT   CDS_pept        544598..545650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0459"
FT                   /product="putative glycosytransferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85816"
FT                   /db_xref="GOA:Q0SVR2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR2"
FT                   /protein_id="ABG85816.1"
FT                   /translation="MVRVLMIGPNKLENGGISSVVNSYYDVGLDKDKNLQLTYLDTFKS
FT                   GSLLKKISVFLKSIILFRNNIKENDIVHIHMSYRGSFYRKSIFVLMSKYKNKKVIIHIH
FT                   GSEFKKFYDKSNNFIKKYIENTLNKADYVLALSEEWRENLISIAPKSRVEILHNSIIVP
FT                   KYDYKNYKFKNILFLGRLGKRKGVYDILKVANSISSKFPDCKFILAGDGEIENVKKICN
FT                   DLSINNIIIPGWISGYDKVNLLKEATIYILPSYNEGMPISILEAMAYKLPIISTKIGGI
FT                   PQLIDNGVEGFLVDAGDILGLENSINKLLESEELRKNMGENSFKKVEKDFNLVKNIEKL
FT                   KSIYKSLIEE"
FT   gene            545657..547540
FT                   /locus_tag="CPR_0460"
FT   CDS_pept        545657..547540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0460"
FT                   /product="heparinase II/III-like protein"
FT                   /note="identified by match to protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85999"
FT                   /db_xref="GOA:Q0SVR1"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR1"
FT                   /protein_id="ABG85999.1"
FT                   /translation="MDIKWLFNRFRKMSLKEIKYRLKVKRFDGKIKKGYTISIKDRNMN
FT                   FFHINKACFCEKTKKDIKKYAEEILSGNYDIFNEKVNLNNENLFFLDQINNFKWDNNKY
FT                   SDINIINKVGDAKIILEINKQQYLLDLALAYIVTNESKYYYKVVDEILRWINDCNNYIG
FT                   PGWKSGLEIGLRCLSWMYSLSIINCENELKYEEKLKILDSLIEQADFVYNRLSLFSSAN
FT                   NHLVGEAAFLLHVSFFVNCNRSDKWRIRAIKILNEQINNQFFDDGVNKEQSINYQLHTM
FT                   ELYFLSQNLLNINDMSLDNKCLEILKNSCRYILCISEKDGSYFNIGDEDGGEILRFRVE
FT                   DNKVNSLLSCAEDVLNVSIDRKLYSNVKDKLIYKVNELEKFEVISENNTNIFRNGGMLV
FT                   KNLYFNNKKYKISFDFGECGLSPLYAHAHSDLFSFNLNINGKPIFIDCGTYKYHNSNGL
FT                   RDYFRSSIAHNTISINEKDHIEFLGNFMCNKSPKCLILDINKNMISCFSDSYKNIKCGI
FT                   FRTLEFNNTHLLIKDRVENNSNKDVELKQYFNLDSTCRIHLQDNKSFNINNQIKLILGN
FT                   IDSFEVVNGDSNLNIGLQSPRYNILCNTNIIITKTKVEKNSTKNIVTKLML"
FT   gene            547553..548392
FT                   /locus_tag="CPR_0461"
FT   CDS_pept        547553..548392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0461"
FT                   /product="glycosyl transferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85447"
FT                   /db_xref="GOA:Q0SVR0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVR0"
FT                   /protein_id="ABG85447.1"
FT                   /translation="MKISLIVTTCDNLCVFRRLLDSIKYSNFKLHQLIVIDQSENLETK
FT                   DLVEKYKDYINIIYIYIGKRISLSKARNIGIKYSSGDILGFPDDDCWYEEDFFYNISNI
FT                   FENNNYDMILTSVFDPLRNKIYGNKQSSKEIEVIKKNNIIKYSTSVGIFIRVNNEFEKF
FT                   DEQLGVGAKWFGGEDIDYVARYIWKNKKVVFINSLKVYHEVDLNRDNEKEYRYSVGFGA
FT                   VSKKMIYNYNMKNFKKDIFWRQTKSFIGMCIFKFLNHKKYKKYISKFKGVKDGLKYR"
FT   gene            548373..549548
FT                   /locus_tag="CPR_0462"
FT   CDS_pept        548373..549548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0462"
FT                   /product="putative polysaccharide polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86494"
FT                   /db_xref="GOA:Q0SVQ9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ9"
FT                   /protein_id="ABG86494.1"
FT                   /translation="MVLNIDKFINKLILIYPLIVLICEIINKNFGIDLLMKFTFIIFLL
FT                   ILLKFKDIKMKFLIFIILSINTLQFIMGYKFFDYNILIRFLIFLTFLGFFSNKKNICIF
FT                   KHYIDLNKNILINIFKACSIIIFIYLFLNQGYVNKWGGNNYFIGPFSSPHKMGYYLLGL
FT                   QAMDIFIDKNFRKKSNLFYQSIFVILQMLTGARIPLLVSVITVLLALKKYIKTRARFII
FT                   ILIFLLIITLIIVFEKDIIKDIPFIQKFIYTEGKDSLSSGRDLIWKANLNVYKDSALYI
FT                   KLLGNGMLYSFYANLLYLNNEIWSHNDFIQILLGNGLIGLIIYCVMLLNLCRIYKSEIL
FT                   LIVLFILAFFNGLFTYYFFGVMIIYYLMAIYNFKGEYYENIKNNIKKNRDL"
FT   gene            549505..550239
FT                   /locus_tag="CPR_0463"
FT   CDS_pept        549505..550239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85335"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ8"
FT                   /protein_id="ABG85335.1"
FT                   /translation="MKILKTILKKIGIYKILLNIPYLKEKKRKYGLKINRDRKEAFDKF
FT                   AYDCLKKVKNTMDENDITFWLDFGTLLGAIRENDFIEHDLDLDFGIDFSSNPQFVKEVF
FT                   EKNGVSILKEFILDGQVVEQTYSYKGVTFDIFFYFRDKNNMWTYCFTKRDVKSKNITID
FT                   NIIYNIGFKSFKVVMKNRYTKKIIFKGESFDVPENTEEYLIENYGPNYMTPIKDWDFVN
FT                   SPSNMYEIENKYVIEVISSNFN"
FT   gene            550248..551708
FT                   /locus_tag="CPR_0464"
FT   CDS_pept        550248..551708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0464"
FT                   /product="putative polysaccharide transporter protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM PF01943; match to protein
FT                   family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87641"
FT                   /db_xref="GOA:Q0SVQ7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ7"
FT                   /protein_id="ABG87641.1"
FT                   /translation="MSKSISKNIIFKFLLNIFNVVVPIIIGPYVLRILGPDLMGTINFS
FT                   QTIYGYFFIFAGFGVYQYGLREISRVRDDKKKLSQVYTSLFTLTFITNILTTIGYVLFV
FT                   QFNYSGTEIYVACMILTFNLLANIFYTEWVNEGLENYDFITIKTIIIRIVYVVFLFILV
FT                   RSANDLKEYMILLVLSTFLNNIVSFIYIRKRIPFDFSDLKLLRHIKPMFLVVILSNANV
FT                   LYTQLDRYFIGEYINMDSVAYYTTAQNISNIINTLLLTVIYATIPRMSNYIANENHDEY
FT                   KGLLDKISRMYFIVLFPAAIGMLVLAKEVILIYGGSKYLDAIPMLKVFAIYIITLGFET
FT                   ILSNQVMYIRGKEKEQVKITFIGGAVNLVLNVTLLWTGYFNGTNAVITTMLANIVVIIL
FT                   EYLYIKFVMDLDFNIFSLDKMKYLAISLLFIPITYFIGKFISGVILFTLAVMLINSLVY
FT                   FLILLIIKDDCLLEIINKFFKYIINKIK"
FT   gene            552664..553584
FT                   /gene="galU"
FT                   /locus_tag="CPR_0465"
FT   CDS_pept        552664..553584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="CPR_0465"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87156"
FT                   /db_xref="GOA:Q0SVQ6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ6"
FT                   /protein_id="ABG87156.1"
FT                   /translation="MKNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEE
FT                   AIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISGMVDIHYIR
FT                   QKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVYNEEKPCLKQLIGCYNEYKTSVLGVQT
FT                   VPESHVSKYGIVDGKHIEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENT
FT                   KPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGF
FT                   VEYLNNLSEKESLFKKEVEKEIVTV"
FT   gene            553994..554641
FT                   /locus_tag="CPR_0466"
FT   CDS_pept        553994..554641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0466"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /note="identified by match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86391"
FT                   /db_xref="GOA:Q0SVQ5"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ5"
FT                   /protein_id="ABG86391.1"
FT                   /translation="MAEKKQRFINKNVRELRLLGEKGNKEALNELIIRGKKGDKLAIAE
FT                   IVSIYEGLIHKYSTSFFINGYDVEDLKQVARSVIIESISKFDGDHGSEFIFFISTNVKN
FT                   KLGTMCKKKENRVDFSSLDSPIGEGITIGETIKDEISIEDEYVERERMRAFVKALANIS
FT                   KSDRDFILYVYKDRGNFQKYCQEHKHITTYSKARWRKERILKELREEMKNFK"
FT   gene            554961..557204
FT                   /locus_tag="CPR_0467"
FT   CDS_pept        554961..557204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ4"
FT                   /protein_id="ABG85663.1"
FT                   /translation="MTKLKEKGVSLLKPKNKGVFTVNFKHPILKDYKGNGRVITKSLGA
FT                   DVGKDYEKAKNFTDEIKSIINNSDCYENYYGFLESLEKYSEKAMKIVFDNTHFMEEFYY
FT                   DSKKNILEKFIEIYHDNINKRLEEELKEIFKLLKLEEFELIDNSNKSFEIFVEEEIKSR
FT                   FNFEFKKKIQLLGGDYEYRKKLISNFIGSSEKFSKAYKNTNEAKEDKFINKFFNNMGDP
FT                   NFEVIFKQDSNKFKFVGTPYSKSIINEKINLKGILEEFLFRINSLDNIFQYKIELRERK
FT                   SGKSYIFNNNELLVERNFIYNKGLDKYPLDNIEDLAYIYFHIGYKENYKEKSQEELKSK
FT                   FFYILESLFNEKHNPNSSSLIFSDIRLEGNFRGEILHNKEKDFILADYSGNINEFRNKL
FT                   LSYETRRNLASSDEIIWLFNIEEEAFERNLEVLKYLIINGYLNKTNIYIYEKTVFSDYF
FT                   SFEFDNSESDFMNVLNEKEAYNMPNIFNSFLKDNFQNLLEELGEEEPSIIIRGREEYYL
FT                   NLIMERVIFPCDEEKKVLSNKGLIEKIINQSEEVLINKIKEKSSLINEYKLSYKYERLV
FT                   GLSLEINRKVKRKFIRRVRGSYDKNLKEFSLRMAYNFGGREYKSLCLEKILETSIKNSI
FT                   KAFLLNPYKIRKDINILEFEKSIEYIMESISEKIIEEVEILIREDNLLKWKEAAELILK
FT                   EDIIEGRNLIEEIIEETFVVSNDTFREDKVLKIIKEVLKNNSIFKEIKGEFSV"
FT   gene            557282..558298
FT                   /gene="galE_2"
FT                   /locus_tag="CPR_0468"
FT   CDS_pept        557282..558298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE_2"
FT                   /locus_tag="CPR_0468"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85566"
FT                   /db_xref="GOA:Q0SVQ3"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ3"
FT                   /protein_id="ABG85566.1"
FT                   /translation="MNILLTGGIGYIGSHTIVELLRDDNNSVVVIDNLVNSRKEVKDIV
FT                   EKITGKSIKFYEGDLVNFEDIDKVFKNEKIDAVIHFASLKAVGESVEKPLEYYNNNIIG
FT                   TLNLLTSMRNHNVKKFIFSSSATVYGESEIVPVHEGLQAGFATNPYGRCKAMIEDILRD
FT                   LYISDNSWDIVLLRYFNPVGAHESGLIGELPNGIPNNLMPYVSKVADGELDYVRVFGDD
FT                   YNTQDGTGVRDYIHVVDLARGHVAAMKKLKDGSGISTYNLGTGQGYSVLDIIKAFSKAS
FT                   GKEIPYKIVDRRAGDIAISFADPSKAEKELGWKAEKNLEDMCKDFWKWQCVGMKNFK"
FT   gene            558338..559282
FT                   /gene="galU_2"
FT                   /locus_tag="CPR_0469"
FT   CDS_pept        558338..559282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU_2"
FT                   /locus_tag="CPR_0469"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by similarity to SP:Q05852; match to
FT                   protein family HMM PF00483; match to protein family HMM
FT                   TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87563"
FT                   /db_xref="GOA:Q0SVQ2"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ2"
FT                   /protein_id="ABG87563.1"
FT                   /translation="MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEE
FT                   AIASGIEEILVITGRSKKAIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIR
FT                   QKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVYNEEKPCLKQLIECYNEYRTSVLGVQT
FT                   VPEENVSKYGIVNGKHIEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENT
FT                   KPGKGGEIQLTDALLELMREEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGF
FT                   IDYLRELSATENIFTEANGKEKKDKEEELVTEA"
FT   gene            559605..560297
FT                   /locus_tag="CPR_0470"
FT   CDS_pept        559605..560297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAS41597.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87816"
FT                   /db_xref="GOA:Q0SVQ1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ1"
FT                   /protein_id="ABG87816.1"
FT                   /translation="MIIISQNTFLVVGIILFCLFRGAIKIKGIIKEEYTYRQIYSNEEF
FT                   IFDLFCIYLIGVASKVYFPLTIAWGKNIVYNFPEIWLSPLWSIKQIYHQGGLGGVIYQL
FT                   IGNSIMLSPMAFFLCYFYSIDEENLTLGKWIIDKINKILEGFELHNKKKLKEDSYVPSL
FT                   NTVLKFCFFMSLFIESSQVILSLVFPNTKRFFEVNDLMCNTLSGVWGYYIYIKVIKLDI
FT                   IPKKIFKL"
FT   gene            560509..560880
FT                   /locus_tag="CPR_0471"
FT   CDS_pept        560509..560880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0471"
FT                   /product="ISCpe2, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85832"
FT                   /db_xref="GOA:Q0SVQ0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVQ0"
FT                   /protein_id="ABG85832.1"
FT                   /translation="MYCIQYNIVWCVKYRRKVLFGDVDKSLKEIILKIANDNNFEISEM
FT                   ETDKDHIHLLIECSPQHQIPNIIKALKGVSARLLFLKHPEIKRYLWGGNLWNPSYFVAT
FT                   VSENTEEQIRNYIQNQQVK"
FT   gene            560891..562045
FT                   /locus_tag="CPR_0472"
FT   CDS_pept        560891..562045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0472"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85455"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP9"
FT                   /protein_id="ABG85455.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGA
FT                   GYDKYYKKIGGRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVKIENSR
FT                   NVDGNIKRVTVSRTQSDKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEAN
FT                   PKHFRKAEKRLIKLQRDLARKEYNSKNYHKNRIMIAKLHERIANQRMDFLQKFSTKLIR
FT                   ENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAEWYGREIVIAPPDYASSQ
FT                   LCSECGYKNIEVKNLGLREWICPECGTHHQRDLNASINLEKLIA"
FT   gene            562274..562349
FT                   /locus_tag="CPR_0473"
FT   tRNA            562274..562349
FT                   /locus_tag="CPR_0473"
FT                   /product="tRNA-Met"
FT   gene            complement(562383..563237)
FT                   /locus_tag="CPR_0474"
FT   CDS_pept        complement(562383..563237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0474"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by similarity to SP:Q00753; match to
FT                   protein family HMM PF00165; match to protein family HMM
FT                   PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86002"
FT                   /db_xref="GOA:Q0SVP8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP8"
FT                   /protein_id="ABG86002.1"
FT                   /translation="MKTLEYNESNKHKYLELKEKNSLDLYLGYCGMEKCLPSHSYGPAV
FT                   RNNYLIHYIIDGEGTYYVNGQSYRLRKNQGFLICPNTLTYYKASKDNPWTYMWIAFNGI
FT                   KAKKYLNYANLNEDNLIFEYTEDDSLEIYINRMFELNRMNYSNELEIQGLLYLFLSKLA
FT                   MSKNENSLKSNNISDFYVEKAIEFMQNNYLNPDLKITDVANFVGLNRSYLTHLFKKSLK
FT                   LSPQEFLLNYRINEATSLLKNTNLSVGTISKSIGYNDQLTFSKVFKKVKGISPKTYRDN
FT                   FLK"
FT   gene            563529..565721
FT                   /gene="aga"
FT                   /locus_tag="CPR_0475"
FT   CDS_pept        563529..565721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aga"
FT                   /locus_tag="CPR_0475"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="identified by similarity to GB:AAD23585.1; match to
FT                   protein family HMM PF02065"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85395"
FT                   /db_xref="GOA:Q0SVP7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP7"
FT                   /protein_id="ABG85395.1"
FT                   /translation="MIINYNENLKTFHLKTKNTSYILKMLETGHISHLYWGRKLKADNL
FT                   EYFFRRRCFGSFCADTDNISGFQLELIPQECPTFGATDLRSPSLEFQYEDGTSATDLRY
FT                   KSHRIYEGKQRLSGLPAVYAESEEEATSLEITLVDSLKNLEVILTYNVFEDFDAITRSL
FT                   KIVNNSGEKINIERVLSANVDFTTDEFDFIQLSGSWGRERHILRNPLRSGSQAIESRRG
FT                   ASSHAQNPFMALCSKDTNEEYGDVYGFSLVYSGNFLANVEVDMYRNARAQIGINPFDFK
FT                   WLLESKEEFQAPEVVLVYSSKGLNGMSQIYHNLYRKRLCRGNYRDKVRPILINNWEATY
FT                   FDFNEVKIKEIAKEASKLGMELFVLDDGWFGNRNDDKSSLGDWFVNEGKLKGGLSKLAK
FT                   DINNMGLKFGLWFEPEMISPISKLYEKHPNWCIHIPGRTRSQARSQLILDLSRKEVCDY
FT                   IIESVSKILESANISYVKWDMNRNMTEVGSLELTSERQRETAHRYILGLYRVMEEITSR
FT                   FPNVLFESCSGGGGRFDPGMLYYMPQTWTSDDTDAIERLKIQFGTSMVYPPISMGCHVS
FT                   AVPNHQANRTTPLETRGVSAMAGNFGYELDITKLSEEEKEELKKQISLYKEIRETVQFG
FT                   TLYRLKSPFNSNEVAWMMISEDKNEVVVSYVRQWALVNESFSNLKLTALDKDSEYEIIG
FT                   EDIVLSGDELMYIGLNIPELYGDYVSKLWKLKKKDL"
FT   gene            566372..567655
FT                   /locus_tag="CPR_0476"
FT   CDS_pept        566372..567655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0476"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86079"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP6"
FT                   /protein_id="ABG86079.1"
FT                   /translation="MKRGLRNIIAMTLATFTVGSFLTACGNDNLKSGNSSDGNVILTYS
FT                   IWDKGQEPAMRAIADAFEKENPNIKINVEITPWDQYWMKMDAAAQGGALPDIFWMHSSQ
FT                   ISRYGRNGKLLDLTDRIKNSKKINLNNYPEGLVELYSPDNKNYAIPKDYDTTALWYNKA
FT                   LFDEAGIPYPDETWTWDTLLETAKKLTNKENKIYGFGAPLNSHEGYYNFIFQNGGYILS
FT                   DDKKKCGYDDKKTLEALRWYIDLGLKEGVSPTQKEFDEVSPLTLFESGKLAMGIFGSWN
FT                   VANFKQNEYVRENCDIAVLPMGEKRASVYNGLGNAIGYNTKHPEEAWKFVEFLGGKEAN
FT                   ILQAEYGAAIPAYKGIDEKWAEVTKEFNARAHVEMLDYAEILPYSNRTARWKVIEDDLW
FT                   PRVWAGQANLDEVSKRMDKDIEEVLAED"
FT   gene            567700..568647
FT                   /locus_tag="CPR_0477"
FT   CDS_pept        567700..568647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0477"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86826"
FT                   /db_xref="GOA:Q0SVP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP5"
FT                   /protein_id="ABG86826.1"
FT                   /translation="MNISVKSKEKLKLKRIEKEELKFNKKNMKEWGWGYVMIAPTIIGL
FT                   LILNIFPAIKTFILSFQKTGDFGNNVWTGLSNYKKLLTDEVVISAIGNTFKYAIIVVPI
FT                   SIILSLIVAVLLNQNIKGKSLYRTIYFLPMVAAPAAIAMIWKWLFNSEFGIINQILNLI
FT                   GINGPMWLSDSKTALISIAVVGIWSCIGYNMVLLLAGLQEIPKDYYEAANVDGAGPIRT
FT                   FFKITLPLLSPTMFFVVVTSVIGSLQVFDTIFMMIGKTNVAIEGTQSLVYLFYKYSFVV
FT                   NDQGYGSAIVMLLLAIIMVITFIQLKVQKKWVHY"
FT   gene            568664..569491
FT                   /locus_tag="CPR_0478"
FT   CDS_pept        568664..569491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0478"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87535"
FT                   /db_xref="GOA:Q0SVP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP4"
FT                   /protein_id="ABG87535.1"
FT                   /translation="MDKKIKTKKILIHGALICGALIMIVPFLWMVLTSLKTMGEATQVP
FT                   PKIFPSKPMYENYSEVSRLLPFGKFYMNTIIMLIFRVVGSVFFSAMAAYAFARLNFPGK
FT                   KIFFALVLFQMMIPAQIFIVPQFLLVQKLGLLNTISALVIPGIVSAFGTFLLRQFFMGL
FT                   PKELEEAAKLDGCNTWQTFYKVMLPLARSGLVALGIFTALFAFKDLMWPLVVNMSVDKM
FT                   TLSAGLASLQGQFSTNYPQLMAGSVLAIWPMLIIFVIFQRKFIEGIATSGSKL"
FT   gene            complement(569581..570330)
FT                   /locus_tag="CPR_0479"
FT   CDS_pept        complement(569581..570330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0479"
FT                   /product="sortase family protein"
FT                   /note="identified by match to protein family HMM PF07170;
FT                   match to protein family HMM TIGR03064"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85646"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP3"
FT                   /protein_id="ABG85646.1"
FT                   /translation="MKNSLRIKKIISLILLIIIFFCAIKIYQKRLGYYTDSRDYDNLRS
FT                   LSPLSDSSINKDPEENKKDIENEKNLKNINSDYKFWINVEGTNIDFPVIQGKDNDFYLH
FT                   HNFNKEKSFSGSIFVDSENNLNDDSNLVVYGHNMRNDTMFAQIKHFKNENFFNANKYVT
FT                   LYREGKKSTFEIFSVYQENAKDLESQIKIKFSNKEDYEKYLKEQEEKSLFKREGIDLKD
FT                   NDRILTLVTCGYDFVNARIVIVAKEVN"
FT   gene            570569..571069
FT                   /locus_tag="CPR_0480"
FT   CDS_pept        570569..571069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0480"
FT                   /product="putative peptidase"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02228"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86517"
FT                   /db_xref="GOA:Q0SVP2"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP2"
FT                   /protein_id="ABG86517.1"
FT                   /translation="MKKGIKIFYNILFYGFLTILIAFLLLGFFAKKSDSGISIGGYRIY
FT                   DILTGSMSPTIKPGNLVVVKETLPNEVKKNDVITFKSDITNNVTTHRAIEIVNSDGKTE
FT                   FITKGDANNTQDPVPLDEKLLVGKVVFQVPYLGAFLSSLQKNKLIFIGLLVVIILIDFI
FT                   FNK"
FT   gene            572429..573064
FT                   /locus_tag="CPR_0481"
FT   CDS_pept        572429..573064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0481"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAP25245.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87580"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="InterPro:IPR024008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP1"
FT                   /protein_id="ABG87580.1"
FT                   /translation="MSKKKIIGLCIAGVLAVGSIGGSLAWFTSSDSITNPFSTASTDNP
FT                   SNPNSGIKINEKFNKEEADNTLPGDKVTKQVNVSNKATYDQLIRVKIKKVWKDAKGNEK
FT                   SDLDTKNINLNFENNLTDSNKPEEGKWIEGSDGYYYYNGIVNPDGQTANLLESVTLSKD
FT                   ITNEFKGLNFDVVVASEGVQSANGAVNDSWGTAPQVIKDLGAGTNAHK"
FT   gene            573112..573843
FT                   /locus_tag="CPR_0482"
FT   CDS_pept        573112..573843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0482"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:BAC14481.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87048"
FT                   /db_xref="GOA:Q0SVP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVP0"
FT                   /protein_id="ABG87048.1"
FT                   /translation="MKNLIKSFLFTMAFLLIICKPGVASTFATPNVELEGNADGIVFIQ
FT                   GDEPFLWSDNILPGDKLERNILLNNKHKDSYKIFMRAERISKKESYDLLEKIELKVIYD
FT                   GNCIYDGFVSGQNGLENNIYLGEVKPGESKKLEAFAEFPGKEAGNEYKNKKAQVDWIFT
FT                   AVKDSYSGEESLLGSNKLNKGNIDSNQDNIKNTIDNIIVPKTGDSGLGIYFVIFIIASI
FT                   AILILNFDFIKNKLKIFKKEE"
FT   gene            573846..574472
FT                   /locus_tag="CPR_0483"
FT   CDS_pept        573846..574472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0483"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87821"
FT                   /db_xref="InterPro:IPR024008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN9"
FT                   /protein_id="ABG87821.1"
FT                   /translation="MKRRKGLVKALLLILIVISIISVTVLGKGFTSIDSVNNKFSIGSV
FT                   ETEIDENFDAPKEWDGSNISKLVSIKNTGKSDEFVRVSIIPRWIDENENPWTGDSNLIQ
FT                   LNLDEDNIIALNKGDINNLWVYGEDGYFYYMAKLKSGKSTKELLKSVEIKKGAIEDSLK
FT                   EKYNGKKIKIDVNVEAIQPNEEALIKKWTGINEKIKDKYVEILSK"
FT   gene            574489..576357
FT                   /locus_tag="CPR_0484"
FT   CDS_pept        574489..576357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0484"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85798"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN8"
FT                   /protein_id="ABG85798.1"
FT                   /translation="MKNIRKIFCVFLIISLFISVPVLNASGIENKGFDDQFKDIGNESK
FT                   GRICDYDGTEILKEVSQEPDKDGNYEITLTVKGKPKKVTKPVDILLIMDASNSMYYNMD
FT                   ELKASMNSLVDKVIDNIPNSRIAVVAFGTEVEEVFSFNNKNKFTSKEEYKNAIKDSYYY
FT                   ITRKGNTNIEGTWRVADEIFKNELNNNSNSKKDVIFFSDGYPNISVDYLYSIGYLSVYN
FT                   YYNDYYLNEKNYYLNQIYKKAFEEGKNYRNEHRDYEYEKIMKENGNTIGSWALYEYKKF
FT                   YNNYPDTNIFSVALIDNIPYEDKNSAKELLSKMQNSGYFTIDSRFGQDNNENNSKSLKE
FT                   IYDKIANNIILDKEMAKGLKITDVVSKDFEIVKNGAYDGKNSKIVNLSDNSVIDLKENI
FT                   EGDKISWDRGENIIDSTDGIQFKFKIKPKNQYWGTGDNKVYTNDIATISYKKPKEKNKI
FT                   ITGIFNKPNLSIPYKIGKIKVTKKFFDENGKEVKVDDKKTYTVCIDGGDLGKYYLKVDG
FT                   NGNAKVLDFYMRDENTDISNNNDTKKGYLKVTESSENKRIYRVSEIDTMDSETKSIFVN
FT                   GFKNDSFELNMQNNNIDIVINSSINDEKYFYDNKEKVNDLGIFKLN"
FT   gene            576452..578017
FT                   /locus_tag="CPR_0485"
FT   CDS_pept        576452..578017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0485"
FT                   /product="ISCpe5, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86040"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN7"
FT                   /protein_id="ABG86040.1"
FT                   /translation="MKNIHQIVLPINLEIIIPKDDSVRLLYEVTEGLNYKKLYRSYSIL
FT                   GRNSAIDPKALFRIVVYGYMERIFSSRELEKACIRDVNFRWLLQGQKAPSHNTIARFKS
FT                   SRMKYCLEDLFNQLVLKLNEKDEIKFENLFIDGTKIEANANRYTFVWKKSTKKFEEKLQ
FT                   IKVRKLIENINKDLNITFHNENKISVSEATNLLTYIILLKEKTNLEFVYGKGKRKSKLQ
FT                   KYAEGLEDFIEKQSKYDNYNEIFNGRNSFSKTDKDATFMHMKEDHMKNGQLKPGYNIQI
FT                   GVEGEYIVGVDVSSERSDQLTLIPFLDKLKSNLSTQYKSVTADAGYESEENYLYLENNN
FT                   YEAYIKPQNYEKSKTKKFKKNIGNKENMTYLKDEDCYICANSQRLTVKSVTTKKSKSGY
FT                   KSEITIYESESCEGCKYKSSCTKAKGNKKITTSKKFAYLREKSLENIKTDKGILLRKNR
FT                   SIQVEGAFGVIKQDYGFRRFLMRGTKNVITEFLLIAFGYNINKLHRKTLEKRNGQLLHL
FT                   KNIA"
FT   gene            578381..579097
FT                   /locus_tag="CPR_0486"
FT   CDS_pept        578381..579097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0486"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86614"
FT                   /db_xref="GOA:Q0SVN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN6"
FT                   /protein_id="ABG86614.1"
FT                   /translation="MLNIAICDDEKIQRNILKDMLYKICNKNNMDVIIDEFCSGVDLLN
FT                   VYKRNTKKYSIVFCDILMDEMNGIELLRKIGELDTFIQSILITGSEEYVFEGYDVGALN
FT                   YLMKPVSFEKLEKEFLRAIKSLNFTSPSRYAININGKTNFIDLSEVLFFEVNNKTITAN
FT                   LSKESIDFNMKIATLEEELKDRNFLRCHRSYLVNISHIDSILQNKIILKNSVEIPIGRV
FT                   YKKELKTFLMNRIGDI"
FT   gene            579102..580397
FT                   /locus_tag="CPR_0487"
FT   CDS_pept        579102..580397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0487"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87507"
FT                   /db_xref="GOA:Q0SVN5"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN5"
FT                   /protein_id="ABG87507.1"
FT                   /translation="MYVNNVIKLFYIIYIFFIGIYSFFYLDKKIELKKRVFSTIILNFL
FT                   ILIINYIFYINDLSFFFEALIIYIYYFYLYKKNTKSILMSSIYLLNLSLGKYILIFIYS
FT                   VMIFDLEVLKIMNNIMFLCFIILLILMITVVVFIVNFFKNCIINVNDLTVKKQTKLVFI
FT                   IGIAVLLSEKVFDNIALNASLVYRVNISTISIAINLAIIHFITYKRFKEYKANSQINIL
FT                   EKQLDYQKNYYEKVINNYGEARKALHDMNNHMSVIKYFLENKDYKNMDDYIQSLSERIV
FT                   TNKDNNICRNKVINAICLDKCERCKKAGINIRFDTVINSKINIDDLDLCIVLGNLIDNA
FT                   IEACEKINEKELQRVIQVSARIYLNQIYIKVINSKNNKVEKKNNKFLTSKKDKKNHGIG
FT                   LENVKESVYKNQGNIEIKDSKNTFEVSLYMKC"
FT   gene            580574..581380
FT                   /locus_tag="CPR_0488"
FT   CDS_pept        580574..581380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85536"
FT                   /db_xref="GOA:Q0SVN4"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN4"
FT                   /protein_id="ABG85536.1"
FT                   /translation="MKNGRRVKNPKKNSSSRNKSKVLDISIIILIIALVLVIATGTIKD
FT                   KKTLAKNMEIYSSNSSNNSEDNKKQETTSNPYEKIKKGEEVNILVLGNGVGLSEGKTDE
FT                   SGNWTSSLSKWLEETYKSKANITNLSQDKATVKVGLEELDKNKDSFDLAYIIFGENDQK
FT                   ALKPNEFKEDYEKIIKNLKERNKNISIVPIIENSIRKKNEYTNIIEEIGKANNLKVLDM
FT                   ATVFIKDPAPYAKLTTKGGIYPNNVGYSLYFSNIKSLIEANIAALN"
FT   gene            581802..582245
FT                   /locus_tag="CPR_0489"
FT   CDS_pept        581802..582245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0489"
FT                   /product="PTS system, L-Ascorbate family, IIA component"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87075"
FT                   /db_xref="GOA:Q0SVN3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN3"
FT                   /protein_id="ABG87075.1"
FT                   /translation="MNFIRDLLNENNIILKAMAFNKEEAVRLAAEPLLKDGSIREEYVK
FT                   DILEKINDLGPYMAIMPGVVIAHSRPGDYVFKDCISMLTLENPVEFGHEDNDPIEIIFV
FT                   IGAKENTGHLDALQDLARVLINEDSVNRIKNAQNKKEIMELFM"
FT   gene            582420..582692
FT                   /locus_tag="CPR_0490"
FT   CDS_pept        582420..582692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0490"
FT                   /product="PTS system, lactose/cellobiose-specific IIB
FT                   component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86585"
FT                   /db_xref="GOA:Q0SVN2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN2"
FT                   /protein_id="ABG86585.1"
FT                   /translation="MKIMTVCGFGVGTSLLLKMTVDSILEEEGINGDVEASDMTSACGN
FT                   SADLILTSKEIGKEIEGQVSGKLVYISNFMDKEEVKEKILKAIKN"
FT   gene            582734..584005
FT                   /locus_tag="CPR_0491"
FT   CDS_pept        582734..584005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0491"
FT                   /product="PTS system, L-Ascorbate family, IIC component"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87029"
FT                   /db_xref="GOA:Q0SVN1"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN1"
FT                   /protein_id="ABG87029.1"
FT                   /translation="MKEILDFCVSFFRNPALFMGLVVAIGLILQRKPIDAILKGIFKGI
FT                   IGMVILLKGVDIVVSSITPLANAFSGLFNTQSNSTLGDFNVFLGQYGSYVGLILLCGFV
FT                   INIIIARYTRFKTIYLTGNILFWYPMLFLAVGIENNVSGLKLFIFTLIMYILVITIFPY
FT                   ILRKHVKYVTGNDSFTIGHTASIYCLLGSYIGKLVGQKDKNIENLNLPKSLSFFRDTNI
FT                   TAAIVMFIVYIIVGLFIGKESRTAIYGSEPLITYSLIQGITFAAGMIILLTGVRMILGE
FT                   IIPSFKGIADKLAKGSIPALDIPMIFPYGPNALLIGFIIALITSIGTLFLLGASGVLTF
FT                   ALIPLVVACYFDVAPGAIFANARGGWPAAIITSALGGIILMVLAFISLNLVSGTVGNFI
FT                   QTYGGNEFSIWVIIGDLVGKLFSI"
FT   gene            584234..585028
FT                   /locus_tag="CPR_0492"
FT   CDS_pept        584234..585028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0492"
FT                   /product="HAD hydrolase, IIB family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF02358; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87587"
FT                   /db_xref="GOA:Q0SVN0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVN0"
FT                   /protein_id="ABG87587.1"
FT                   /translation="MKNLKGIVFFDVDGTLIDCGKGLYKPSNKTKEAIKKLKDNGYLTI
FT                   LATGRPMSFVDDGLKELELDGYIASNGTYIELNNEVILNDDIKLEKLKEIMDYCVEHNI
FT                   DFILEGQKTSYVLNNDVAKKMVENFSLPEESFTGEWTEEELSANKLVIVDNNKDDFKDI
FT                   FERFKDEFVFMQHPGHSSYDMYRRGCTKAHGIEHLINELGLSDKDTYAFGDGENDIEMF
FT                   QRVKYGIAMGDAHETLIPHAYKQTENVPNEGIYKALLELGLI"
FT   gene            complement(585163..585609)
FT                   /locus_tag="CPR_0493"
FT   CDS_pept        complement(585163..585609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0493"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87022"
FT                   /db_xref="GOA:Q0SVM9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM9"
FT                   /protein_id="ABG87022.1"
FT                   /translation="MDNIENLMEATEELYTLLLCLNRKVFSHDDIVKRLSIPPSHAKVI
FT                   FHLHCGGEASVSEIAKNLSISKSNMTPIIDKLIQENLVERFTDPNDRRIIRVRVTEKGH
FT                   EFCLKQREKTKKHLEEKISSLSSEELEKIKDLAKELNSIFSKIE"
FT   gene            585931..588228
FT                   /locus_tag="CPR_0494"
FT   CDS_pept        585931..588228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0494"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="CAC2393; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87648"
FT                   /db_xref="GOA:Q0SVM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM8"
FT                   /protein_id="ABG87648.1"
FT                   /translation="MSKLIKYLKPFTASILAVIVLLFAQAMFDLSLPDYMSNIVNVGIQ
FT                   QGGIENAVPKVISKSEFDKLTLFMSKDEKEKVESNYTLLDKGNLPKSEYDKYVKDYPAL
FT                   EKENIYKLNTKDKEIINELNPIMGKAMIVVGGIEEKGLQGVMGNSSLTGASDNFKANME
FT                   ESAPKEGKIQGMPANTDPFFMIKNMPEAQKNDMLKQINEKFESMPESMVTQTAATFIKD
FT                   QYTDLGMNIEKIQSQYILKTGGIMILLAFGSMIAAVSVTLIAARVAAGFGRNLRSKVFG
FT                   KVVRFSNAEFDKFSTASLITRSTNDIQQIQTLMVLLLRIVFYAPILGLGGIFRVVKTDT
FT                   GMSWIIAVALAAILSLVIVLFGLAIPKFKLVQKLVDKLNLVARESLTGMLVIRAFNTEK
FT                   YQENKFDGVNKDLTRTNLFVSRIMGGMMPLMMLIMNLITILIVWVGAHNVNDGVMQVGD
FT                   MMAFIQYTMQIIMAFLMISMVSVMLPRASVSGQRIAEVLETKESIKDPEKNHEFNKNKK
FT                   GYVEFKNVSFKYPGAEEYVLKDISFTAKPGETTAFIGGTGSGKSTLVNLIPRFYDVTEG
FT                   EILVDGTDIRKVSQHDLREKIGYVPQKGILFSGTIESNLKYGNEDALLEELEEAANIAQ
FT                   ASEFINTKALKYAEEISQGGTNVSGGQKQRLSIARALVKNPDVYIFDDSFSALDFKTDA
FT                   AVRKALNEKTSHSTMLIVAQRISTIMGANQIIVLDEGKIVGKGTHKELLENCEVYKQIA
FT                   LSQLSKEELSNE"
FT   gene            588221..590077
FT                   /locus_tag="CPR_0495"
FT   CDS_pept        588221..590077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0495"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="CAC2392; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86247"
FT                   /db_xref="GOA:Q0SVM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM7"
FT                   /protein_id="ABG86247.1"
FT                   /translation="MSKERKGGMGGPMGRMGGGPRAVEKAKDFKGTMKKLGVYLKPYSL
FT                   SIAIVILFAIGSAAFSIVGPKILGKATTKIFEGLVQKITGVPDASIDFGYIGNIAMILV
FT                   ALYLVSSLFGIIQSFIMSGVAQKVSYNLRKQISEKMDTLPLNYFDTRTNGEVLSRITND
FT                   VDTVNQTLNQSLSQIITSVVTLIGVLIMMFSISWIMTLATFIILPVSMVLISLVVKKSQ
FT                   KYFKSQQEYLGHLNGQIEEVYGGHNIMKAFNREEASTKDFDELNNTLYKSAWKSQFLSG
FT                   MMMPIMSFVGNLGYVLVSILGGWLTIKSVITVGDIQAFIQYVRSFNQPISQMAQVANIM
FT                   QSTAAAAERVFEFLDEEDEVKDPVNSVDPSEIRGEVEFEDVHFGYNEDKIIINDFSVDV
FT                   KPGQKVAIVGPTGAGKTTIVKLLMRFYDINSGSIKIDGHDIRDFKRADLRNLFGMVLQD
FT                   TWLFNGTIMENLRYGRLDATDAEVKEAAKAAHVDHFVKTLPDGYNMVLNEDASNISQGQ
FT                   KQLLTIARAFLKDPKLLILDEATSSVDTRTELLIQKAMEKLMEGRTSFIIAHRLSTIRD
FT                   ADLILVMKDGDIVEQGNHEELLEKGGFYSSLYNSQFEQNSAS"
FT   gene            590221..590325
FT                   /locus_tag="CPR_0496"
FT   CDS_pept        590221..590325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86747"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM6"
FT                   /protein_id="ABG86747.1"
FT                   /translation="MNNVADMNFKNFKFVSAIFFYFKVAYLIESKLIN"
FT   gene            590592..591473
FT                   /locus_tag="CPR_0497"
FT   CDS_pept        590592..591473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM5"
FT                   /protein_id="ABG87317.1"
FT                   /translation="MKFRFLYVGDKILSHREEGLFRVLNCEEYSLNKKVLDYKEICNRK
FT                   KYKNGFSEEKFNRIYLSKRGSVINFYSLGSKEFSETYLNDTNRFKDLLNLNKNSENEEI
FT                   KIIFFDLFNKDANKDQLFITSFMNKLGEISKDINWDNILIIFNEEIIFNKVTDINSRFR
FT                   ECSLVLNNYDVNLNEFIHILIDFLLLRNDLGDKWAEYRKKIANSKLTLGKGKGENFSGE
FT                   VIMRILGEFSKIQRDNLFKLILMRKEEINLNEIALIEDALKEYISLDSRLIIKQLTRDF
FT                   FDDEVRYILFSK"
FT   gene            591728..592777
FT                   /locus_tag="CPR_0498"
FT   CDS_pept        591728..592777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0498"
FT                   /product="transporter, auxin efflux carrier family"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85952"
FT                   /db_xref="GOA:Q0SVM4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM4"
FT                   /protein_id="ABG85952.1"
FT                   /translation="MLEIIQKTLTDNAIIGAIFSSIAIIFLGFYIRKRNILTGAASKIL
FT                   TKVVLTVAIPALAFTSFMKDINQKELHEGINILIWGFVIYILLIVLTKFIFARVKGDKQ
FT                   DVFRVLTIFGSTTFFGVPIVKAVYGSVGAMYSSIFNIAYRVFLYSYGYIKMSGVKMDKE
FT                   NMKKNLKEMLLNPVIIATFLGLFIWLFQGMLPQVQIGDKSYAFLRIDQTLPWLYKPLTY
FT                   LDKLCSPLAWLAIGITLAEVPFKQAVGQKEPWVYSLIKIILVPVINLGLLVVLNKTGIL
FT                   PVSFEGMATTVIMLATPTATVAAAYAISFDKEALLTSNCSLLSTVVAVVAMPFWIVILQ
FT                   IIKNIGLFA"
FT   gene            593105..594103
FT                   /gene="idhA"
FT                   /locus_tag="CPR_0499"
FT   CDS_pept        593105..594103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="CPR_0499"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /note="identified by similarity to SP:P52643; match to
FT                   protein family HMM PF00389; match to protein family HMM
FT                   PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86445"
FT                   /db_xref="GOA:Q0SVM3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM3"
FT                   /protein_id="ABG86445.1"
FT                   /translation="MIKLVCYGVRETEVPYFHKLNEEFGYDLTLVEKNLNHENVEEAIG
FT                   AEAIMVRGNCMADRQNLELLKSKGLKYVLTRTVGFDHVDLEAAKDLGLQVARVPGYSPN
FT                   AIGELAVSLAMMLLRHTAYTTHRTSNKNFVVDGFMFSKEIRNCTVGILGAGRIGLTTAK
FT                   LFKGLGAKVVAYDVFQSDAAKEIVEFMPLDEVLKVSDVISVHMPYIKGQNYHMINEEFI
FT                   SKMKNDAIIINTARGELQDIEAIVKALEEGRLGGFGTDVLEGESAVFFKNLEGQKLENE
FT                   SYEKLISLYPRALVTPHMGSYTDEALRNMIGISYENLKEYLEKNTCKNAIA"
FT   gene            594394..595944
FT                   /locus_tag="CPR_0500"
FT   CDS_pept        594394..595944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0500"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by similarity to SP:P39272; match to
FT                   protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85570"
FT                   /db_xref="GOA:Q0SVM2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM2"
FT                   /protein_id="ABG85570.1"
FT                   /translation="MKVKFENKILLWAILITFIPLALSFTLFIEDKLSYMDEDVRNTLK
FT                   ETAFSISQIPFVQEDLNNGEINPRIQEYTKHFIEAINDVDIIVVADMRGIKYSHLDEKQ
FT                   IGQVFINDDKKEVLTQGNSYYSLMKGSMGETLRWFQPVMYNGKQVGFIMVGKYYNEIQL
FT                   LTHKTLIKYMGLFILVFLITILISKLFARKVKKAILGMEPEEIAALYKEKKIILNTVSE
FT                   GIIALNKNNEITEINDNCYKLIDGFSKYKVLKKLLPYIEENKPVEMKEIILQGKKVFVT
FT                   IQPIMKKGEYLGSVITLMDRNDIRKIAKEITGVDEVVKNLRANVHEFRNNLHVILGLIQ
FT                   LGEYEEARKYILKTQKIHENNSLKFSNVEDYYVRGLLLSRELVAKERGVNFVLTEESFL
FT                   FGNHNYVDSYDIVTILGNLIENAFDSCVCSSIENKEVEVTLYEDDEKIELQVRDNGKPI
FT                   DNNIKERIFELGVSSKGEGRGTGLSLVKNRVELYDGCIDIEEFNEEKIFIITILKGEK"
FT   gene            595944..596612
FT                   /locus_tag="CPR_0501"
FT                   /note="CPE0532"
FT   CDS_pept        595944..596612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0501"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86145"
FT                   /db_xref="GOA:Q0SVM1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM1"
FT                   /protein_id="ABG86145.1"
FT                   /translation="MEKKILIVEDDPMVALINKRFLENMGFKDILGPVQTEEEIIQLLD
FT                   KENIDLILLDVYLPKKNGIDILKSLRYKKYLTDVIMITAANSVEEVKRAFAYGVTDYLV
FT                   KPFEFERFEEAINKYKQKNNLLNKREALSQQDIDVISKSLEEKIELPKGLNQKTLDRIM
FT                   EFLKENKGKVWTLREIAYELKISNVTIKKYMDYLEDIKKVNVTLTSGNVGRPEYKYTLG
FT                   "
FT   gene            597024..597554
FT                   /locus_tag="CPR_0502"
FT   CDS_pept        597024..597554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0502"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85616"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVM0"
FT                   /protein_id="ABG85616.1"
FT                   /translation="MNKRKIVASILTTSLLVTSLVGCVGSNNKANTNSNDSKVQESVEN
FT                   QSDFNDLRTYVGKTYNEVSENKGTGNENIEEVSGKKVIVSSSYSTRMFNYNANLILELD
FT                   DSKNISAVSVHFKGIEPNNILENIKKILGEPKISKDKENGDSKVYSWEKDGYQYKLSQV
FT                   GEETIINVNKSAI"
FT   gene            597909..598550
FT                   /locus_tag="CPR_0503"
FT   CDS_pept        597909..598550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0503"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02659"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87078"
FT                   /db_xref="GOA:Q0SVL9"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVL9"
FT                   /protein_id="ABG87078.1"
FT                   /translation="MSILSIVLTGFGLAMDAFAVSVAKGITLTRVKAKDALKVALFFGG
FT                   FQALMPLIGWGAGRYFADYIKAFDHWIAFILLGFIGGKMIFEALKEEDEEKAEVAVSME
FT                   VNKNKEREFANMKRKEELSAKNLTVLAIATSIDALAVGVSFAFLGISIVQTIIIIGIIT
FT                   FVLCFLGVIIGEKLGDIFKNYAEIVGGVILILIGINILLEHTGIIEKLFS"
FT   gene            598761..599174
FT                   /locus_tag="CPR_0504"
FT   CDS_pept        598761..599174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0504"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86553"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL8"
FT                   /protein_id="ABG86553.1"
FT                   /translation="MYVAFGNRVLDSEEIKKEIELNTDARVVSDLCKSSKREDIIAFKL
FT                   SIDMDILRGLMRENSDLKDLNDEELFEDYLDLAEEVAGMIFEYMPEDAILDIRSYKWDM
FT                   SYNDVNLIMVMAHEDLGIAKVNDVMKRLLRQVD"
FT   gene            599399..600109
FT                   /locus_tag="CPR_0505"
FT   CDS_pept        599399..600109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0505"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85923"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL7"
FT                   /protein_id="ABG85923.1"
FT                   /translation="MRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNYW
FT                   NIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGAG
FT                   YDKYYKKIGGKPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKRIKLLKLGLVKIENSRN
FT                   VDGNIKRVTVSRTQSGKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEANP
FT                   KHFRKAEKRLIKLQ"
FT   gene            600161..600550
FT                   /locus_tag="CPR_0506"
FT   CDS_pept        600161..600550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0506"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF07282;
FT                   match to protein family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85423"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL6"
FT                   /protein_id="ABG85423.1"
FT                   /translation="MIAKLHERIANQRMDFLQKFSTKLIRENQSIAIEDLRVSNMLKNH
FT                   KLAKIISEASWSEFRRMLEYKAEWYGRKIVIAPSDYASSQLCSECGYKNIEVKNLGLRE
FT                   WVCPECGTHHQRDLNASINLEKLIA"
FT   gene            600703..601818
FT                   /locus_tag="CPR_0507"
FT   CDS_pept        600703..601818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0507"
FT                   /product="NAD-dependent 4-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.61"
FT                   /note="identified by similarity to SP:P38945; match to
FT                   protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87434"
FT                   /db_xref="GOA:Q0SVL5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL5"
FT                   /protein_id="ABG87434.1"
FT                   /translation="MKLLNLNTEILGFDTSSEFAKELNINGKDLVFTNRRIYEGSFKSL
FT                   DLKCNYVLKDKYNFNEPNDEIIDEIFKDIKNIDFNRVIAIGGGSILDVGKLLALKDVSS
FT                   TKKLFKRELPIIRDKELIIVPTTCGTGSEVTNISIVEIKSENTKLGLAVDELYADKGVL
FT                   IPELCKTMPYKAFVYSSIDALIHSIEGFLSPNSTPYTDLFAFKAIEMILSGYKEILEKG
FT                   EEYRNTIMDKFLIASNYAGIAFGNAGVGAVHALSYPLGGKYHVPHGEANYQFLMAVLNF
FT                   YKKNNGDGKIIELTRLISSIINAKEEDCYLELENLLNNLIRRKNLKEYGMTIDEIEKFS
FT                   HSVMKNQQRLLKNNYVSMEIKDMEEIYKYLY"
FT   gene            602050..602730
FT                   /locus_tag="CPR_0508"
FT   CDS_pept        602050..602730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0508"
FT                   /product="TrkA domain protein"
FT                   /note="identified by match to protein family HMM PF02080"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85321"
FT                   /db_xref="GOA:Q0SVL4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL4"
FT                   /protein_id="ABG85321.1"
FT                   /translation="MVLVLTFILFLMIFLIIVDFFAILFRLTGVPIEKARFQVTSLLTG
FT                   TGFTTKESEIIVQHPTRRKLAIWLMGFSYASTATIISFAVNIITSSVIDVGSIAVIVLF
FT                   IIFVLFFHKSSLLEKFENKIEKFIVQSKIWDKINSKHLTLITNTKGFGVYEIYLSNKTT
FT                   LIGKSIRDSNLKANEIEVLNIDKGDKFVNFPTPDYTFEICDKVTVYGNVKNIKNMFKHI
FT                   NEVK"
FT   gene            complement(602860..603312)
FT                   /locus_tag="CPR_0509"
FT   CDS_pept        complement(602860..603312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0509"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF01978"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87055"
FT                   /db_xref="GOA:Q0SVL3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL3"
FT                   /protein_id="ABG87055.1"
FT                   /translation="MDLKALNPNGNAFLVSFTKAKKTYKKFISPTLNDLGLTHNEFEIL
FT                   VFLQENLEYNTAKDIVEFSGLSKGLISRSIESLLKKEMLSIKKDDKDKRIFRLYISPSA
FT                   NETLNTLNKLSNKFFKLLLEDLKYEELVLFDNILNKMIRNLNNLKI"
FT   gene            603993..605384
FT                   /locus_tag="CPR_0510"
FT   CDS_pept        603993..605384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0510"
FT                   /product="amino acid/peptide transporter"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85410"
FT                   /db_xref="GOA:Q0SVL2"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL2"
FT                   /protein_id="ABG85410.1"
FT                   /translation="MAEAIKSTDFEVEKGNGRLKHPAGLYLLFFTEMWERFSYYGMRAL
FT                   LMLYLTASFVTGGLGFDVPSAARIYGAYTFLVYFTPIIGGEIADKFLGQKKSIMLGAAV
FT                   MILGNLTLFGWQTRWALYLGLGFIIVGNAFFKPNISTIVGQLYEDGDKRKDSAFTIFYM
FT                   GINLGSLIAPIICGLLAENFFATKSGEVILHYGFRYGFLAAGIGIILGEIIFITLSPKY
FT                   LAHVGEIKREKNKKEVKKEKKPLTKQEKKRVAVILILASFVVFFWAGFEQAGTTLTLFA
FT                   EHATNRSLFGWTVPVAFFQSINPLFILILAPLFSKLWFTLANSKRGDLSIPTKMAMGMI
FT                   VLGCGFLLMVFATMSLGGNVENPEVKASMFWLVGTYLFNTMGELCLSPIGLSMVSSLAP
FT                   VKYASLLMGVWLASNGVANYLSGFIASFVEKLGALELFGSIAGVSIVLGLVLLLLSKKI
FT                   TAMME"
FT   gene            complement(605747..605962)
FT                   /locus_tag="CPR_0511"
FT   CDS_pept        complement(605747..605962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL1"
FT                   /protein_id="ABG85797.1"
FT                   /translation="MSDNKLKEDLVKVYKDWKDLEKKAGKKIKHHHELKKEEKEAEIQR
FT                   FSDYAGLSVPVTEEMLLYLDEEYFRV"
FT   gene            606454..608004
FT                   /locus_tag="CPR_0512"
FT   CDS_pept        606454..608004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0512"
FT                   /product="nitrite/sulfite reductase homolog"
FT                   /note="identified by match to protein family HMM PF01077;
FT                   match to protein family HMM PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86287"
FT                   /db_xref="GOA:Q0SVL0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVL0"
FT                   /protein_id="ABG86287.1"
FT                   /translation="MNTLNDILSKEIEEFREKGHKFLNKEMTVGEFRKVSGGMGVYAHR
FT                   GGKEFVVRLRIPSGVARLSSLEQVYNWAKKYNLEKIHLTTRESIQLHGISIDAVCDIMQ
FT                   DGLTKGIYTRGAGGNFPRNVALNPLSGVQIGETFDVTPYALAANAHYMSKIYTYNLPRK
FT                   IKTAFSNTEEDSAHCTVTDLGFLAVENNGKRAFKLYIGGGLGRNPRKSVEFDELIDEKD
FT                   VLYCLEAITNLFIAEGDYKNNSKARIRYIVERMGEEEFKNCFRKHLEEVKVKGGLDLKV
FT                   EDIKYSKKGEKTNIKHERLIPQKQEGLYTVLFHPVGGQLSLDVLKELIEKIENIEDVEV
FT                   RLGMDENLYIRNLNGKEAEAILDFTQGKGGDTLAERSVSCIGTPICQMGVLESQKTLRE
FT                   FVKLLKENSIEEGVLPRVRFSGCPNSCGIHEVGNIGFAGKKKKVGDVLSNVFELHFGGK
FT                   LGIGETRLGDYYGDILQDKVPEFLIKVAKAVEAKNSTFEEWIKDNSEEFKAIVEEYNV"
FT   gene            608318..609133
FT                   /gene="speD"
FT                   /locus_tag="CPR_0513"
FT   CDS_pept        608318..609133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="CPR_0513"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by match to protein family HMM PF02675;
FT                   match to protein family HMM TIGR03331"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85383"
FT                   /db_xref="GOA:Q0SVK9"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVK9"
FT                   /protein_id="ABG85383.1"
FT                   /translation="MLGLKEKICLYGFNNLTKTLSFNIYDICYAKTEREKEDYIKYIDE
FT                   QYNSERLTKILCDVTEMIGAHVLNISKQDYEPQGASVNVLITEEALPVALIDPSCNKGE
FT                   LSYLELRDSVVGHLDKSHLTVHTYPEFHPNNDIISFRVDIDVSTCGKISPLNALDYLIG
FT                   SFDSDVITIDYRVRGFTRDVDGRKCYIDHDIKSIQDYIDEETLKKYDAMDVNVYQSNIF
FT                   HTKMMLKDIGLNNYLFNSDPYELSPNDRREIRDRISKEMIEIYGGVNIY"
FT   gene            609151..610605
FT                   /locus_tag="CPR_0514"
FT   CDS_pept        609151..610605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0514"
FT                   /product="Orn/Lys/Arg decarboxylase"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM PF01276; match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87685"
FT                   /db_xref="GOA:Q0SVK8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK8"
FT                   /protein_id="ABG87685.1"
FT                   /translation="MKRLSQENAPIYEALKWYKNQRIVPFDVPGHKQGRGNTELREFLG
FT                   EDCVSVDVNSMKPLDNLCHPTSVIKDAEELAAEAFSADKAFFMVNGTTSAVQAMIMSVC
FT                   KDGDKIIMPRNVHRSAINSLIITGVTPVYINPGIHGRLGISLGMAMEDIKKAIKENPDA
FT                   KAIFVNNPTYYGICSNLREIVKLAHENNMYVLVDEAHGTHFYFDKRLPVSAMEAGADMA
FT                   AVSIHKTGGSLTQSSMLLMKCNRIKPDYVRTIINLTQTTSGSYLLLSSLDIARRNLALN
FT                   GEKIFEEVVGIAEYAREEINKIGGYYAFSKEINNGDDIYDFDVTKLTINTLETGLAGIE
FT                   VYDILRDDYGIQIELGDVANILAIISVGDTRYNIERLVSALSEIKRIHEKDKKDIFDHE
FT                   YIDPIVKVKPKEAFYAKKKKVLLRESEGLISGEFVMCYPPGIPILAPGELVTKETIDYI
FT                   EYSKKKGSLVTGPEDMEIEYINVLDF"
FT   gene            610620..611471
FT                   /gene="speE"
FT                   /locus_tag="CPR_0515"
FT   CDS_pept        610620..611471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="CPR_0515"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by match to protein family HMM PF01564;
FT                   match to protein family HMM TIGR00417"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86992"
FT                   /db_xref="GOA:Q0SVK7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVK7"
FT                   /protein_id="ABG86992.1"
FT                   /translation="MELWYTEEHTDKVRFSIKVDEQLYSGKSDFQRIDVFKSQEFGTFF
FT                   TLDGLMMVTEKDEFIYHDMIVHVPMATNPNIKNVLVIGAGDGGTVRELTRYETIEKIDM
FT                   VEIDKLVVDVCREYLPQTANKLDDPRVSLFFEDGLKFVRSVENKYDLIIVDSTDPFGPG
FT                   EGLFTREFYGNCFKALKEDGILVNQHESPYYEEYARGMKRAHKRIKECFPVCRVYQAHI
FT                   PTYPSGHWLFGFASKKYDPLNANIEKWNDLGLKTKYYNTDLHKGCFALPNYVKEMLENV
FT                   DE"
FT   gene            611458..612315
FT                   /gene="speB"
FT                   /locus_tag="CPR_0516"
FT   CDS_pept        611458..612315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="CPR_0516"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87141"
FT                   /db_xref="GOA:Q0SVK6"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK6"
FT                   /protein_id="ABG87141.1"
FT                   /translation="MLMNRNVSTFIGCEAEYDESSIVVFGAPFDSTTSFRPGTRFASQV
FT                   MRGESWGLESYSPYQDLDLYDFNIFDGGEIELPFGNSEGALALIEDFSTKVVEDGKIPA
FT                   MIGGEHLVTLGAFKGVFKKYPDVHVIHFDAHADLREDYLGQKLSHATVIHRVWDLVGDN
FT                   KIFQFGIRSGEKEEFLWAKDHVYTNKFNCDTLDYALEMVKDKPVYVTIDLDVLDPSVFP
FT                   GTGTPEPGGIQFNELLNSILKLRGLNIVGFDINELSPQYDQTGASTAVACKVLREMLLV
FT                   ANNK"
FT   gene            complement(612631..612894)
FT                   /locus_tag="CPR_0517"
FT   CDS_pept        complement(612631..612894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86439"
FT                   /db_xref="GOA:Q0SVK5"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK5"
FT                   /protein_id="ABG86439.1"
FT                   /translation="MKELFVSYLVIINLVAIILMYIDKQKAKKHQWRISEDTLIGVSII
FT                   GGGIGALWGMHVFRHKTKHAKFTIGIPLIIAIQALLILYFIR"
FT   gene            complement(613160..615829)
FT                   /locus_tag="CPR_0518"
FT   CDS_pept        complement(613160..615829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0518"
FT                   /product="copper-exporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR00003;
FT                   match to protein family HMM TIGR01494; match to protein
FT                   family HMM TIGR01511; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87292"
FT                   /db_xref="GOA:Q0SVK4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK4"
FT                   /protein_id="ABG87292.1"
FT                   /translation="MSAIIFMINKSIKIKGMSCAACAARIEKVLGKMDGISKANVNLAT
FT                   EKLNLEFDENKISFKEIEEKINKLGFSVVRNLKKESFKVSGMSCASCAARIEKVLNKLS
FT                   GIYNATVNFANESLQVEYDEDEISLEEIKVKVKKLGFELKGNNKSTSFKVEGMTCSACA
FT                   ARIEKVTSKMDGVESSNVNFANSTLNISFDKDKLSTNDIKAKVEKLGYKLLDASQEDEH
FT                   EKAKENETKRMKNRLIGSAIFTIPLFIISMGHMVGLHLPNIIDPMHNPLNFALIQLLLT
FT                   TVVIFICRDFFIHGFKNLFMRSPNMDSLIAIGSGAAYVYGLFAIYHIYMGDHSYAMQLY
FT                   FESAGTILTLISLGKYLETLTKGKTSDAIKKLMGLAPKTATLLVDGKEKIVSIDDVKVF
FT                   DLILVKPGEKLPVDGKVVEGYTSIDESMLTGESIPSEKKVGDTVFGASINKNGRIIYEA
FT                   TKVGKDTVISQIVKLVEDAQGSKAPIAKLADTISGYFVPIVISLAVVASLAWYFSGESK
FT                   TFALTIFISVLVIACPCALGLATPTAIMVGTGKGAENGILIKSGEALESTQNLNTVVFD
FT                   KTGTITEGKPKVTDIICENISKDELLLLAASAEKGSEHPLGEAIVRDAEEKNLKLKNVL
FT                   DFEAIPGKGIKCSIEDKRILLGNYKLMKDKNINLKNLLATSEELASKGKTPMFIAIDEK
FT                   IAGIIAVADTVKETSKKAIKTLQKMGLEVVMLTGDNLKTAKAIAKEVGVNRVIAEVLPQ
FT                   EKAEKIKTLQDEGKKVAMVGDGINDAPALAISDIGMAIGSGTDIAMESADIVLMKGDIL
FT                   HVVGAIQLSRQTMKNIKENLFWAFGYNTLGIPVAMGVLHIFGGPLLNPMIGAFAMSFSS
FT                   VSVLLNALRLKKFKPNYK"
FT   gene            616121..616777
FT                   /locus_tag="CPR_0519"
FT   CDS_pept        616121..616777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0519"
FT                   /product="flavodoxin family protein"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87447"
FT                   /db_xref="GOA:Q0SVK3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK3"
FT                   /protein_id="ABG87447.1"
FT                   /translation="MKKLLYITVNSKPEKLSSSKTIGRAFISRFVELNPEFEIEEVDLY
FT                   KDFIPRLEHKHFSGRSSVVDCETASIDEKTKEEVKRIIELSEQFKNADLYVIAAPLWTL
FT                   SFPAPLKEYIDCVVQNKITIKVTPEEVNGLLDDKQREMVYIQSSGGEIPWLTKGIFNKG
FT                   LNYVEDIMKFLGIKKFHPLLVDGTGFSIEEKFKAEDKAVEKIDNVIKDIHFSNKG"
FT   gene            617705..617809
FT                   /locus_tag="CPR_0520"
FT   CDS_pept        617705..617809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86800"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK2"
FT                   /protein_id="ABG86800.1"
FT                   /translation="MLIYNICNEFSKSKKNKRRTSTDVKNILNEAKNK"
FT   gene            618058..619194
FT                   /locus_tag="CPR_0521"
FT   CDS_pept        618058..619194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0521"
FT                   /product="glycine betaine/carnitine/choline transport
FT                   ATP-binding protein"
FT                   /note="identified by similarity to SP:O34992; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00571; match to protein family HMM TIGR01186"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86542"
FT                   /db_xref="GOA:Q0SVK1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK1"
FT                   /protein_id="ABG86542.1"
FT                   /translation="MIEIKNVSKQIGDRKILDNISLTIDKGSLVVLIGSSGCGKTTTLK
FT                   LINKLITPTSGEIFINGKSLAKENPIELRRNIGYVIQNNGLFPHLTIKENIELIPRLKK
FT                   GKDVEKIEQTTLDLLNMVGLDPEIYLNKYPSELSGGQQQRVGFARAFATDAEIILMDEP
FT                   FSALDPITRTSLQEELFTIQEELKKTIIFVTHDMDEALKIADKICIMNGGKIAQYDTPE
FT                   NILRNPANDFVRDFIGSDRVWNNPDFIKAKDIMIKNPVSVKGARTILQGIEIMRSNKVD
FT                   SLLVIDKENVLKGIVTFKDIKITNEKSRVLSEIMSENPLRVNEDDSLVDILTVMNENSV
FT                   GFIPVVNSEEKLVGLITRSSLLSILSDQFLDMEVNIFE"
FT   gene            619187..620740
FT                   /locus_tag="CPR_0522"
FT   CDS_pept        619187..620740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0522"
FT                   /product="glycine betaine/carnitine/choline ABC
FT                   transporter, permease/substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87678"
FT                   /db_xref="GOA:Q0SVK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVK0"
FT                   /protein_id="ABG87678.1"
FT                   /translation="MNSLLQYVISQKTQILDLLVQHIYLTITAIGIAILIGVPLGILVS
FT                   RVKFLRKPIIGFVNLVQAVPSMALLGLLIPILGIGSTPAIFMVVVYSLLPIVKNTYTGI
FT                   SGIDPVVLESAKGIGLTKNQSLFKIQLPLALPIIMSGIRISAVTAVGLMTLAAFIGAGG
FT                   LGYLVFSGVQTVNNNMILAGAIPACILALIVDFIFGKIEVAVTPKGLSNDKKKKNTFVL
FT                   KIISVIMIIAILFMGISSFISSKKDKVVIGSKNFTEQLILGNMYADLVQAKTDLQVEKK
FT                   LNLGGTSVAFGALEKGDVDMYVDYTGTLLVNVMKENNIDNSVDYYNSIKENMNKEHGLT
FT                   VMEPLGFNNTYNIAISKELADKYKINTISDLSKYSNDFVLSPTIEFQNRQDGLVGLKNY
FT                   YGMDFKNVKSLDGSLRYSALSNGESQAIDAFSTDGLLKKFDLKTLEDDKKFFVNYSAVP
FT                   IVNNKTLEKYPQLKDVLNSLSGKINEEKMIDLNYEVDVLGKSPEEVAKAFLIREGLIEQ
FT                   "
FT   gene            620996..621571
FT                   /locus_tag="CPR_0523"
FT   CDS_pept        620996..621571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0523"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="identified by similarity to SP:Q45585; match to
FT                   protein family HMM PF04542; match to protein family HMM
FT                   PF04545; match to protein family HMM PF08281; match to
FT                   protein family HMM TIGR02937; match to protein family HMM
FT                   TIGR02954"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87130"
FT                   /db_xref="GOA:Q0SVJ9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014300"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ9"
FT                   /protein_id="ABG87130.1"
FT                   /translation="MEKTMSISYLDIDRKNKLNEIKLIKESMKGNKESFGILIKNNKEY
FT                   LYKMAFLYVKDEQDALEVIHETVYRAFLNIEKLKKAKFFNTWITRILINVSIDFLKKKG
FT                   KNEMLDESTPIRKERCEISTEEKLDLYNAIDLLNDNYKTVIIMMYFNDMKIKDISKVME
FT                   IPENTVKTYLRRAKQALGEVLKEGYLNE"
FT   gene            621564..622652
FT                   /locus_tag="CPR_0524"
FT   CDS_pept        621564..622652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35292.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86909"
FT                   /db_xref="GOA:Q0SVJ8"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ8"
FT                   /protein_id="ABG86909.1"
FT                   /translation="MNKKDLDKINLPNNLDDVIDEAINMAHEDKKKNKIKGKGYKKVFK
FT                   SIAAGLAIIIGIGVGTSTFAYGVPIIKNAFERIQKEIWNKGDYSKYATEVNQTVSNNGV
FT                   GITLSEILCDGQNLYVSYVIESKEPFKYIKYKYDPVKDYDITKEQAEKIEQMQLDYGAE
FT                   AKVSFTDSELDNSGVSGLEGRFIDDHTFVGVEEYNLTSLNIRIPDEFEFIINFNSIVEE
FT                   GWNERDKRHIFKGEWNFKVPVKVDKSLSKCIEVNDMNKEGVGIKEVIATPIKLKLVTTG
FT                   YDREKNNYWVRVYDEKGNILRTSSGEELSSYGEYLSTIAKEGEDIKKIKVEIYKPFVDE
FT                   NGKDYFHDPRETILYSKEINLE"
FT   gene            623002..623823
FT                   /locus_tag="CPR_0525"
FT   CDS_pept        623002..623823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0525"
FT                   /product="PTS system, trehalose-specific IIB component"
FT                   /note="identified by similarity to SP:P36672; match to
FT                   protein family HMM PF00367; match to protein family HMM
FT                   TIGR00826"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85695"
FT                   /db_xref="GOA:Q0SVJ7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ7"
FT                   /protein_id="ABG85695.1"
FT                   /translation="MSKFEKDAKLLTEYIGGKENVAAVTHCATRMRFVLNDTSKADVEK
FT                   IKAIPCVKGTFTQAGQFQVIIGPEVATFYNDFVGQTGVSGESKEEVKKAAKKNMNIVQR
FT                   AVAGLAEIFAPLIPAIIVGGLILGFRNVIGDMKLFEDGTKSLVEISQFWAGTHSFLWLI
FT                   GEAIFHFLPVGVVWSIAKKMGADQMLGIVIGITLVSPQLLNAYSAGNGAAAPVWDFGFA
FT                   QVPMIGYQAQVLPAIMVGFTFVYLERLFKKITPGPIQMIIVPFFSIRNLLN"
FT   gene            623886..624101
FT                   /locus_tag="CPR_0526"
FT   CDS_pept        623886..624101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0526"
FT                   /product="oligo-1,6-glucosidase, truncation"
FT                   /note="identified by similarity to SP:P21332"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87191"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ6"
FT                   /protein_id="ABG87191.1"
FT                   /translation="MYAYERNYNGEKLLVINNFYGEECLVDLSKEIEGLENYNKSILIS
FT                   NYKDSTLDLLNLKLRPYESIVYKLEK"
FT   gene            624365..625072
FT                   /locus_tag="CPR_0527"
FT   CDS_pept        624365..625072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0527"
FT                   /product="trehalose operon transcriptional repressor"
FT                   /note="identified by similarity to SP:P39796; match to
FT                   protein family HMM PF00392; match to protein family HMM
FT                   PF07702; match to protein family HMM TIGR02404"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87829"
FT                   /db_xref="GOA:Q0SVJ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ5"
FT                   /protein_id="ABG87829.1"
FT                   /translation="MSSKYLKIYNDIVGKIDSGIFEANTKLPSESQLMDEYNVSRDTVR
FT                   KSLNLLEQNGYIEKSKGKGSFVLDMNKFDFPVSGIKSFKEIENSLGKECETILEELTLK
FT                   SPSDSLMKKLEVSPNKYVWRVVRVRNIDGEKIILDKDYLNSEFVPRLTEEICKDSLYKY
FT                   IEEELGLKIAYAEKEITVQTATEEDQRLLDLRGYDMVAVVKSYTYLEGRKLFQYTESRH
FT                   RPDKFKFVDFARR"
FT   gene            complement(625524..627710)
FT                   /locus_tag="CPR_0528"
FT   CDS_pept        complement(625524..627710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0528"
FT                   /product="stage V sporulation protein D"
FT                   /note="identified by similarity to SP:Q03524; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717; match to protein family HMM PF03793; match to
FT                   protein family HMM TIGR02214"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86674"
FT                   /db_xref="GOA:Q0SVJ4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR011927"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ4"
FT                   /protein_id="ABG86674.1"
FT                   /translation="MKRSYRDMAIIRKRLSFILAFIIIMCFILSIRLSYVMIIKGPDYA
FT                   DLAVEQWTNEVKISARRGKILDRDLNELAISSNVYRIDLNLNAIRSYTKKTGKTNEELA
FT                   LEISKVLEMDKDTVLKKIEFKLPSGAPAGAAILARRIEKEKADKVKELEIPGVMVSPDT
FT                   QRYYPNDNFLSHVLGTTNSDGVGLNGIELKYDRVLSGSPGLKITEMVKDGAEYPYTISR
FT                   FTAPVDGKDVVLTIDEKLQYFAEQIAEIGLVHHNADAASVIIMNPNNGEILAMSNKPDF
FT                   NPNKPYDGAENFSGNTSSDRIQKMWRNRSVSDSFEPGSIFKIITASAAVQEGVAGKDET
FT                   YTCSGGLQKGDRFIKCWKRGGHGTQTFEEIIQNSCNVGFMNLGEKLGAEKLNEYIKKFG
FT                   LGKKSGVDLPGESPGIVKKTENITDMDLATISFGQTNTVNPIQFMTAVNAVANGGTLIQ
FT                   PHVVKEISYINENNDRVIDETFVPKKTENLISKETADQIKLALENAVKNGSAKGAYKEG
FT                   YGVAGKTGTAQKVNPETGGYGGGYVASFVGFAPYDNPQISVMVSVDNPKNGEYYGGRVA
FT                   APLAGMLFQNIFNYIDLTEFHLDEKLPEKETIVIPEVRGLPINDATSMLKELGISYEIE
FT                   GEGEFIVESNPSPGYPISPDTKITLIAGDSSNLNSDVIIPDFKNYSKESAEKLLNQLGL
FT                   IGEFVGEGPSITKQSISPDEVVNGNSKITLTLGY"
FT   gene            628052..628720
FT                   /locus_tag="CPR_0529"
FT   CDS_pept        628052..628720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0529"
FT                   /product="putative N-acetylmuramoyl-l-alanine amidase"
FT                   /note="identified by similarity to SP:P00806; match to
FT                   protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86113"
FT                   /db_xref="GOA:Q0SVJ3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ3"
FT                   /protein_id="ABG86113.1"
FT                   /translation="MEHNKIKNINLSKRRKKIFRRRLIFLISIILIICGSIFFVFSKMN
FT                   KDESYRDAYKKNISSRELEKMRQELDIKEVDYKWGSGLKNGNSPKRLIIHHSATDSPET
FT                   PEDIHKFHLDNGWSGIGYHFYIREDGTIYKGRDENVIGAHAKNANYNTLGICIEGNFEK
FT                   EGLKEAQKNSLVKLGTYLSLKYPIKDILPHREVVDTLCPGTLFPMDNIKSSIIEEIKNI
FT                   "
FT   gene            629200..630297
FT                   /gene="ribD"
FT                   /locus_tag="CPR_0530"
FT   CDS_pept        629200..630297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="CPR_0530"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85973"
FT                   /db_xref="GOA:Q0SVJ2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ2"
FT                   /protein_id="ABG85973.1"
FT                   /translation="MDEFFMKKALELARKGEGYVNPNPLVGAVIVKGGEIIGEGYHEFF
FT                   GGDHAEINAINSSVKSTEGATIYVTLEPCCHYGKTPPCVEAIIKNKFKTVVVGTLDPNP
FT                   LVSGNGIKILREAGIEVKVGVLEKECIRLNEIFNFYIKENRPFIALKWAMTLDGKIATK
FT                   DFKSKWITNKKSREFVHSLRNKYSSIMVGINTVLKDNPDLRCRLNKNKELERKHFRIVL
FT                   DSKLKIPLDSEILKNQSESKTLIFTTNKKDKIKNEKLKDKGIEVIEVNLDEGKININQV
FT                   LECLKEKNIDSVLIEGGGNLNFSFLENKKVNKIYAFVAPKVFGGKNAITPVEGEGIRNV
FT                   LDAFEFPEVNLKTFHNDILIECSLS"
FT   gene            630319..630972
FT                   /gene="ribE"
FT                   /locus_tag="CPR_0531"
FT   CDS_pept        630319..630972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="CPR_0531"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by similarity to SP:P50854; match to
FT                   protein family HMM PF00677; match to protein family HMM
FT                   TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85559"
FT                   /db_xref="GOA:Q0SVJ1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ1"
FT                   /protein_id="ABG85559.1"
FT                   /translation="MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNG
FT                   VCLTITTKGKDYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDS
FT                   TGEIISFKDEGEAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHS
FT                   QEETTLTKRKIGDLVNIECDPIGKYVEKLLGFKKDSRKKKSVLTEEFLTINGFI"
FT   gene            631121..632320
FT                   /gene="ribA"
FT                   /locus_tag="CPR_0532"
FT   CDS_pept        631121..632320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="CPR_0532"
FT                   /product="riboflavin biosynthesis protein RibA"
FT                   /note="identified by similarity to SP:P17620; match to
FT                   protein family HMM PF00925; match to protein family HMM
FT                   PF00926; match to protein family HMM TIGR00505; match to
FT                   protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87475"
FT                   /db_xref="GOA:Q0SVJ0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVJ0"
FT                   /protein_id="ABG87475.1"
FT                   /translation="MKKFNLVEEAIEDIKNGKMVIVIDDEGRENEGDLVMAGELVTGEK
FT                   INFMATYGKGLICAPVSESIAESLGLNPMVSHNTDNHETAFTVSIDYKNTTTGISAFER
FT                   AHTIKELINEESKAEDFRRPGHVFPLIAKNGGVLKRAGHTEAAIDLAKLAGLKEVGVIC
FT                   EIMKDDGTMARTDELLEFAKIHNMKIITIEDLIAYRTERDNFVYRVVETNMPTKYGEFK
FT                   AIGFIDKLTGEHHVALVKGEIKSEEPVLLRVHSECLTGDVFGSRRCDCGEQFHRAMEKI
FT                   NEEGKGILLYMRQEGRGIGLINKLKAYKLQDEGLDTVEANIALGFPEDLRDYGVGAQIL
FT                   KELGVREIRLMSNNPKKITGLEGYGLKIVERVPIEIKCNEENEFYLKTKKEKMHHLIMQ
FT                   "
FT   gene            632447..632908
FT                   /gene="ribH"
FT                   /locus_tag="CPR_0533"
FT   CDS_pept        632447..632908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="CPR_0533"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by similarity to SP:P11998; match to
FT                   protein family HMM PF00885; match to protein family HMM
FT                   TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86426"
FT                   /db_xref="GOA:Q0SVI9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVI9"
FT                   /protein_id="ABG86426.1"
FT                   /translation="MRILEGNLIGQDKKFAIVAGRFNEFIVSKLIGGALDAFKRHGVEE
FT                   ENIDLAWVPGAFEIPLIAKKLAKSGKYAGVVCLGTVIRGATSHYDYVCGEVSKGIANVS
FT                   LDTEVPVIFGIVTTENIEQAIERAGTKAGNKGFDAAMAAIEMANLLENI"
FT   gene            complement(633001..633408)
FT                   /locus_tag="CPR_0534"
FT   CDS_pept        complement(633001..633408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0534"
FT                   /product="conserved hypothetical protein TIGR00149"
FT                   /note="identified by similarity to GB:BAC14697.1; match to
FT                   protein family HMM PF01894; match to protein family HMM
FT                   TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85699"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI8"
FT                   /protein_id="ABG85699.1"
FT                   /translation="MNSFFKHTLETHTPQSMSKITSYIREDIKNSNIENGIVVVYCPHT
FT                   TAGITINENADPDVVKDLIYGFEKVYPTNDHKYRHFEGNSHSHLKSSTVGVSQQLILHR
FT                   GRLILGQWQDVYFCDFDGPRNRTFYVKILEG"
FT   gene            633805..634053
FT                   /locus_tag="CPR_0535"
FT   CDS_pept        633805..634053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:F72407"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87777"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI7"
FT                   /protein_id="ABG87777.1"
FT                   /translation="MYTIMAIKISPRTVAAPKVQEILTRYGCIIHTRIGLHEATENTCS
FT                   TSGLILLNLIPSAEEEIKNLDNELNSLEDVTAKLLNL"
FT   gene            634257..634349
FT                   /locus_tag="CPR_0536"
FT   CDS_pept        634257..634349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85899"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI6"
FT                   /protein_id="ABG85899.1"
FT                   /translation="MLILNCKKKVILIYMTLNVYSRGNGGEIYG"
FT   gene            634342..636546
FT                   /locus_tag="CPR_0537"
FT   CDS_pept        634342..636546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0537"
FT                   /product="conserved hypothetical protein TIGR02336"
FT                   /note="identified by similarity to GB:AAN25428.1; match to
FT                   protein family HMM PF09508; match to protein family HMM
FT                   TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86710"
FT                   /db_xref="GOA:Q0SVI5"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI5"
FT                   /protein_id="ABG86710.1"
FT                   /translation="MGELKGRVTIPTDSNMKEKIKSIIDRWGADALRDCDGTKLSKDIV
FT                   DLGVKLYSTYLTVRSDQKWASENKDELQQLYLMSEPVIAKSEKTEIKILSGYYSEQFEI
FT                   DKVHDEKKWWEVIDRTTGKVVDTSKWNFNKESEILTVEETTPYHEYTVNFLVYMIWDPT
FT                   QMYNHITNDWGDKPHEMPYDCRQAKTSVHVKEALKKWIHDNPEVDVVRFTTFFYHFTLC
FT                   FNEVAKEKFVDWFGYSSSVSPLALEQFEKEKGYKLRPEDIVDAGYYNSTFRVPTKQYKD
FT                   FIDFQCKHVSKMAKELVDVCHENGKEAMMFLGDNWIGTEPYGKYFPSIGLDAVVGSVGN
FT                   GTTMRMIADIPGVKYTEGRFLPYFFPDVFNETGDPVGEARENWLQARRAILRSPLDRIG
FT                   YGGYLGLAVKFPEFVEQVEKICDEFREIHETIKGTKAYVAPFKIAVLNCWGKLRSWQTQ
FT                   QVAHALWYKEIYSYAGIVECLSGMPVEVEFISFDDILENGIPEDIGVIINAGDAYTAWS
FT                   GGEYWKNPKLVSMIRKWVHNGGGFIGVGEPTAIHYENKFFQLADVLGVDKEVGFSLSTR
FT                   KYNELNPHHFITEEIGEKAIDFGEGMKGVYGKGDSYQVLRMDFGNCHCLKNNFRGDTTC
FT                   AVNTYGKGRSVYFAGFPYTPENCRILLRAIYWAASKEDEMKKFYVTNIDTECAAFLEVG
FT                   KMAVINNTQEEKITDAYINGVKVETLTLAPMEIRWLNINK"
FT   gene            636725..638476
FT                   /locus_tag="CPR_0538"
FT   CDS_pept        636725..638476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0538"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00672;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87594"
FT                   /db_xref="GOA:Q0SVI4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI4"
FT                   /protein_id="ABG87594.1"
FT                   /translation="MRKIIRKVINTLRGISNFLRKTSIKNRLIASFSVGIIFCSSILGI
FT                   LLYKKATNALKNNVINYSKNMLSIMSEDIYKNKEFLERASIELSMNEEIANNLINYKFM
FT                   DGKEKNKFLKYMNDYLSKKLSLLPNLAEVEIISKDYEVTYMQGFKYFKREDIERYADES
FT                   ENGLFWFSTILNNESHICIVTPVKQDNSILGYVFMAIKSEVFASSFSLFNIGKGSEIFI
FT                   IDDNNNIIISENNLNSNFILEETNLNKFLKDKGAKDTARSIVVNGENYVATYRKLKGFN
FT                   WYIASMIPYDFINADIQSLKKEMTIIGLLFTLVVLIFSYFLYSSIKVPLYNLLNKMKRV
FT                   SEGDLKVLVNDTYEDEIGVISDNFDSMLKRVNELIEKTKLQEVEKRDLEIRMLQAQINP
FT                   HFLFNTLNSLKWTALMNQDYTVSEGLSSLAELLRNTIIDKNEFVTIREELENIKNYFVI
FT                   QKIRYGNSFDVQYEVDELLLENKVIKFILQPIVENSIIHGIDENKENQKIIIKIMSEEE
FT                   NILISIKDNGKGFNSKEKIKDNKLSGIGWNNVDESIKLTFGLDYGTNIYSEVNKGTIVK
FT                   IVIPKSI"
FT   gene            638489..640078
FT                   /locus_tag="CPR_0539"
FT   CDS_pept        638489..640078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0539"
FT                   /product="DNA-binding response regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87049"
FT                   /db_xref="GOA:Q0SVI3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI3"
FT                   /protein_id="ABG87049.1"
FT                   /translation="MFKVIIADDEKIFRIAMRNIIDWESHDFNIVGLAKDGLEVLNILK
FT                   EEGADLIITDLKMKGLNGIELIDKLKEENFMGKILVLSNHGEYELVREAMKKGADDYLL
FT                   KITLRPKELEDIIDKFRESLEERKKEEEKEAQFKNEFDKTRKIAEISLLKEYLKGDLSY
FT                   EELLSEFPKINFLDDNCEYYTGGCIYIDNYKKIYEEKIKDKNKLAITIQNIIKEEFSVN
FT                   GVKIIPINNHKYIFISKIDFNSLKIKTINIQNLIMLYLNIKVSAILIKRIDSVKGLKES
FT                   FKKVEEILSLKFYGKENFLITSEEFLGFGDAIKLRKEVTDAILENIELGEVSANKELIK
FT                   EFARRCSKMNVKPSNLINYVNFMCELIENHEYVQDDLNDIKELKGKILKSDNIEELINN
FT                   STILIDYINQRYIKSKELSYKREVNEIIKFIEKNIDKRITLVMVANAVNLNESYLSRIF
FT                   KSETGKNLMYFINEVKMKKAKELLKQQDTLVKEVANSIGMTDQFYFNRVFKKFYGVSPS
FT                   KFKSDYNNKVLS"
FT   gene            640231..641616
FT                   /locus_tag="CPR_0540"
FT   CDS_pept        640231..641616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0540"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87045"
FT                   /db_xref="GOA:Q0SVI2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI2"
FT                   /protein_id="ABG87045.1"
FT                   /translation="MKRKLVKMLTVACVTAIAASAFVGCGNKEETPKDNEKPSTEQAEG
FT                   SGEKKVLEIAVFEGGFGKDYWEACIEAFEAEHPDVEVKMEANPKIGDIIRPKLSSEKTP
FT                   DFIYLSTNDPSGIANALIKDKALVDLSDVFDREDPDNPGQKLKDKILPGFLDTPLTTPY
FT                   GDGKVFLAPLYYNVTGMWYNKALFKEKGWEVPKTWDEFFELGKKAKDEGIALYTYQGQA
FT                   PGYNEAVIFPMLASAAGEETVEKIFNYEEGAWKDPNVKKALDIFQRMADEDMVLNGTVG
FT                   MTHTQAQVEFLNGKALFLPCGSWLEGEMKDAIPEGFEFGFMAPPAFKEEDTPYVTTTIE
FT                   QMYIPAKSDQVELAKEFLAFQYTDAMVKKNAEIAKAVVPVKGAVEKAKSSLDASGYESY
FT                   KVVEEGAKPIPLSFKPTNSKLDFRNDSLFGPVGSIINKELTVDEWINNLESDSQTLAKE
FT                   VVE"
FT   gene            641695..642621
FT                   /locus_tag="CPR_0541"
FT   CDS_pept        641695..642621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0541"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86446"
FT                   /db_xref="GOA:Q0SVI1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI1"
FT                   /protein_id="ABG86446.1"
FT                   /translation="MNSNKRKIFLAMCVLPALILFTIFMLYPIGKGFMMSLYEWSGISG
FT                   EPVFVGLDNFKALLNDRYFKEAFGNTFFIIVLFPAITITLSLFLAVVITQSKLKEKNFY
FT                   RVILFFPNILSMVVIGVLFTYVYDPSIGILKAFFEMIGLDKLAGLAWLGDSKLVLWALV
FT                   ITMVWQAVGYYMVIYIAGLDGISPSLYEVCYLEGASAWQKFRYVTLPLLWDVVRVTFAF
FT                   FITGALNLSFIFVTVMTKGGPNGKSEVLLTYMYKQAFTNSQYGYAMAVGVTIFAFAMIL
FT                   ALIINKLSDSDVREEKRVKRLQQKGVR"
FT   gene            642623..643504
FT                   /locus_tag="CPR_0542"
FT   CDS_pept        642623..643504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0542"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85882"
FT                   /db_xref="GOA:Q0SVI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVI0"
FT                   /protein_id="ABG85882.1"
FT                   /translation="MLETKKKKNVGLDTENKTKKVISNTLLRIILIAATILVIVPIIWT
FT                   IMSSFKTTKEFYASPWALPKSFGFANYMTAFTEANMGAYFFNSILVTIIAMILSLCLSV
FT                   PASYVLARQKFFGCSFIKNLFMAGLFIQPVYIIVPLFTILEKMKLLNNLFALALVYAVL
FT                   SLPFSIYIMSGFMKGIAKDYEEAAMIDGCTNLQILTKIVVPLAKPGIITIMIFNFMNYW
FT                   NEYAMAMTFITDADKKTLPVGLQNLMEVQKFATDWGALFAGLVIVMVPTMVIYSLVHKK
FT                   LTEGVNIGGVKG"
FT   gene            643852..644547
FT                   /locus_tag="CPR_0543"
FT   CDS_pept        643852..644547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0543"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87425"
FT                   /db_xref="GOA:Q0SVH9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH9"
FT                   /protein_id="ABG87425.1"
FT                   /translation="MKKIVKPWVATLIILIVAFLVYFFVPTANSKINQMIFYLSSMNLD
FT                   MIKEYILSFGIWAPITSFLLMVLQSVIAPIPAFLITLSNAAIFGWVKGAILSWSSAMAG
FT                   AALCFYIARGLGRDAVEKLTSKFALKDIDGFFEKYGKHTILIARLLPFISFDLVSYAAG
FT                   LTSMNFWSFFIATGIGQLPATIVYSYVGGMLTGGAQLLMSGLLILFALSIAIYVGKKVW
FT                   NEKRGKNDK"
FT   gene            644537..645649
FT                   /locus_tag="CPR_0544"
FT   CDS_pept        644537..645649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0544"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85701"
FT                   /db_xref="GOA:Q0SVH8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH8"
FT                   /protein_id="ABG85701.1"
FT                   /translation="MTNKELKKNLEDCVNCGLCYKVCPMMNTFGDSPKNILRDIYKNKI
FT                   SYDEIAYSCMLCNACTEACPKDINLKEMFQNLRIKSYRENLKNTSKKFNLKVVQNHQKG
FT                   SFSKFLTSKNNHKKIKRVFIPGCSLSGYNNEIIFKIKDYLIENLGEVEILLKCCGKPSK
FT                   DIGNLELFESNLNDIENNLKIKEVDEIIVACENCYKTFGSAFKDIKVITLWEVINEFGV
FT                   PKELKNKYSDLKEEFALHDPCPIKKEEQIHEAVRSILKDLGIKIVEFEKNRSKTECCGC
FT                   GGMVGVTNKELWLSQKNKRANSTECENIVSYCESCVNTFKSSDKNALHILDFIFNEDVI
FT                   NGKAKSQKNISTINQWINRIKLANKLGKES"
FT   gene            645813..646400
FT                   /locus_tag="CPR_0545"
FT   CDS_pept        645813..646400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0545"
FT                   /product="CDP-alcohol phosphatidyltransferase family"
FT                   /note="identified by match to protein family HMM PF01066"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87554"
FT                   /db_xref="GOA:Q0SVH7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH7"
FT                   /protein_id="ABG87554.1"
FT                   /translation="MLDTYGRKYVNPIIDLGANTLLKLRLTPNGVSIIALIIGVLSSVF
FT                   LYFDKLILSVVFLWISGYLDSVDGAMARKKDLTSPFGTLLDITFDRIVELSIIFVLALK
FT                   FQNSRLYLLILTMMILISMTIFLTVGALAQNNGMKSFRYQAGLAERSEGFICFSFMILL
FT                   SSIKLNLVTNIFSLIIFITIIQRALEAKKLLK"
FT   gene            646419..646982
FT                   /locus_tag="CPR_0546"
FT   CDS_pept        646419..646982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0546"
FT                   /product="ISCpe2, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85642"
FT                   /db_xref="GOA:Q0SVH6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH6"
FT                   /protein_id="ABG85642.1"
FT                   /translation="MPLARTPVISIMGVLAATYAKSINRLTLANKLYFSFKYFTYVKLN
FT                   NNIIKEVVIMAQVKQGRGYVYCIQYHIVWCVKYRRKVLFGDVDKSLKEIILKIANDNNF
FT                   EISEMETDKDHIHLLIECSPQHQIPNIIKALKGVSARLLFLKHPEIKRYLWEGNLWNPS
FT                   YFVATVSENTEEQIRNYIQNQQVK"
FT   gene            646993..648147
FT                   /locus_tag="CPR_0547"
FT   CDS_pept        646993..648147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0547"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86038"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH5"
FT                   /protein_id="ABG86038.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLDA
FT                   GYDKYYKKTGSRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVKIENSR
FT                   NVDGNIKRVTVSRTQSGKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEAN
FT                   PKHFRKAEKRLIKLQRDLARKEYNSKNYHKNRIMIAKLHERIANQRMDFLQKFSTKLIR
FT                   ENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAEWYGREIVIAPPDYASSQ
FT                   LCSECGYKNIEVKNLGLREWVCPECGTHHQRDLNASINLEKLIA"
FT   gene            648503..649135
FT                   /locus_tag="CPR_0548"
FT   CDS_pept        648503..649135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR33720.1; match to
FT                   protein family HMM PF01865"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87116"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH4"
FT                   /protein_id="ABG87116.1"
FT                   /translation="MFNLNPKDDKFYDMFIDEAKNVEKAAVILSEALGDLENKTSHVAR
FT                   VEELEHKGDEIVHRLIEELNNSFITPIDREDIFSITKRMDDILDSIESTMHRFTMFNIN
FT                   ESKEGAKVLGSLIVDASRELVSLMEEFKHMKKKNKEITERVISINKIENKGDIFYRQMI
FT                   SELFDEDGKTPVLDIIKWREIYKFLEATLDSCEAVANIVEGVVMKYV"
FT   gene            649128..650126
FT                   /locus_tag="CPR_0549"
FT   CDS_pept        649128..650126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0549"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87541"
FT                   /db_xref="GOA:Q0SVH3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH3"
FT                   /protein_id="ABG87541.1"
FT                   /translation="MSSTLAVTVVIILLTLAFDFINGFHDTATAVATSISTRALSPKAA
FT                   IALCAIFNFIGAFLGTEVAKTVGDGIVDQNKIPLWVIAAVILGAIIWNLITWYFGIPSS
FT                   SSHALIGSLIGGGIAYSHSINIVSWGTLFDEVILWLILSPIIGLIVGYIFMILLNWALR
FT                   RCKPGPVNRIFSKLQVVSGALMALNHGGNDAQKSMGIITMALLSGGFLSTFEVPTWVIA
FT                   LCAIAMATGTSIGGQKIIKTMGSGVAKLNAVNGFAAQTGAAGVIGIATMFHAPVSTTHI
FT                   ITTTIMGVGASKNPKAVKWGVAKNIVWAWILTIPISACIAAIVVEIFKFIL"
FT   gene            complement(650364..652256)
FT                   /gene="fruA"
FT                   /locus_tag="CPR_0550"
FT   CDS_pept        complement(650364..652256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="CPR_0550"
FT                   /product="PTS system, fructose-specific, IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85367"
FT                   /db_xref="GOA:Q0SVH2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH2"
FT                   /protein_id="ABG85367.1"
FT                   /translation="MKISQLLSLDTIKLDLAASNKNEVIDQLVDVLWDAGKLTDKNLYK
FT                   EEILKRESLSSTGIGERIAIPHAKTKAVKNASLALGLYKDGVDYDSLDGEPVNIVFMIA
FT                   APDGANDEHLETLSRLSVLLMNPDFKNGLLNAKTPEEVISLLDKFEENEESDEINNSNE
FT                   IENNSNKKYILAVTACPTGIAHTYMAADSLNKTAKEMDINIKVETNGSTGVKNRLTQED
FT                   IDNADGIIVAADKQVEMARFNGKKVVIVPVVQAMKRPKELINEALSGSAPVYSHSGDSS
FT                   NQSSGKTERRGFYKHLMNGVSNMLPFVVGGGILIAISFMFGIHSAEINDPTFSPIAKLL
FT                   KDIGGGNAFFLMIPVLAGFIGSSIADRPGFAPAMVGGLIAANSGSGFLGGLIAGFLGGY
FT                   VVVLLKKIFSKLPQSLEGIKPVLLYPLFGILITGALMYLVIVGPVTALNNNIAIWLQNM
FT                   GTGNLVLLGIVLGGMMAIDMGGPINKAAFTFGIAMIASGNYYPHAAIMAGGMVPPLATA
FT                   LATTFFKNKFTKDERDAGTTNYIMGLTFITEGAIPFAAADPFRVIPACVIGSALAGGLS
FT                   MVFKIGLPAPHGGIFVIPVVEGNPLLYLLSILIGSIVAALIIGFLKKPVNEINK"
FT   gene            complement(652260..653180)
FT                   /gene="fruK"
FT                   /locus_tag="CPR_0551"
FT   CDS_pept        complement(652260..653180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="CPR_0551"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM TIGR03168"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85684"
FT                   /db_xref="GOA:Q0SVH1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH1"
FT                   /protein_id="ABG85684.1"
FT                   /translation="MIYTLTLNPSIDYVIDVENLELGKVNRTSKDFKFPGGKGINVSRI
FT                   LGNQKIDNIALGFLGGFTGKFIEDNLKALGVKTEFIKVKGDSRINVKIKSNEETEINGT
FT                   GPMIASEELEALFNRLDQLVEGDILVLAGSIPSTLPKDLYLQIQKRVSKKNVKVVVDTS
FT                   GKALLEAIKNKPFLIKPNNHEIEEIFNVKINSEKELIKYGKKLVSLGAENVIISMAGDG
FT                   ALLITKDGVFKGNAPKGEVKNSVGAGDSLVGGFLAKYVETKDLIASFKNGIASGSASAF
FT                   SLDLALAEDVNKLLPIIKIEKYEEV"
FT   gene            complement(653180..653926)
FT                   /locus_tag="CPR_0552"
FT   CDS_pept        complement(653180..653926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0552"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86398"
FT                   /db_xref="GOA:Q0SVH0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVH0"
FT                   /protein_id="ABG86398.1"
FT                   /translation="MLSEKRHEIILNLLKLKGFVSLAELLEATESSESTIRRDLSYLES
FT                   INLLKRVHGGAKSLTNVSKELSYNEKSSKSIHEKRAIAKYAASLIEDGDCIFIDAGTTT
FT                   YELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIGGNIKISTKAITGCDALMCLSKFR
FT                   FDKCFIGANGVHHIYGLTTPDTEEAILKECAINNSRKSYVLADDSKFGEISTIKFSDIN
FT                   KCVIITNEKPKDNAYDKKTDIKVVDI"
FT   gene            654217..654669
FT                   /locus_tag="CPR_0553"
FT   CDS_pept        654217..654669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87234"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG9"
FT                   /protein_id="ABG87234.1"
FT                   /translation="MLNKSDNEIYIMAPGEGNVLDYIVLNKAFNLEDLEEIISLNSHNE
FT                   FLFSPVNGKVIYISKDYGFIEIGMKEGVNIIVSTHINNNIKAIEPIVDIGGEVLTGQIL
FT                   MYFEKESDCDIPVTVAIKKSHSILKIVKSKNKNIVLNEYIMKLNLI"
FT   gene            complement(654719..655819)
FT                   /locus_tag="CPR_0554"
FT   CDS_pept        complement(654719..655819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0554"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86132"
FT                   /db_xref="GOA:Q0SVG8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG8"
FT                   /protein_id="ABG86132.1"
FT                   /translation="MNNFFRNNKSYIKMVLVIVVSYLSIKLIDNIPSVMSAIHTILAVL
FT                   LPFLLAFIIAYILNPIVNLFSKKFKLSRGISIVITYLIFVTSISLAATYLLPKLYTSLI
FT                   ELIDNIPAFTNYVQNLFTEIMASFKVPEGINSYLPHGDTNKLITFIGSMVTLLSNWLLD
FT                   AAISLTSSIINWIFGFLISIYVLVDKDKFLAHSSKVTRIIFGKNLGDEILEFIKILNEK
FT                   IGTYVGIKAIDSLIIGLLAFVGLTVIKSEYALLLSVLVGITNMIPYFGPFIGMVVGFFI
FT                   NVFISPMKAVIVLIYLFILQQFDAWYLDPKLIGNRVGLSPFLVILGVTLGGAIYGPIGM
FT                   ILGSPVMSVIRIYTLKLIKKFEYRAE"
FT   gene            656116..656736
FT                   /locus_tag="CPR_0555"
FT   CDS_pept        656116..656736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0555"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85936"
FT                   /db_xref="GOA:Q0SVG7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG7"
FT                   /protein_id="ABG85936.1"
FT                   /translation="MISGIYERIQSLESLDLKSLDKNRTILLIVDINKGFAKAGALYSD
FT                   RIEKLINPISNLAKYALNNGIKVKAFTDYHTEDSIELKAYPKHCMKDTDEWELVEELNL
FT                   EGIEVIKKNSTNGFLEENFILNKEEIDNVIIVGDCTDICIYQLAISLRAEFNRVNKDGE
FT                   IYVPKKLVDTFDMPMHKANFMNYVFLNSMIDNGVNVIEDIILD"
FT   gene            656994..658307
FT                   /locus_tag="CPR_0556"
FT   CDS_pept        656994..658307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0556"
FT                   /product="voltage-gated chloride channel family protein"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87841"
FT                   /db_xref="GOA:Q0SVG6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG6"
FT                   /protein_id="ABG87841.1"
FT                   /translation="MKQKSKKYLKYISSNNTFLLGKTFLKWLLIGSLIGIFIGGVIAIF
FT                   LKSLEWATDYRVNHGFVLFLLPIGGALVSFLYYKFGRNSVKGNNLIIENINNYCGDVPL
FT                   RMVPLVFFGTVVTHFFGGSAGREGTGVQIGASIAETIGKLLKLNKEDSKIMLMAGVSGG
FT                   FSAIFGTPLAGTIFGLEVSVLGKMSYEALIPSFFASIVGNEVVKNLGVHHSHYKVLGVP
FT                   DISALIILKVIISAICFGLASRLFSELTHKLKKVFSNKFKNTSLKSFVGGCIVILLVYL
FT                   VGSRKYLGLSLPLLSEAFNGHISPFDFLGKLIFTSITLGAGYQGGEVTPLFVIGSTLGN
FT                   TLSGILNLSPSFLASLGLVGVFAGATNTPIASFVLGIEMFGVGGAPYLFMACAISYIFS
FT                   GHTGIYTSQKIGVSKSNLISFSHDSTLASLSKREEEKL"
FT   gene            658610..659533
FT                   /locus_tag="CPR_0557"
FT   CDS_pept        658610..659533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0557"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87023"
FT                   /db_xref="GOA:Q0SVG5"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG5"
FT                   /protein_id="ABG87023.1"
FT                   /translation="MDINLDALVEANRKYTKDGHVATYIPALAKVNPNQLGVCIYDLKE
FT                   NKKFSAGEYDVRFAIESISKVPTLILAILDNGIEKVFSEVGTEPSGFAFNSIMNMQINH
FT                   KNKPSNPFINAGAIKVVSLLKGKNDEERFKRILDFYRKIMNDDEITLDTEIYLSERETG
FT                   DINRSLAYYMKGNGIMEGDVTDILDSYFKQCSVLVTAEDLARLGAVLANEGVMPWNGER
FT                   LFSVETATVVKSLMTTYGLYDESGAFSVHIGLPSKSGVGGGILSSVPNKCGIGLFSPAL
FT                   DVPGNSVTSMKLLKEIADKLKLDIFR"
FT   gene            659866..660588
FT                   /locus_tag="CPR_0558"
FT   CDS_pept        659866..660588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0558"
FT                   /product="MgtC family protein"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86468"
FT                   /db_xref="GOA:Q0SVG4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG4"
FT                   /protein_id="ABG86468.1"
FT                   /translation="MGLTLSLKDIIIRLLLATIVGGVIGYEREYHNRAAGFRTQILVCV
FT                   GAAIVSLIEIRLGQDVFEFVKDNYYIRSVIKIDYARLGSQFISGIGFLGAGTILQNKGS
FT                   VKGLTTAASLWVVACLGLAIGMGYYNLGILGFLFIFLTLVSLKKFQSKFITKAGEKCFE
FT                   IIYEKDSQVLEFIDKIFTQKGVKIKSIEFFGRNNNEAVQYKNAIYRVELPNYIEVGEII
FT                   NKLSINDGIIKISEYNDI"
FT   gene            665896..665970
FT                   /locus_tag="CPR_0559"
FT   tRNA            665896..665970
FT                   /locus_tag="CPR_0559"
FT                   /product="tRNA-Glu"
FT   gene            666620..667312
FT                   /gene="sfsA"
FT                   /locus_tag="CPR_0560"
FT   CDS_pept        666620..667312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="CPR_0560"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87704"
FT                   /db_xref="GOA:Q0SVG3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVG3"
FT                   /protein_id="ABG87704.1"
FT                   /translation="MKYNSVIRKAIFLRRPNRFQAYVVLDDEELLVHVPNTGRCREILK
FT                   EGCTVLLRKGTTPNRKTPYDLIAAYKGEILINIDSQIPNKVVEEALINKKIEKLVNFNN
FT                   ISREKTFGNSRFDFKLQDDNENIYFLEVKGVTLEENGETRFPDAPTERGKKHILELIEI
FT                   KKLGMGAGIIFLIQIDNVNKFSPNDETDPKFGEALRLAKKEGVDIFAYNCKVTEEEIEL
FT                   LNPVEIVL"
FT   gene            667786..668325
FT                   /locus_tag="CPR_0561"
FT   CDS_pept        667786..668325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0561"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86220"
FT                   /db_xref="GOA:Q0SVG2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG2"
FT                   /protein_id="ABG86220.1"
FT                   /translation="MKFKYCPLCGEKLELKNSWDEGMIPYCSKHDMMFFDLPKPCIVVA
FT                   VIKGDEIILLKQSYIYENSKVLISGYVGVDECAEETVYREVKEETGITVKDIKYLGSDF
FT                   VQGKELLMLTYLAYYESGEIEKSTEVEGAAWYNIEDALCELNEDSIGKRVVKKVLKEIG
FT                   YEGTNAFRCEGSNCNV"
FT   gene            668735..670030
FT                   /gene="lysA"
FT                   /locus_tag="CPR_0562"
FT   CDS_pept        668735..670030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="CPR_0562"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by similarity to SP:P23630; match to
FT                   protein family HMM PF00278; match to protein family HMM
FT                   PF02784; match to protein family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86356"
FT                   /db_xref="GOA:Q0SVG1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG1"
FT                   /protein_id="ABG86356.1"
FT                   /translation="MKLFGSMKVEGNELYVGGVKASDLSKEYGTPLYVIDEELVRGNCR
FT                   RYYNAMKCEERGNRVTYAGKAFINMSMCNLVNEENLYLDVVSGGELYTAYKAGFPLERI
FT                   YFHGNNKSDYEIDLGVRLGIGRFIVDNIHELEVLNSIAQEYGRVQKVYLRITPGVEAHT
FT                   HEYIKTGQLDSKFGFPVIGDTVYDAIKRAMELEYIELNGLHCHIGSQIFDLEPFEDTTE
FT                   IMLNLINDIKETLGYEIKELDLGGGFGIYYTEGDKPKEIEEYCSVIINKADEICRKLNM
FT                   NVPILSIEPGRSIVGNAGLTLYTVGAIKEIPNIRKYVSVDGGMSDNIRPALYSANYESI
FT                   IANRVFDNSKEIVTVAGKCCESGDVLLNSIEMPRMETGDILAIISTGAYGHSMANNYNR
FT                   IPKAAVVSVSNGISKVMCKRETYEDLLRNECF"
FT   gene            670388..670654
FT                   /locus_tag="CPR_0563"
FT   CDS_pept        670388..670654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE77690.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85669"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVG0"
FT                   /protein_id="ABG85669.1"
FT                   /translation="MILKISHTNIRSKEYKMKKIIVDRIEGHFIVCEDEKENILELKKD
FT                   DVIGDVKEGDVLVKGKEGKFCLDKVLTEKRKKEIEDLMKGMWE"
FT   gene            670657..671187
FT                   /locus_tag="CPR_0564"
FT   CDS_pept        670657..671187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0564"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86410"
FT                   /db_xref="GOA:Q0SVF9"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF9"
FT                   /protein_id="ABG86410.1"
FT                   /translation="MSSSNTKKKSFFLDWIIPILAALILAALIHKFLLFKIKVPTGSMM
FT                   PTVEIGDQLFVTKIYNPNNIKRGDIVVFNSDELKEPLLKRVIGLPGEHVEIKSDGSVYI
FT                   NGNKLEEDYVKYQGGKTDMSFDVPSGKFLMLGDNRNNSDDARYWNNPYIDGKDIEAKAQ
FT                   LTVYPFDRIGFVK"
FT   gene            671212..673353
FT                   /gene="ftsH"
FT                   /locus_tag="CPR_0565"
FT   CDS_pept        671212..673353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="CPR_0565"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87131"
FT                   /db_xref="GOA:Q0SVF8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF8"
FT                   /protein_id="ABG87131.1"
FT                   /translation="MFKDKKMLKYIVIYSIIAFGILLTFNMVKDEMLYEKVDYSTFMQM
FT                   LDKKEVKSVNFSGNQIEITPSDSSNLKGKILYTTNPAVAGISQPDLIKDLTAAGVGFNV
FT                   TKPENYQLLGLLMSWVFPLILIFFVGRMMFSKMNNKMGGGVMSFGKNNAKLYAENETGI
FT                   TFKDVAGQDEAKESLVEIVDFLHDTRKYVEIGAKLPKGALLVGPPGTGKTLLAKAVAGE
FT                   AKVPFFSMSGSDFVEMFVGMGAARVRDLFKQAEEKAPCIVFIDEIDAIGKSRDGAIQGN
FT                   DEREQTLNQLLTEMDGFDSSKGVVILAATNRPEVLDKALLRPGRFDRRIIVDRPDLIGR
FT                   EEILKVHSRDVKLSDDVSLEEIAKSTPGAVGADLANIVNEAALRAVKHGRKFVIQEDLD
FT                   EAVEVIIAGQEKRDRILSPKEKKIVAYHEVGHALVAALLNNTDPVHKITIVPRTMGALG
FT                   YTMQLPEEEKYLVSKEEMIDQISVMLGGRAAEEVVFNSITTGASNDIERATQSARNMIT
FT                   IYGMSERFDMMALEAMSNRYLDGRPVRNCSETTAAIADEEVLQVIKKAHEKSIKILIEN
FT                   RELLDEITGVLLDKETIMGDEFMEIVYGKYPEKREADEKAKKEIQSLREQALAKRKEKE
FT                   EAIKKAREEALRLEEEQRKQAELKAMIEAQEEAAKLSRANNEALDSSKENEEVKSNVND
FT                   GATEEKKDDSSTNNKVDGE"
FT   gene            673573..675693
FT                   /locus_tag="CPR_0566"
FT   CDS_pept        673573..675693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABR36889.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87762"
FT                   /db_xref="GOA:Q0SVF7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF7"
FT                   /protein_id="ABG87762.1"
FT                   /translation="MTDKKDIEFLVEEKKLEEVSNILNEEMLSYINKRKFVTQYILDYR
FT                   KNAVEEYKDDEDKLIEYFDHERYVKEQAFTTIDKKLKELTILKESPYFGRVTFNDLEFD
FT                   QKDTLYVGRFGVTPEGSYEPVIVDWRAPVASLFYHGSLGEASYTSPDGPIKCDIEGRRQ
FT                   IIVKKGELKGVFDSAIDVKDDILQMVLSNNSSDKLKDVIMTIQQEQDEIIRKERTSNIV
FT                   VNGVAGSGKTTIALHRVAYLLYNYRKELEDKVLILGPNGIFMEYISQVLPSLGEVGVKQ
FT                   ETFASFALKEMDSELYIMSFDKYLEKILSEDKEFIEDAKYKNSYEIIKDLDNLVKDMDK
FT                   DYFHVEDVKYFGDLVISKEEIEEMFNKHYEYMPLFRRSEKIKRIILSKIKDKRDEKVWE
FT                   LNEELRKEKEKLTPEELLIEENNLEFRRKLRIREIVKEVMDSRAKLDSWISREDVLDIY
FT                   DRFNGNKKEYTINDLAPILYLAIKLEGKKATKDYRHVVIDEAQDYSPLQFKVVRELTGT
FT                   KYFTVVGDVNQRLIKYSDLAPMMELGKIFDDVNPEIYNLNKSYRSTYEIMEYANKYLDE
FT                   DRIIPIVRHGKPVEEIELHNNEELSESIIESLKEFSNEGLESIAIITRDKEELEKVYNL
FT                   ISNKVHLVKFDNEDVLYKGGNVIIPSYFAKGLEFDGVIIVDNGSSKDENEDLIKYIMST
FT                   RALHRLKEIQFK"
FT   gene            676152..676988
FT                   /locus_tag="CPR_0567"
FT   CDS_pept        676152..676988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0567"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="permease protein homolog lin2352; identified by
FT                   match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85477"
FT                   /db_xref="GOA:Q0SVF6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF6"
FT                   /protein_id="ABG85477.1"
FT                   /translation="MKKNIFKKMLSVAMIGGLTLSLAGCGAKTAKENGSNDKVAKIKES
FT                   GKLVVGLSADYAPYEFHIMKDGKDQIVGLDIDIAKEVAKNLGVDLEIKEMEFGAIIQSV
FT                   KNGMIDMGISGITPDEKRKEAVDFSDIYYEAEQGILINKDNKESIKGIGDLKGKKVGAQ
FT                   MGSIQAEIAKGIEGADVKLLDNVNTLILELKTGKLDAVITELPVAKIASEVNSELAVAD
FT                   EVIKNSEGGSAIAIQKGNKDLVDEVNSTIKELKENGKIDQFTNDAIELVPYQKKEE"
FT   gene            677019..677690
FT                   /locus_tag="CPR_0568"
FT   CDS_pept        677019..677690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0568"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86275"
FT                   /db_xref="GOA:Q0SVF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF5"
FT                   /protein_id="ABG86275.1"
FT                   /translation="MGGLDFSFLKEYFPVFLEGAKWTLIISAITVILGALLGTILCFMK
FT                   RFKFSIFKVKILRVISTAYVEVIRGTPLLLQIYIVYFGLPSFGIQLEVLPSCIIAISLN
FT                   SAAYVSEIIRAGIDAVDKGQLEAARSLGMTEGMAMRLIILPQAIKNILPAIGNEFVAII
FT                   KESSMASTIGVAELMYSSKIVTGATYKGFEPLIVIAMFYFVMTFSLGRVMSYVEKRLSK
FT                   S"
FT   gene            677687..678409
FT                   /locus_tag="CPR_0569"
FT   CDS_pept        677687..678409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0569"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86639"
FT                   /db_xref="GOA:Q0SVF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF4"
FT                   /protein_id="ABG86639.1"
FT                   /translation="MINVRNLYKSFGKNEVLKDINETIKKGEVVVIIGPSGSGKSTFLR
FT                   CLNLLEEPTSGVINFEGEDITDKNVDINKIREKMGMVFQQFNLFPHKTVMENLTIGPTK
FT                   IKKISNGNAVKKGSELLEKVGLLDKKNVYPNSLSGGQKQRIAIARALAMEPDVMLFDEP
FT                   TSALDPEMVGEVLGVMKSLAKDGMTMVVVTHEMGFAREVGDRILFMDEGRIIEEGTPEE
FT                   IFQNPKNSRTKDFLSKVL"
FT   gene            678647..680455
FT                   /locus_tag="CPR_0570"
FT   CDS_pept        678647..680455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0570"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86958"
FT                   /db_xref="GOA:Q0SVF3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF3"
FT                   /protein_id="ABG86958.1"
FT                   /translation="MKEKVKSFFKCNWVFIFLVITLQIKSMLLLSMLRTPGSRGINFDL
FT                   MYFTPPAWWAHIAIVTLIASFVYLFKGKGRIWAGIVIDILVTILFVADIWYYRVNGTFL
FT                   SIRHIIEPGIFNPVGKSLFNLAKVDVVFIVDFIILFLVYNFTGLKNVKYKNNIKTRLIA
FT                   FICLFGISATVIGVSHYYIDIEKKSDKSFLRISWAPFQTISDSSPLGYHGYDIYYYANR
FT                   KETLTDAQKNEIKTWFDENKEDLPDNKYKGMLQGKNVIALQVESLENFVIGKKVYGQEI
FT                   TPNINKLLKNSLYFDNIKEQNNSGTSSDCDIMVNTSILPVREGTTVFGYPWAEYNTLQK
FT                   ILKSKGYSTVSTHPEVPGNWNWAEVHKAFKADEIWDAHQFDQSEIIGLGMSDESYLRQV
FT                   GERLKSQKQPFYTFLVTLTSHGPFDMPKDKQYLNLPEDLNENMLGAYFQSVRYTDEAIG
FT                   EFINQLKEEGLLDNTVIMIYGDHGGVHKFYEDKIKDAPLEGDWWKDDEKEIPFLIYNPS
FT                   INGETISKEGGQIDFLPTIAYLLGFNRDTFDNTAMGRVLVNTNRNASILNNGEIVGNPT
FT                   PEEKAHLEKSFNIADMIIQGNYFKNN"
FT   gene            680759..681463
FT                   /locus_tag="CPR_0571"
FT   CDS_pept        680759..681463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0571"
FT                   /product="glycosyltransferase ycbB"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85535"
FT                   /db_xref="GOA:Q0SVF2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF2"
FT                   /protein_id="ABG85535.1"
FT                   /translation="MDKILLIIPAFNESENLPKLIASIKKESYDYDVLIINDYSTDNTG
FT                   KVAKELGVNVINLPCNLGIGGAVQTGYKYAYENEYDYAIQVDGDGQHDPIYLELLHKKI
FT                   KEGYNFVIGSRFIEKKGFQSTFIRRVGIQFFYHLIKFLGKEKITDATSGFRIADKSVIK
FT                   LFSQYYPSDYPEPETIMLLIKNNFKIAEIPVVMKERENGKSSINIIKSIYYMIKVTLAI
FT                   ILSYFSKKRSYV"
FT   gene            681465..681815
FT                   /locus_tag="CPR_0572"
FT   CDS_pept        681465..681815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0572"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to GB:AAS44458.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85943"
FT                   /db_xref="GOA:Q0SVF1"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF1"
FT                   /protein_id="ABG85943.1"
FT                   /translation="MDRVLQFIILSVCILFTIYIIKMINKEKLELKYALTWLFSSLGLI
FT                   IIAVFPQILDWVSVILHILSPVNALFLIVIFFLLVIIFTLTVAISKSKKQIIAISQEVG
FT                   ILKEKIERGENN"
FT   gene            681802..682158
FT                   /locus_tag="CPR_0573"
FT   CDS_pept        681802..682158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0573"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86587"
FT                   /db_xref="GOA:Q0SVF0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVF0"
FT                   /protein_id="ABG86587.1"
FT                   /translation="MRIIKAVFLVLVNCIMLVSGQILWKIGLKDASMGSVKDIILLMFN
FT                   KYVFSGLVIYALATIYWFYIIKTNDLSKVYPMQSMSYIISLFMSYYILKESISINSILG
FT                   TIVILLGVFIIAMK"
FT   gene            682173..683441
FT                   /locus_tag="CPR_0574"
FT   CDS_pept        682173..683441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0574"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85858"
FT                   /db_xref="GOA:Q0SVE9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE9"
FT                   /protein_id="ABG85858.1"
FT                   /translation="MTFWEKDKRYRYTLWLCILVMFVIGTVCTLKYGNYFLLGDLDKLN
FT                   NDDVRYLHTAKVLAEQGKLVYHNMDPTLFIMPGYPIFIALIVKIFGSGSLGIIAIRMSQ
FT                   LVLQCVCLYILYFLAKELVNKKTAIIACILTVLYLPEYVAANLILTEVLYKTLYMLLFY
FT                   FSIIAIRKNKTKYYVFSGISWALVCLVRPNAAAFPLFIIIFWIVNKYSIKDMIKYTSIV
FT                   FVIFVTLFSPWWIRNYKLTNKFVLFTESSANPKLLGTFIRWGAPSFYKDIPKEYKYDEF
FT                   LNDEYLTEDEQNNLANYMIKRSFQEEPLKYTYWYTLGKTEELYKEAYYWKPIFRVNDTR
FT                   MNFTHISYITLGILGIIAMIRRKIKGGKMLIVFLLINTAVYLPFITFSRYGYPNIFVFI
FT                   IGAAYTLNVLFCKDEIQSEKSLI"
FT   gene            683456..685282
FT                   /locus_tag="CPR_0575"
FT   CDS_pept        683456..685282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0575"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87693"
FT                   /db_xref="GOA:Q0SVE8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE8"
FT                   /protein_id="ABG87693.1"
FT                   /translation="MKKNEYRFLSILNNKFLLFFLFSLLIIIKEVFFTWIWSSSDSIAK
FT                   LQIFNMYMYWPKLLIHIVFAMTIASGIFLFNKNGRIIYILIADIVITILMFLDISYYRN
FT                   YGNFLSIRHLFHEELFNPLNKELFNFYKRDILLLIDFIILVPLSIFSLKNDSGKKSRRS
FT                   IKIFILSWIINGIIIYTSHSLVDIKGVTNGKLTLFEKSFAPQVNMDDLGMVGYHEYDLT
FT                   SYILKKDKKLSTEEKVEINKWFEENKETLPDNKYKGLGKGKNLIIIQWESLENFAINYK
FT                   VDGQEITPNMNKLLSNSLCFDNIYEQNKNGTTSDAELMANTSLLPISESAYFIQYPWKK
FT                   QNTLQRLLEKHGYNTATAIADKGGVWNWLENHKSFGVQTIWDSSYFNRDELIGSNITDG
FT                   SLFRQTEEKIKTLKRPYYLFMATATSHGPFDLPTNYRELKLPKEIDDTKLGGYLQSLRY
FT                   TDKMLGEFLNKLKGDGVLDNSIIVIYGDHGGINKYYKKELENIDFANNNWKQEYLKVPM
FT                   LIYNPEIKGEVINTYGGLVDLLPTVGYIMGVDKSDFEKTAMGRVLVNTNVNATINSSGQ
FT                   ILGNPKDEKEIRHLQDMYKISNNIIESNYFNN"
FT   gene            complement(685339..686520)
FT                   /locus_tag="CPR_0576"
FT   CDS_pept        complement(685339..686520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0576"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87538"
FT                   /db_xref="GOA:Q0SVE7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE7"
FT                   /protein_id="ABG87538.1"
FT                   /translation="MFSNLIIKTFIKDYKNTENESVRSSYGYLASIVGIIVNIILFLIK
FT                   FSVGLISASIAITADAFNNLSDAGSSVITMIGFKLAKMPADKEHPFGHGRIEYISALIV
FT                   AFMVMLVGFQFTKSSIERILNPTPVTFEVIPFILLIVSIFFKFWLSRFNKLTGNRINSS
FT                   ALKAASVDALGDVFTSTCVVISFLAAKFTTFPIDGYIGVIVSLAILYAGFTLVKETINP
FT                   LLGEAPDPELAKNIREMVLSYDHIIGVHDLIIHNYGVGKCMASIHAEIPSDINVMKIHD
FT                   IIDMAEREISKKLKIYLVIHMDPICLEDDEIKQAKEEIDKIIKYNPLIESMHDFRIVGH
FT                   GNKKNLIFDIVVNPEKLRKVMSESELKEEIIKAVKETHPQYNCIITIDKDFTC"
FT   gene            686886..688181
FT                   /locus_tag="CPR_0577"
FT   CDS_pept        686886..688181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0577"
FT                   /product="zinc metalloprotease, aminopeptidase I family"
FT                   /note="identified by match to protein family HMM PF02127"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87827"
FT                   /db_xref="GOA:Q0SVE6"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE6"
FT                   /protein_id="ABG87827.1"
FT                   /translation="MERVFANELINFLYESPTAFHAVKNVKDTLEFEGFKELKEADRWN
FT                   LEVEGKYFVTKNDSALIAFRVGKGDIAENGFKIIGAHTDSPGFRIKPNPEITVENTYVK
FT                   LNTEVYGGPILNTWFDRPLALAGRVSLVSKNPLKPVNKIVNINRPILIIPNLAIHMNRE
FT                   VNEGYKINRQKDTLPLLSLVNETLEKGNYLVELLAKELYCEKEDILDFELYPYEYEKGC
FT                   LMGLNEEFISSGRLDDLSMVHAGIKALMDAEVSQATNVMVCFDNEEVGSATKQGGDSDF
FT                   LKTILERIVLALGKDREDFLRSLSESFMISADLAHAVHPNLGEKHDPVVRPVLGKGPVI
FT                   KIAASQSYTSDSDSSAVYEMICRNAGVNVQKFVNRSDMRGGSTIGPISSTHLPIRSVDM
FT                   GTPILAMHSIREFGAVKDHFDCIKSFTEFFRI"
FT   gene            complement(688273..688467)
FT                   /locus_tag="CPR_0578"
FT   CDS_pept        complement(688273..688467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:E96976"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86116"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE5"
FT                   /protein_id="ABG86116.1"
FT                   /translation="MSKKYPPKDRDFYSPEKHDLVSYSKTGKTYTKLPNPLEDDIVCNN
FT                   ISYSEFDYIEGDMLDDDDI"
FT   gene            688858..689697
FT                   /locus_tag="CPR_0579"
FT   CDS_pept        688858..689697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0579"
FT                   /product="HAD hydrolase, IIB family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85565"
FT                   /db_xref="GOA:Q0SVE4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE4"
FT                   /protein_id="ABG85565.1"
FT                   /translation="MSYKLICIDMDGTLLNNKHEISERNKEAIKKATERGVKVAVTTGR
FT                   LFTSAKYYAGLLGVKTPIISCNGAFIREKDEDKVIYESVLNEDQLDRIYNVIKKYDINM
FT                   AYFNTPNTVISEKIVPEEHGYKVMNKMMGESKEKVMFSEGIDFREAFKTYGKHILKAIC
FT                   IENDSNKLNDLFKAKEELKKYEDLEVVSSSPSNFEVMNKGTSKGRAVKVLADILNINRE
FT                   EVMCLGDSENDLSMIEFAGLGVAMGNAEEFLKEKADYITDTNENDGVAKAIEKFVLD"
FT   gene            complement(689905..693234)
FT                   /locus_tag="CPR_0580"
FT   CDS_pept        complement(689905..693234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0580"
FT                   /product="membrane protein, MmpL family"
FT                   /note="similar to B. subtilis YdgH protein; identified by
FT                   match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87588"
FT                   /db_xref="GOA:Q0SVE3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE3"
FT                   /protein_id="ABG87588.1"
FT                   /translation="MKDNILKKIKLNKPLSFFILIIWCAVVAFLFLTAPSLSKLVSEKG
FT                   GIQLPDDYSSKISDILQSDNKFNSKDSYIAVFHSSNKLTDENLKNIKDTIDRLKSKENS
FT                   DYIQSINDSFDTPQLKNQLNSENGKTIIALMTVNPKDSSVSTIEKTLNDELKTPGVETY
FT                   VTGQSLIENDVNVAAQKGLNKTQTITVIFIFIVLILLFKSVVTPFIPLLTVGISYLGAQ
FT                   SVVGILADKFNFPLSNYTQIFMICIMFGIGTDYSILLLNRFKEELANGNNKLDSVKTTF
FT                   KTAGKTVLSSATPVFVVFASLNFIGFNLYRSAVAVAIGILFLIAALFTIFPAIMIILGK
FT                   NIFWPVKGTFKAEENRLWAKLANKAFSKPIPILGAIFTILLLPILFNNFHQSFNNLNEI
FT                   GDTYSAKEGFNIIADDFGIGQASPVSIYIENDDDMRKPEYVALIEKLSNNLQNSSNDIK
FT                   SVLSVTRPTGVRLDEIYVNDQASQVSQGIDKANNGLNKINDGLSDASKKIDSSKSKLKG
FT                   AEEGTAKLQEGTKKTETGVSKLQSALNKLVESIREEHNGATELKDSIDGALDKVNSLKL
FT                   SKSQLEEDYSAIVNSANDVLENLNKISSLTGNPNSVNVDTSKLKESLSSLNSHLSEYSK
FT                   SHPEVLNDENFKKFSDDINNLNNNSNNLQGTFNNTPEIKAINESIGALKVLINTLNSKK
FT                   DTVINDLDKFNSGISEIENGLKALDSGLGKSLAGGEEISSKVPEISNALNQIANGQSKI
FT                   QDGFKEFSGQINELSNGLEAGSNGLTEIQNGLKYANGFINDWSNLSYNLSGICVPIEVF
FT                   SNDEFKKSLNQYMSSDGKLAVINVITTKNPYSNEAVNEIPNLKSLVQDGVKGTKLENAN
FT                   IGIGGMASTTYETKRMADSDYDKALIFVIVGVFITLIIILRSLTMPIYLMISLLLTYFT
FT                   SISVIQFVVTKIMGYPGISWITSFFGFVVLMALGIDYSIFIMTRFNQDLNGSIKDRIIR
FT                   TMKSMGGVIISAVIILSGTFAALLPSGVLSLIEISMVVLTGILLYVVFVLPLFIPAMVK
FT                   IFGKANWWPFKPALSKEDKNLDDSTTIVTTVVTTTTTTTTTTKKGSSKVTKKESKTTTT
FT                   KE"
FT   gene            complement(693495..695090)
FT                   /gene="prfC"
FT                   /locus_tag="CPR_0581"
FT   CDS_pept        complement(693495..695090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="CPR_0581"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87004"
FT                   /db_xref="GOA:Q0SVE2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE2"
FT                   /protein_id="ABG87004.1"
FT                   /translation="MSDLIKEIEKRRTFAIISHPDAGKTTLTEKFLLYGGAIRMAGSVK
FT                   ARKAATHAVSDWMEIEKQRGISVTSSVMQFNYGGYCINILDTPGHQDFSEDTYRTLMAA
FT                   DSAVMVIDGAKGVEDQTRKLFQVASLREIPIFTFVNKMDRETRDPFQLLEDIESELGIK
FT                   SYPMNWPIGCGSHFKGVYDRATNTIHLFDGGNHGQSEVSTITGDLEDPKFKELLGEDLH
FT                   NKLMEDVELLDIAGDEFDLEKVRKGELTPVFFGSALTNFGVEPFLNDFLKLTTSPLPRN
FT                   SSIGEIDPMTEPFSAFVFKIQANMNKAHRDRLAFMRICSGKFEKGKDVFHVQGGKKVKL
FT                   AQPQQFLAQDREVVEEAYAGDIIGVFDPGIFSIGDTLCLNPKKFKFEGIPTFAPEHFAR
FT                   VKPVDTMKRKQFIKGVTQIAQEGAIQVFKELHIGMEEIIVGVVGVLQFEVLEYRLKNEY
FT                   NVDIKMERLPFRYVRWIENDNIDVDSLNLTSDTKKVKDFKDRNLLIFQNDWGISWAIDH
FT                   NPGIILSGVGKSND"
FT   gene            complement(695303..695908)
FT                   /locus_tag="CPR_0582"
FT   CDS_pept        complement(695303..695908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0582"
FT                   /product="conserved domain protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85600"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE1"
FT                   /protein_id="ABG85600.1"
FT                   /translation="MPVRIAILGGPRCGKTTLIQQLYVEFKIRGLDVGAATEYSTEYLK
FT                   EKGMIETISEQYGIYLGQLRLEESLNQFDYALTDYATFVPYIYGRFMLGNKKRSVKEIE
FT                   ILKDLYHLALKDLQKYDHIFFVPREFGYTQDGVRWQDESTASAVDNALKQFLDSENVKY
FT                   TTIEGSTKDRAKQILSIVGLDNKDALPTMRELKKKNSK"
FT   gene            696294..697094
FT                   /locus_tag="CPR_0583"
FT   CDS_pept        696294..697094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0583"
FT                   /product="HAD hydrolase, IIB family"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86697"
FT                   /db_xref="GOA:Q0SVE0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVE0"
FT                   /protein_id="ABG86697.1"
FT                   /translation="MYKLVAIDMDGTLLKEDKTISEKTKEAIKKAREKNVKVVLATGRP
FT                   VDGVKRYLEELDLFHNDEYVLTFNGAIVKEIGPDRVICRDTLKGSDLKYLYEVSKNAGV
FT                   NIHAFSNFGCVTPKMNKYTELEGRINGIEVCEADYNEIKEDEEIIKIMMIDEPEVLEEG
FT                   IKKLPEEVYKKYTVVRSAPYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDL
FT                   HMIEYAGLGVAMGNAFEEVKEKADFITKSNEEDGVAFVFEKFVL"
FT   gene            697159..697788
FT                   /locus_tag="CPR_0584"
FT   CDS_pept        697159..697788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0584"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85571"
FT                   /db_xref="GOA:Q0SVD9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD9"
FT                   /protein_id="ABG85571.1"
FT                   /translation="MENNIKGDKIIYLFVKRLIDILASTLGLIVLSPIFLIISILIKLD
FT                   SKGPIFFSQERVGFKGKTFNMYKFRSMVINAEEIKEKLKEQNEMSGPMFKMKNDPRITK
FT                   IGKFIRRTSIDELPQLINVLKGEMTLVGPRPSLPKEVVEFEPWMMERLTVKPGLTCYWQ
FT                   VMGRNSIVFEDWMKLDVKYVNERCLSLDIKLIFKTFFVLFGDENAS"
FT   gene            697807..698529
FT                   /gene="tagA_1"
FT                   /locus_tag="CPR_0585"
FT   CDS_pept        697807..698529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagA_1"
FT                   /locus_tag="CPR_0585"
FT                   /product="N-acetyl-mannosamine transferase"
FT                   /EC_number="2.4.1.187"
FT                   /note="identified by match to protein family HMM PF03808;
FT                   match to protein family HMM TIGR00696"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86214"
FT                   /db_xref="GOA:Q0SVD8"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD8"
FT                   /protein_id="ABG86214.1"
FT                   /translation="MVKIFNLDFYDENLENLKIELEKDIDENKKVRVYTPNVDHIINIK
FT                   SNENVFLKYSKAEYIIADGWPVVATAKVKKTPIHKITGVDLMDELLKLADKKSLNIFFL
FT                   GATDYTLKKLKFNIERDFNNINLINYNNGYFSEKESERIVKKINDTNSNILFVGMGSPK
FT                   QEIWITENIEKLNVNITIAVGGALKIYSEEIERAPKFVQQIGMEWFYRFMKEPKRLFSR
FT                   YFVKYPKFIKHFIDEIKE"
FT   gene            698533..699630
FT                   /locus_tag="CPR_0586"
FT   CDS_pept        698533..699630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0586"
FT                   /product="glycosyl transferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85505"
FT                   /db_xref="GOA:Q0SVD7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD7"
FT                   /protein_id="ABG85505.1"
FT                   /translation="MLNVLMIDLGRDYGGAEKVIENLFFYDYSDINMHLVALKDTKFFN
FT                   VIKSKNNNQNYMFIENDKKKILKSLFKVKKYIEDNKIDIIHAHGVISEIFGVLLSKMTK
FT                   CKLVTTIHSRADFDTTNKIKGKLYCWIQKYLLNFNERYIVVSDELEKFFINNLNVKKEK
FT                   LIFIKNGLKDLIKREKQEHENVVICSIGRLTAVKAHNKLLRSLLSLSNDGYDLKCLIAG
FT                   IGELENELKKQVEEYNLQEKVEFLGFIEDVRDVFDKSDYLIIQSDMEGLPVILLEAMSY
FT                   KMPIIAYRVGGIKKLLKENQCIELKSNEPADISNGIKQALNKNREELDLIVDEAFLNFK
FT                   KNYDLSIFIKKHEDLYNEVKGGINE"
FT   gene            699623..701059
FT                   /locus_tag="CPR_0587"
FT   CDS_pept        699623..701059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0587"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87792"
FT                   /db_xref="GOA:Q0SVD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD6"
FT                   /protein_id="ABG87792.1"
FT                   /translation="MNRISNFLEIFNYKKYTTEQKIKFILLSIMTLTLILVRIWTIASY
FT                   WLIIPIIFNTILMGLGIIDEFEFIMYSMIMPSEIYNFLGIGIAILSWIYKITCGKVKFN
FT                   FNKKDKWLGILIVFMLLSGFISCIVNSTILSAIFSLGYIFVMLFIFRITVACNYKIKDI
FT                   SSVFNNILIIQIIMMIIQFINYGVFQPSDSFSGTFINAHRLCVWLIWYLVVTSIIIKEK
FT                   NFIIKSDILKILCLLVMIYLTDGKHIVASAIGVFILWFVLDKIKYLRDKKVLTTGIAIL
FT                   LGLYFVTNISHNILFKENIKSKSEYVYRYIYEPPYNNKFNYFDKTINDKLIGYKLFLGF
FT                   GPGQYGSRVANLRAYEYMVKEDSLAITISKFIPPHVIEPYKEFAEQYNEEYLAFVKDMS
FT                   AVLSYPFSSIMAIIGELGVIGYLIYLMFFNSIEKYSSNKIYSIFPMIILVLMIFDSYFE
FT                   MTSIIVFFWIIMGASQTKKI"
FT   gene            701139..702272
FT                   /locus_tag="CPR_0588"
FT   CDS_pept        701139..702272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0588"
FT                   /product="glycosyl transferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86959"
FT                   /db_xref="GOA:Q0SVD5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD5"
FT                   /protein_id="ABG86959.1"
FT                   /translation="MNLLFLIDNLCGGGAEKVLIDILKNLNLQKYNIEIFLIRNKGVYL
FT                   KDLPQNIKVNYIYNDRNFEETKLYNIYYWITKTHFKINRILGLKRLFKKNIKKQYDAYI
FT                   PFLEGACIQLVSDSNLEGKKIAWIHTDLIKHNIMSLKEERKALNSMDKLICVSEGSKRS
FT                   LLKKYPEFNHKVMVINNPIDLDNIEKKANEKIEEVVFNNSYPTFIAIGRVERVKGHDLL
FT                   IEAHKKLINDGFKHNIAILGVGQEMESLKNLINENSLQSSFKFLGFKSNPYKYLKEADF
FT                   YIMPSRYEGYPLSLCEAIALEKPIIATNFESAKDILKNGKLGLIAELEDVDDITFKMKK
FT                   LLEDYNLVKELKNNCSIFKHTLGFKEKILDIENVIDG"
FT   gene            702289..703089
FT                   /locus_tag="CPR_0589"
FT   CDS_pept        702289..703089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0589"
FT                   /product="LicD family protein"
FT                   /note="identified by similarity to GB:AAD37094.1; match to
FT                   protein family HMM PF04991"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85400"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD4"
FT                   /protein_id="ABG85400.1"
FT                   /translation="MDYRECSLQEAQLRMLEMLCEIDRICKKYDIKYWLDAGTLLGAIR
FT                   HKGFIPWDDDIDIGMIREDYRKFKSIVKGELDQNYFCQSPLTDSYSESPWIKIRDNNSR
FT                   IGEEKREKGHSGLFIDILPYDDYNDYNNAKKKPIYNIINLKWKSELPYKKGIKNIPRNI
FT                   SLFSLKLIYKISPYKMFIKKTFYMADKAKNMNSEYIDYGIEGPWNMRLRKSDVFPLKST
FT                   EFAGYKFMIPNKHENVLRCLYGEWNVLPPKEKRIPTHSEKIYIR"
FT   gene            703110..704561
FT                   /locus_tag="CPR_0590"
FT   CDS_pept        703110..704561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0590"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM PF01943; match to protein
FT                   family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85950"
FT                   /db_xref="GOA:Q0SVD3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD3"
FT                   /protein_id="ABG85950.1"
FT                   /translation="MGKSIFKNIVFKFILNLFNLVVPILIGPYVVRKLGPDLMGTVNFA
FT                   QTIFGYFFIFAGFGVYQYGLREISRVRHNKQLLSKTFTSLFIFTGMTTIITTIAYVFFI
FT                   KYMYSGRIVYTACIILTFNLIANIFYVEWINEALENYDFITIKTIIVRIIYIILLFVCV
FT                   KSSKDVNNYLYLLVVSTVLNNIISYIYIKKKIKFDFKEIKILRHIKPMFLVVILSNVNV
FT                   LYTQLDKFLLGEFVGLKEVGYYTTAQNISTIISTLLLSVIHATIPRLSHYIASDNDEKY
FT                   VNLLDKITKIYFMLLFPAAIGMIVLAKEIILIYGGQEYIDAVPMLVVFSIYMITLGYET
FT                   ILGNQVMYVKKKEKKQVEMIFVGGFINLVLNIFLLKINLLNGTYSIITTMIANIIVIIL
FT                   ECLYIRKKLNLDFNIFSLDKNKYLFLSLIFIPVTNLINHFANNLFVISILSIIINVTLY
FT                   FGFLLIIKDKPFIELFNKFISKFKI"
FT   gene            704680..706401
FT                   /locus_tag="CPR_0591"
FT   CDS_pept        704680..706401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0591"
FT                   /product="cell wall binding repeat/zinc carboxypeptidase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00246;
FT                   match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86865"
FT                   /db_xref="GOA:Q0SVD2"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD2"
FT                   /protein_id="ABG86865.1"
FT                   /translation="MQASKRKVLKYVILGSILSAQFLTFNSIKANELKKINNSDNINDI
FT                   VLKSDNLNEKKHIGWIEQDGKWYYINSDGSKHTGWLNLNNTYYYLDPFNGEMQTGMKEI
FT                   NGYKYYLDNSGAIQTGWVKYNGQYYFFGSDGAMRTGWINDGWTDYYLKKDGTIYKGWLD
FT                   DGLNKYFMDENGQMRRGWVKYNGEYYFFGSDGAMRTGWINDGWTDYYLKKDGTIYKGWL
FT                   DDGLNKYFMDENGQMRRGWVKYNGEYYFFGQDGAMRTGWINDGYAYYFMNSNGQITKGW
FT                   FTEDNNKYYLGNDGVMRIGWQEIDNNWYYFEQSGFMARNKIIEDWYVNSNGVGERYIEK
FT                   STYGKSGRGRELEYYKVGSGKKVLFAVFGVHGYEDAWNGDAQELYLIAQKAYNNLVKQY
FT                   EVGTNADDLSEWSVYLIPSANPDGRIDGWTNYGPGRTTITTKNDINRSFPIGFRPYYSA
FT                   RNYTGDSYLGSPEAKALYNFINKTMDGATEKILLDVHGWEDKTIGDSNIASYFDKEFGF
FT                   RNIPKYPGGFVITYGNAIGAKSVLVELPFPKSHEDILRRDFSGKFSRALLNILLNN"
FT   gene            706497..709172
FT                   /locus_tag="CPR_0592"
FT   CDS_pept        706497..709172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0592"
FT                   /product="cell wall binding repeat/mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase"
FT                   /note="identified by match to protein family HMM PF01473;
FT                   match to protein family HMM PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87550"
FT                   /db_xref="GOA:Q0SVD1"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD1"
FT                   /protein_id="ABG87550.1"
FT                   /translation="MIRKTATMLAIFITLSTSNVFAIDIKINNNSKNKQEKSVESYNQK
FT                   ASENNKDKINEKNVNVDEAIKEKDTNIDNDIMNGKESEEKKDNNNQDIYVEPKNNLDTE
FT                   NTNNNDNSKDWKKEVEKNRDENKIKAADEDNKVENKDDLVGSIYEKKSINLKPKFHQFF
FT                   SINNSENELKYEQIRDSNGLESLVRLHPKTDKKYEIALAKDDGTFVYIGSYDDYNIAKK
FT                   STDHSNYNVQSFSETGGIPIILNSEGKVIYAEKALGRIVGIKGQSTINICSDSGLKNAF
FT                   TYIAASYVDDVPIIRYDGNAVEIVINGYRGWISREAIDIVPLNQVKNPSNYVNRYGELS
FT                   HFISDNLMSSEEYYRYPLGKSPSYLKEWKKYYNYDGKYFYTSLELLIDDLQNNTHKNAV
FT                   NVNEPYYNYYYYLPMRSKTSFTVDQINTYISNNSAYNSKLRDTGEYFIEAQNKYGVNAL
FT                   IMLGIAINESAWGTSYYARNKNNLFGIGAVDSNPDDAFYFESVEQCINEFAKYQMSRGY
FT                   SDPYNWSYNGAALGNKGFGANIQYASDPFWGEKASSNFYKLDYHVSGNGLAGLTEYDKY
FT                   QLGLYIGNSKVTDKFGNLLYNIGSMESSKVGKIGTAVIINDLNKKDINNSLNYTIQPDR
FT                   TIPISNGKISGLYDWKNGYTPIDGVKLINQGKNVTKPSGWINKDGKFYYQHSDGTLAKG
FT                   WLDLSGYWYYLDNTTGEMKTGLQEINGYKYYLDESGYMRTGWVNYKDEYRFFGEDGTMK
FT                   TGWINDGWTDYYLKPDGTIYKGWLDDGLNKYYMDENGQMRKGWVKYNGEYYFFGPDGAR
FT                   RTGWINDGYAYYFLKKDGTIHTGWLKENGQKYYLGSEGDMKLGWYNIDNNWYYFDNSGA
FT                   MMTNTIIDGWEIDGNGIARK"
FT   gene            709292..710950
FT                   /locus_tag="CPR_0593"
FT   CDS_pept        709292..710950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0593"
FT                   /product="cell wall binding repeat domain protein"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87858"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVD0"
FT                   /protein_id="ABG87858.1"
FT                   /translation="MKRIFITSLTSLIIVSLILTTGTISVQAAEKNENKINQNLSIKNG
FT                   NADFISSVDIERLDNSKIAIKINTNSNYNGNSYNISVRGPGSINNISTNVPYHELDLTN
FT                   YGTYNIYITVTDIYGISDSYFKNYHYSSPIQARFFETVDKATIGDEIKFNVISSGGNGS
FT                   HKYKFYTKDGVIKEYSYNSSLVTKFNEYGEKELFCDIKDEDDTVKTISHKIKVIANEPA
FT                   WKNENNKWYYVNDKGEFIKGWLNLNNVWYYLDGETGEMKTGLQDIGGYRYYFDESGYMK
FT                   TGWINYNGEYRFFGSDGAMRTGWVNDGWTDYYLKSDGTIYKGWLDDGLNKYYMDENGQM
FT                   RKGWINYNGEYYFFGPDGAMRTGWINDGWTDYYLKPDGTIFKGWLDDGLNKYYMDENGQ
FT                   MRKGWVKHNGEYYFFGPDGAMRTGWINDGYAYYFLNNNGTVKKGWFDENGIRYYLGSDG
FT                   AMRTGWQVIGDNWYHFNNSGAMSRSTSIDGWKIDKEGIATPIKINSTVYVTPNGTSYHY
FT                   SRDCTTLKRSHQILSMSLDEAKASGKNDPCNVCVK"
FT   gene            711069..712937
FT                   /locus_tag="CPR_0594"
FT   CDS_pept        711069..712937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0594"
FT                   /product="choline/ehtanolamine kinase family protein"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF01633; match to protein
FT                   family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85831"
FT                   /db_xref="GOA:Q0SVC9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017190"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC9"
FT                   /protein_id="ABG85831.1"
FT                   /translation="MLSYDIEVLKIINDEDNISQRRLAEMLNLSLGKINSLLKELLTKE
FT                   YIVKIDIDKRNVKYELTEAGIALLENSLDKVKSTKLSIHKHKFHKVKQAIILGAGGKGD
FT                   FGKPAGFLELEEFRIIDRIIDILKSNGIEKIVIVNGYKKEYYEELAKKDSTIFCVTNSN
FT                   YKWTGTMSSLALAKEYIDDDFILVENDLVFESRAVEQIIKNDNRDCVLITNESGSGDEA
FT                   FVEIRDGYLFKMSKDVHQFNKIDGEMIGISKISYKLFKMMLEEFKHNINPYMNYEYTML
FT                   DVARNYKVGYEKINDLVWGEIDNKDQYEKVKKHIIPMIRRKEMQYKIDQVKSAIVNGLK
FT                   VSEEEVKEIVPVGGMTNKNYKAFVNDKAYIVRIPGLGTSSMINRRDEMINSKLAADEGI
FT                   DAKILFFDEESGVKIAELIEGAETLNPATAKKKENMELVVGALRTLHNSDIKMENRFNV
FT                   FEKIEEYESLVKKVNGTLFEDYYEIKTRVLKLEKVLEDNGMEIKPCHNDTVPENFVKDI
FT                   NERMYLIDWEYSGLNDPMWDLAAHSIECDFSEDDEELFLNLYFNNLIEDKHKIRILVYK
FT                   ICQDFLWSIWTILKEAQGDDFGTYGIDRYNRGKKNLELLDKILMGQ"
FT   gene            712965..713933
FT                   /locus_tag="CPR_0595"
FT   CDS_pept        712965..713933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0595"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85576"
FT                   /db_xref="GOA:Q0SVC8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC8"
FT                   /protein_id="ABG85576.1"
FT                   /translation="MLKSNYKGYGSGIISAMAWGLDTVLVGVILSMAPFINTEAAIMLA
FT                   PFVSTFLHDFFSTLWMFIYMIFTRQVGKLFKSLKTPSTKYVILASIFGGPMGMTGYLLS
FT                   VNYIGPSYAATISSIYPAVGAVLAAIFLKEKISRKGYIGLTISILGIALLGFGNDGGKA
FT                   SLIGFLFAGLSVLGWGSESVICSYGMKDEDISPKQALQIRQFISALFSGVIILPLLKAY
FT                   PLVFEVLKGNVIFLIIGTALMGTISYVCYYTAIHKLGPTRAMGLNITYVVWAMIFDKVL
FT                   LGHDITIKMVICALMVMIGSFVVATQPAHEEELINVTNTAV"
FT   gene            714080..714763
FT                   /locus_tag="CPR_0596"
FT   CDS_pept        714080..714763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0596"
FT                   /product="nucleotidyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86407"
FT                   /db_xref="GOA:Q0SVC7"
FT                   /db_xref="InterPro:IPR017189"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC7"
FT                   /protein_id="ABG86407.1"
FT                   /translation="MRAILLAAGMGTRLRPLTLDTPKSLIEVNGRPLLERQVEFLRERG
FT                   VEEIIVVTGYLAEKFDYLKDKYGVKLVNNDKYDIYNNIYTMYLVREYLENTYVVDADVY
FT                   ISENFLLEKPETSMYFSANKQGFKGEWKLSFDENLKVNDIEVGDDEGYILCGVSYWDKK
FT                   DTDIIVKELEDMVENGDFSELYWDDIVKNNISKLDIRIEKISENSIYEIDNLEELDYVK
FT                   SVVEK"
FT   gene            complement(714858..716162)
FT                   /locus_tag="CPR_0597"
FT   CDS_pept        complement(714858..716162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0597"
FT                   /product="surface protein pspA precursor"
FT                   /note="identified by match to protein family HMM PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86758"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC6"
FT                   /protein_id="ABG86758.1"
FT                   /translation="MNKKKLLLILTTFLMINSSQITLAKNLDYSDAKMEIKKSLNNTNG
FT                   WVNKDSKWYYLDSNGNIHKGWLYLNDLWYYLDNINGEMKKGIQEINGHKYYLDPSSGVM
FT                   KTGWIKINDDYYFFGSDGAMRTGWINDGWTDYYLKPDGTIFKGWLDDGLNKYYMDENGQ
FT                   MRKGWVKYNGDYYFFGPDGAMRTGWINDGWTDYYLKPDGTPHIGWLTYDNNKYYLNTNG
FT                   SIAKHWLSLNNNWYYFENNGVMVQNSEKTVNGNIYKFDSDGVMITDKWFGSTYVNKDGI
FT                   VLHGTPSRSHSYTQYKLFNYMSNEDNRESVHYAAIDLHGGETTNNCVYFTSEALRRAGV
FT                   KIPLYVANTYQLERELLSRGWIKSTNTSDLRPGDVVFSGYKHSFTFMNWYDKDYAYIVD
FT                   NQKKYFDSVLHKRLVSVDDPINDTIRATHFFYLPE"
FT   gene            complement(716266..717279)
FT                   /locus_tag="CPR_0598"
FT   CDS_pept        complement(716266..717279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0598"
FT                   /product="Cell envelope-related transcriptional attenuator
FT                   domain family"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87266"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC5"
FT                   /protein_id="ABG87266.1"
FT                   /translation="MLKLAKKTSKKSNYKKPIKNRKLIITLSIIGLLIVSLVGGVATYG
FT                   LTMLGKINKVDLNENNLGIDKAIDEKLSKYDGIANIALFGIDATDGNVGRSDAIMIATV
FT                   DKIHNKLKLTSIMRDSYVDIQGHGKDKINHAYAFGGHELALKTLNENFDLNLKDFATVN
FT                   FSSLPKIIDSIGGIDLGIRNDELQYINNYIGDLNTLNKTNVSNITSAGTQHVNGTQALA
FT                   YCRIRYTAGGDGERTERQRIVLSKLFDKFSKISPTKYPSILNELMPMITTSLSSSDILG
FT                   LAKTVASISESGLEQERFPKDDYSKGEMIHGVYYLTFNKEATVKQIHDYIFEDIKN"
FT   gene            complement(717556..718830)
FT                   /gene="brnQ_3"
FT                   /locus_tag="CPR_0599"
FT   CDS_pept        complement(717556..718830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ_3"
FT                   /locus_tag="CPR_0599"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85842"
FT                   /db_xref="GOA:Q0SVC4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC4"
FT                   /protein_id="ABG85842.1"
FT                   /translation="MNNKKSDFLIIGFALFSMFLGAGNLIFPPLLGRNLGADYYLGIIG
FT                   FIITGVGVPLLGILSSMRVNGKFELFGDKVGKKFSLIYSIALFILIGPLLAIPRTAATT
FT                   FELAFAPNFANINYFAVIVVYFLVNLIFVLKPSKVIDVLGKFLTPILLAILFFLIAKGV
FT                   LSPIDALTKSYTPDALFTSLLEGYQTMDAIAAVIFSSIILGSIKAKGYTGKASFKLLIK
FT                   AAVIAIGGLAIIYGGLIFLGAHTGDLALDLSNSQLLLFVAESILGHAGAILIGVSMALA
FT                   CLTTSIGLLSAGGSFFERVSNGKLPYKFNVLLMTVTSILVASMGLDKIISLSATLLGVI
FT                   YPVTIVLILLNLFHKRITNPLTHKVTVYVTLIVSILITLGNSIPGVENLVSLLPLYSKG
FT                   FGWVVPALIGFIIPSIMPTRETATA"
FT   gene            719562..720560
FT                   /gene="trpS"
FT                   /locus_tag="CPR_0600"
FT   CDS_pept        719562..720560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CPR_0600"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86764"
FT                   /db_xref="GOA:Q0SVC3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC3"
FT                   /protein_id="ABG86764.1"
FT                   /translation="MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYDCYFCVVD
FT                   LHAITVKQLPADLRRRTLEVLAIYIASGINPEKNTLFIQSHVPAHSEASWLLTCNSYMG
FT                   ELSRMTQYKDKSKKMGDSIGAGLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIG
FT                   TRFNNSYSKTFTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVIRKKI
FT                   SRAVTDSIGVVNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKNDVAEAIV
FT                   EELAPVQEKVKALLGNKKALEEIYKKGAEKANYAAMKTLRKMQKKIGLIPR"
FT   gene            720975..721514
FT                   /locus_tag="CPR_0601"
FT   CDS_pept        720975..721514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87006"
FT                   /db_xref="GOA:Q0SVC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC2"
FT                   /protein_id="ABG87006.1"
FT                   /translation="MIIRLIVCILILGGLIIYRNNKLKTINLEKKKTDSKVISLLYDKL
FT                   SNVLLIFFAFDMVIGAMARDANNMTSNIWGVLTIIFCFGVFIYVTKESFKSTIIIRKND
FT                   FILFVNGEENINFHDVKEINISNTVNKYVYLITIFLNDGREYRIKGRDQYEMNKVVRLI
FT                   NERIGYKALKEELAKA"
FT   gene            721625..722467
FT                   /locus_tag="CPR_0602"
FT   CDS_pept        721625..722467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0602"
FT                   /product="arylsulfatase regulator, putative"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85714"
FT                   /db_xref="GOA:Q0SVC1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC1"
FT                   /protein_id="ABG85714.1"
FT                   /translation="MSFLIKPASSGCNLKCTYCFYHSSSDNRNVKSYVIMRDEILESMV
FT                   KRVFNEADGHCSFAFQGGKPTLVGLEFFEKLIEFQRKYNYKNLKIYNSLQTNGTLIDES
FT                   LAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAELFKKYKVEFNILCVV
FT                   TSNTARHVNKVYKYFKEKDFKFLQFINCLDPLYEEKGKYNYSLKPKDYTKFLKNLFDFW
FT                   YEDFLNGNRVSIRYFDGLLETILLGKSSSCVMNGTCTCQFVVESDGSVYPCDFYVLDK"
FT   gene            722930..723760
FT                   /gene="pstS_1"
FT                   /locus_tag="CPR_0603"
FT   CDS_pept        722930..723760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS_1"
FT                   /locus_tag="CPR_0603"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR02136"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86431"
FT                   /db_xref="GOA:Q0SVC0"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVC0"
FT                   /protein_id="ABG86431.1"
FT                   /translation="MFKKRLIAIIGTVFIGATAIVGCNSGGSEAKSTNSVSISGSTSVG
FT                   PVMEAEAEAFKTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAGLKEV
FT                   EIAYDGIALITHKNNKVKDLTLAQIKDIYTGKITNWKELGGNDAPIVVVSREDGSGTRD
FT                   AFQEIVGFKAEELTVNSQISDGSGNIKSLVQGNENAIGYISFSYVDDSVSAVKVDGVEA
FT                   TPENVLNKSYKVSRPFLAVYKEENLTESGKSFIDFILSEEGQDIVAKEHLIKVK"
FT   gene            724146..724802
FT                   /gene="pstS_2"
FT                   /locus_tag="CPR_0604"
FT   CDS_pept        724146..724802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS_2"
FT                   /locus_tag="CPR_0604"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87210"
FT                   /db_xref="GOA:Q0SVB9"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB9"
FT                   /protein_id="ABG87210.1"
FT                   /translation="MPDITVEVNQLGSSAGIKDAINGTVEIGISSRDLKEKELESGIKE
FT                   KPIAYDGMSVVINNENPVQNLTMEQIREIYTGKITNWKEVGGEDNPIVLVSREDGSGTR
FT                   DAFQEIVGFNSEEISPQAQISDGSGSIKTMVAGNKNAIGYISFSYVDNSVHAVSIDGVK
FT                   PTAENVQNKKYKLSRPFLLVYKEESLNENSKKFIDFIMSKEGQEIVEEDGLISVT"
FT   gene            724884..725771
FT                   /gene="pstC"
FT                   /locus_tag="CPR_0605"
FT   CDS_pept        724884..725771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="CPR_0605"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="VCA0071; identified by match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87154"
FT                   /db_xref="GOA:Q0SVB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB8"
FT                   /protein_id="ABG87154.1"
FT                   /translation="MEAKSQNNKSKYFIESLTEKIFLISASVAVISLLLIIGFVFYKGL
FT                   RPFIVEGYSFWDFIFGTQWIPSANKYGILPMIVASLGATIGALLIGIPVGILTSIFIAE
FT                   IAPKKIAKVMSGAVELLAGIPSVLYGVFGLAIIVPTIQDVFNLPKGQSLLAVIIVLAIM
FT                   MLPTVITVSETAIRAVPNAYKEGSLALGASKTETIFKVIVPAAKSGIMTGVVLGIGRAI
FT                   GETMAVILVAGNTPVIPSSIMDSVRLLTTNIALEMGYAFGTHQEMLFATGVVLFTFILI
FT                   LNLVLSKLSNKGGK"
FT   gene            725774..726598
FT                   /gene="pstA"
FT                   /locus_tag="CPR_0606"
FT   CDS_pept        725774..726598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="CPR_0606"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="VCA0072; identified by match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87810"
FT                   /db_xref="GOA:Q0SVB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB7"
FT                   /protein_id="ABG87810.1"
FT                   /translation="MRKVKDNILNGLVWLSAIFTIGILVIILGFIFIKGIGKINLTFLT
FT                   SNYSAGSGSGILPMIVTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVNFIRFATES
FT                   LAGIPSIVYGLFGGIFFVVDLKMGYSILAGSLTVSIIILPVIIRTTEEALKTVPESYRE
FT                   ASLGLGATKFQTLYKVILPSAMPGILSGVILSIGRIIGESAAILLTAGTVAQMPKGIFS
FT                   SARTLTVQAYLVTKEKGDIETAAAVGIVLIVIILALNISAKLIAKKFNKANY"
FT   gene            726616..727377
FT                   /gene="pstB"
FT                   /locus_tag="CPR_0607"
FT   CDS_pept        726616..727377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="CPR_0607"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85328"
FT                   /db_xref="GOA:Q0SVB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVB6"
FT                   /protein_id="ABG85328.1"
FT                   /translation="MSDKKTKIQVRDLDLFYASNHALKKINIDIKENEVTALIGPSGCG
FT                   KSTFLRTLNRMNDLIPIVRIEGEIQVDGKDIYKDDDVIALRTKVGMVFQKPNLFPMSIY
FT                   DNVAYGPRVHGIKDKKVLDKIVEESLRDAAIWDEVKNRLKSSALGLSGGQQQRICIARA
FT                   IAMNPEIILMDEPTSALDPISTLKVEELIRKLEDKYTIVIVTHNMQQAARISDKTAFFL
FT                   NGELVEFSDTNTIFTNPRDKRTEDYITGRFG"
FT   gene            727402..728055
FT                   /gene="phoU"
FT                   /locus_tag="CPR_0608"
FT   CDS_pept        727402..728055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="CPR_0608"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86200"
FT                   /db_xref="GOA:Q0SVB5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB5"
FT                   /protein_id="ABG86200.1"
FT                   /translation="MSIDDLRISIKELKSETKEMMELCEVAIEKSVDSIVNKDLELARE
FT                   VIKMDDDIDNLRNKIIEKSIELTALKQPMAKDLRNVYALSTIAMELERVGDYSVNIAME
FT                   TIKIDNEEHITGMVGIPKMKSVCLNMLNATKNALDSNETKLAYDAALEDNIVDDLYNDV
FT                   YVNLLAAMHKDSNNINQGVKLIFVARYLERIGDHITNVCENIVYAIKGDMTELG"
FT   gene            728215..728910
FT                   /locus_tag="CPR_0609"
FT   CDS_pept        728215..728910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0609"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85748"
FT                   /db_xref="GOA:Q0SVB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB4"
FT                   /protein_id="ABG85748.1"
FT                   /translation="MTNKKVLIVDDEEHIRELIKFNLKKEGYDIEVAVNGTEALNIIRE
FT                   IKFDLILLDLMLPEIDGLEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYI
FT                   TKPFSIRELMARVKALLRRSNFKKEENIIKFGDVVVNFKTREVIKGTQNVELTLKEFEL
FT                   LKLLIKNKDNILTRELLLDKIWGYEYIGETRTVDVHIRHLRKKIESDDKNPQYIQTIRG
FT                   VGYKFTSNE"
FT   gene            complement(729082..729705)
FT                   /locus_tag="CPR_0610"
FT   CDS_pept        complement(729082..729705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:C96972"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86339"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB3"
FT                   /protein_id="ABG86339.1"
FT                   /translation="MNNDFLNLLETLNNEKYMRSFISYLISPVITGIKPSSTITLSKQG
FT                   HNLYKLWDMYGEDFLKDLNLKHILLRETINSKVVLIYDEINLMNTVYKKSSMDFLEKLD
FT                   YRLTMSIDEILTHLVNRYDSFHCPHELGIFLGIPVKDVECFMECTKSKCLLCGYWKVYE
FT                   EEKKAQEIFELYDSSKEIIMNHLLSGKDLKEVYNLTNNVYKFTI"
FT   gene            complement(729739..730155)
FT                   /locus_tag="CPR_0611"
FT   CDS_pept        complement(729739..730155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0611"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM TIGR01753"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87251"
FT                   /db_xref="GOA:Q0SVB2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB2"
FT                   /protein_id="ABG87251.1"
FT                   /translation="MKKLNIIFWSGSGNTEAMANLIAEGAKENGLEVKVLNVSDASTLD
FT                   VEGCDVLALGSPAMGCETIEEGEMDPFVEEISGLVSGKPTLLFGSYDWGTGEWMDTWKD
FT                   RMEGYGANVVNTLIVNNTPEGEDIENCKAAGKAL"
FT   gene            complement(730573..732231)
FT                   /gene="glnS"
FT                   /locus_tag="CPR_0612"
FT   CDS_pept        complement(730573..732231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="CPR_0612"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM PF03950; match to protein
FT                   family HMM TIGR00440"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87127"
FT                   /db_xref="GOA:Q0SVB1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVB1"
FT                   /protein_id="ABG87127.1"
FT                   /translation="MSNAEHSSNFIRNIIIDDLDSKKHDTIITRFPPEPNGYLHIGHAK
FT                   SIVLNFELGKEFNGRTNLRFDDTNPIKEDTEYVESIKEDVHWLGYNWSELHFASNYFDE
FT                   MYKRALLLIKKGKAYVCDLTPEEIKEYRGTLTEPGKESPYRNRSVEENLDLFERMRKGE
FT                   FEDGSKVLRAKIDMSSPNINFRDPIIYRIAHASHHNTGDKWCIYPMYDFAHPLEDAIEG
FT                   ITHSICTLEFADHRPLYDWFVKECEMENIPRQIEFARLNITNTVMSKRKLKQLVDEGIV
FT                   DGWDDPRMPTVAGLRRRGYTPKSIRNFCKAIGVAKADSTVDYQMLEHFIREDLQETAPR
FT                   AMAVINPLKLVITNYPEGKSEILEIENNPKDESAGKRAVTFSREIYIEREDFMENPPKK
FT                   YFRLFPGNEVRLKGAYFVKCNEVIKDENGEVTEIHCTYDPETKSGTGFTGRKVKGTIHW
FT                   VDANNCIPAEFRLYEPLILDDCEENEGKHFLEQINPNSLTICKGFIEPSAKDAKPQDKY
FT                   QLFRHGYFNVDPNFTSDDNLVFNRIVSLKSSFKLK"
FT   gene            complement(732484..732639)
FT                   /locus_tag="CPR_0613"
FT   CDS_pept        complement(732484..732639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:A96978"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86389"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVB0"
FT                   /protein_id="ABG86389.1"
FT                   /translation="MEDKNLVCKDCGKEFVFTVGEQEFFKEKGFENDPVRCPACRKARK
FT                   AQKMNR"
FT   gene            complement(732794..733882)
FT                   /locus_tag="CPR_0614"
FT   CDS_pept        complement(732794..733882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0614"
FT                   /product="spore germination protein"
FT                   /note="identified by match to protein family HMM PF03845;
FT                   match to protein family HMM TIGR00912"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85755"
FT                   /db_xref="GOA:Q0SVA9"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA9"
FT                   /protein_id="ABG85755.1"
FT                   /translation="MSLGKLNTRHFIFFIIAAISTSLVNYTSLFIKIGGRDTWIFTIIS
FT                   GIIFFFVTSFIFSVISKIEYYDFKETCYLVLGKSLGNIYILIFSLTLLLMCIESASVSS
FT                   SSINVNIFAESPIWYCLLFFVITVFLIGKNRFNSILIICIVCISIVLAINLLLALLNIR
FT                   YIDYTLLLPIFKDRRISEYILCALTQLGSLSSLAIVLPILPRIDDKKNLKKISINTILL
FT                   TSIFCTLCIVILISTLGSLRSANVFYPQFIQNQRIYFGGFVENGNIFVMISSTLSWIVK
FT                   YLITIFSLYTIWKDRVKYKRNFIALISVIVYVFSYLAAKNAYTLFILLRYYQYILLIVL
FT                   FICPIIIYTLAYFKSHKFKYLK"
FT   gene            733978..735399
FT                   /locus_tag="CPR_0615"
FT   CDS_pept        733978..735399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0615"
FT                   /product="spore germination protein, GerABKA family"
FT                   /note="identified by match to protein family HMM PF03323"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86956"
FT                   /db_xref="GOA:Q0SVA8"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA8"
FT                   /protein_id="ABG86956.1"
FT                   /translation="MEKQLDFLKDKLKDSFDVKYREVDTALGPATIVFMDVLCSTQFIS
FT                   EYIVKPLTLVKDGVKDENDIMTKVIDINITNWSKDKNDTLLHVLSGDVVIIFDKFDKVI
FT                   YCETKGYTRRGVGIPITEAVIKGPREGFNEAFVDNVTLLRRRIKNHNLKFEPLYVGEDT
FT                   QTVVCISYIKNKAPKELIDEIREKIKNLDYKFILDTNYIEAKLREDRTLFDTVGYTEKA
FT                   DEVAAKLLEGRVAIIVDGTPFVLTVPFFFIENFQTPDDYYLNRYFTSFTRILRWIAFFI
FT                   AMFLPGIYVALVTHHFSVLPSLFVFRLAVARAGVPFTIVAEVIIMMLLFQIIKEAGLRL
FT                   PQPIGTSMSLVSGLILGEAAVGAGIASRITIVVVALSAVCYFLIPKLYGAVSIWSIGIV
FT                   ILAALFGIPGVILISVVLLSHLAHLRSCEYQYLFPLGTLSRYKFKDIIIRGRLEEISKD
FT                   IVGKDGKNEPKESYS"
FT   gene            735374..736498
FT                   /locus_tag="CPR_0616"
FT   CDS_pept        735374..736498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0616"
FT                   /product="spore germination protein, GerABKC family"
FT                   /note="identified by match to protein family HMM PF05504;
FT                   match to protein family HMM TIGR02887"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86274"
FT                   /db_xref="GOA:Q0SVA7"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA7"
FT                   /protein_id="ABG86274.1"
FT                   /translation="MNLKKVIASLLSVIIMSIMFIGCYNYKDINKVTFVTSLIFDENEV
FT                   GNIDIYLDCVKPYRSSNESSDKGRRVLYKGTGKTVLEAIKDINMYSSSKLDFTQCKGYI
FT                   FTEKAAKNGIRKYTDIINKNQEFMIRPYMFVLFGSPEELLNDVTVDEEYLGVFIDDLVQ
FT                   RMNKSPRVIAIDANDYLELRTNYGNLLVLGALSIRDDMEEKRLELSGGALLKNEVLVRR
FT                   ITAEEGMSYNLLMGDLKRGTLEVMNPQDPNTFITLDISNAKTKTSISYDGENITLYKDI
FT                   KVKCLIGESQSRLIVDEKLLNLLELEEEAVIKQYLELFFESFKESDIDIVNVGNLFYRK
FT                   YPDEVLEKDPISITNLKINVDVEINGTTITGNTL"
FT   gene            736650..737783
FT                   /locus_tag="CPR_0617"
FT   CDS_pept        736650..737783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0617"
FT                   /product="AAA domain family protein"
FT                   /note="identified by match to protein family HMM PF04326"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85526"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA6"
FT                   /protein_id="ABG85526.1"
FT                   /translation="MNENKLRKLIKKNEYEKLDFKLKIELFTENVKKELAKDICAIANS
FT                   RGGRGYIIIGVEDKTKKIVGVDADYITEERVQQIVASRIEPPVPISLEECFLDGKRLLV
FT                   IVIFNSYQKPYQIRENGAFYIRRGSTTDIMRKQELLSEFQKGISFNLETCPIVNSNIDF
FT                   LNEELVKRYFYLKGIKISKENREFLLSSSNIIHKNNISGKSMCTLGGLLVFSDVNSIYI
FT                   PHNMIKIRNLLGGEQTFIIRGNILDMMKSMEKKLREIVPNEYPVALIIDTIRNILIYRD
FT                   YSQYNKIVEVVLGKKELTVYCPGEIVKRYRDGRIGYIKRNMWIYEKIISLDSRDGEMNY
FT                   NLGGKELKESFTNKVKVITVNEENITKFIFNKYGTIN"
FT   gene            737859..738272
FT                   /locus_tag="CPR_0618"
FT   CDS_pept        737859..738272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0618"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87386"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA5"
FT                   /protein_id="ABG87386.1"
FT                   /translation="MIQLFFNQRGAGKSKNLVKLANEEIEKSKGSIIFIDNDNKRMLQL
FT                   NKKVRLIPMDNYCVKSYDQFYGFLQGIISRDYDVESIYIDSIANILDDIKLEDLENYLK
FT                   KIELMSRELNVNVFVTIHGDLTIMPENIKKYVA"
FT   gene            738558..739778
FT                   /gene="tyrS"
FT                   /locus_tag="CPR_0619"
FT   CDS_pept        738558..739778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="CPR_0619"
FT                   /product="tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by similarity to SP:P00951; match to
FT                   protein family HMM PF00579; match to protein family HMM
FT                   PF01479; match to protein family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85988"
FT                   /db_xref="GOA:Q0SVA4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SVA4"
FT                   /protein_id="ABG85988.1"
FT                   /translation="MANVLDTLMERGYIKQFTHEAETRELLEKEKVTFYIGFDPTADSL
FT                   HVGHFIAMMFMAHMQKAGHRPIALIGGGTATIGDPSGKTDMRKMMTNETIAHNVACIKK
FT                   QMEKFIDFSDDKAILVNNADWLLNQNYVEFLREVGVHFSVNRMLSAECFKQRLERGLSF
FT                   LEFNYMLMQGYDFYVLNKKYNCKMELGGDDQWSNMIAGVELVRKKSQKSAYAMTCTLLT
FT                   NSEGQKMGKTVNGALWLDPEKTSPYEFYQYWRNVNDADVEKCLKLLTFIPMDEVRRLSS
FT                   LEGSQINEAKKVLAFEVTKLVHGEEEATKAKQAAEALFGKGGDMSNVPTYEMGKDKLGS
FT                   ELLDILVEAEIVPSKAEGKRLVKQGGLSLNGEKVADFKKTLEEADFENGEVLIKRGKKN
FT                   YNKIVLA"
FT   gene            740034..740726
FT                   /locus_tag="CPR_0620"
FT   CDS_pept        740034..740726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0620"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85399"
FT                   /db_xref="GOA:Q0SVA3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA3"
FT                   /protein_id="ABG85399.1"
FT                   /translation="MALYAISDLHLALNTDKPMDIFGEKWRNHHEKIKENWNNKITEED
FT                   TVLIAGDISWSMKSDESKDDLDWIDALPGKKIIIKGNHDYWWGSISKLNKMYENTKFIQ
FT                   NNFFTYKDWAICGSRGWICEGSDKFTQKDKKIFDREQIRLRLSLEEAKKAGYEKIICMV
FT                   HYPPTNEKFEDSAFINIFKEFGVDKVIYGHLHGMALKGKVLNEERDGIEYKLTSCDFIN
FT                   FDPIKILD"
FT   gene            740845..741636
FT                   /locus_tag="CPR_0621"
FT   CDS_pept        740845..741636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0621"
FT                   /product="relA/spoT family protein"
FT                   /note="identified by match to protein family HMM PF04607"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85819"
FT                   /db_xref="GOA:Q0SVA2"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA2"
FT                   /protein_id="ABG85819.1"
FT                   /translation="MAIQNWKDFLTPYDQAVSELKVKLRSIRKEFRRKNEYSPIEFVTG
FT                   RVKEVSSILEKANKYSIPVDRIQYEMEDIAGIRIMCQFVDDIDTVVNIIRNRKDMQVLY
FT                   EKDYVSNVKPSGYRSYHVVIRYPINMADGQKDILAEFQIRTLAMNFWATIEHSLNYKYK
FT                   KNLPKDIQFKLKRAADAAFTLDEEMLEIKDEIKDAQTLFEVKSDIISTIMNSILNLISI
FT                   GKVAEASRYQISLNKLIEEGEVWELNNLLRAVQRDIDKYNV"
FT   gene            741909..742694
FT                   /locus_tag="CPR_0622"
FT   CDS_pept        741909..742694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35900.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87822"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA1"
FT                   /protein_id="ABG87822.1"
FT                   /translation="MNAMNNLELKKIKENPLYIREIENPSEEMQLEAIKKNPFTIQYIE
FT                   NQCEKCKEEAVRRNPTTIEYVKNPSEEICILAVKSLWNALKLIKEPSEKVVEEAVKTKG
FT                   WAIQFVKNPSEKLKQIAVSRDYDAIKYIEDPSPEVQLIAVKNHWSAIKFIKNPTLEAMR
FT                   ASVKEDAEAINFLPNYTYEDLETFIGDNINVVKYLYESIDVDMVVDILTKKVAEENVDE
FT                   RYLLDFIDLEVLEMNKVEFIKEYGSKRAKIILVDSMLSI"
FT   gene            742811..743926
FT                   /locus_tag="CPR_0623"
FT   CDS_pept        742811..743926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:C97129; match to
FT                   protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86777"
FT                   /db_xref="GOA:Q0SVA0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SVA0"
FT                   /protein_id="ABG86777.1"
FT                   /translation="MDFKEALSTVNLVLMTGEVPLLIGESGIGKTSLAKELSRINNYHL
FT                   VTIDGNLLKEGEIGGLPMVEKKEILFKGDVVKKSVTKYATHVKLMEIDDHIEKGEKVLL
FT                   FIDELNRCEHAVQQELMNLILNREINGYKLNEDVYILAAMNPSNKYDNYEDSDYQVIEM
FT                   DPAQEDRFVWIDISSNLKEWMSWAMGDGNIHEHIIEFLSTFPEYFHTPNSLETIKATPR
FT                   SWERVSKAYRVYLANKKNFSKEILYNALKGNVGLTIAQEFIAYISNLNKPIISNEEIFE
FT                   SDVLGFNIRERIMSENHSRMYIIAKSALYYLEGLKDYNKELEVFSDLLYCYPKDLRLGI
FT                   MKEIKSDHSEELYRNLLNEDKFLEAFFEIYS"
FT   gene            743940..745277
FT                   /locus_tag="CPR_0624"
FT   CDS_pept        743940..745277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO35898.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86387"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV99"
FT                   /protein_id="ABG86387.1"
FT                   /translation="MDFERTRRKLLNIAMEAEEENKTLTDDFKREFWSLIEKVIISLYD
FT                   KENSFFGQFLIHVKREIRTDIKWPIATKPEMGYFTMVFNPSIILECDLKEVQALLKHEV
FT                   YHIMMSHYAREKALSRKYSKLAVSIAMDIAINQYIKNLPPYSKRLDYVNLEYNLELKPD
FT                   MPMEKYAEEIQKAIERRKKYGITGDDKNAGDLVSQEKSHEVWEEVSISLDSLEGTTKKT
FT                   AINAYKGKAPKDLEKIILLMKEKPEIKWSEFLKDIIPTTRGSYRKTITRKDRRLPERLD
FT                   LRGKLPNSIPKILIAIDVSASISDKEFENIIIEVLGIVRNKNAEIKVIECDDEIRRVYD
FT                   LKGIKDIKPRSKKNGSTRFSPVFRYIKENNMRNHILVYFTDGVGEKDLEVKPINYRTLW
FT                   VLTGKKQLSLNKSFGTVKHLEKEKGDGYTLMDGLQDMKDNLHDWAR"
FT   gene            745582..745899
FT                   /locus_tag="CPR_0625"
FT   CDS_pept        745582..745899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0625"
FT                   /product="ISCpe2, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87299"
FT                   /db_xref="GOA:Q0SV98"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV98"
FT                   /protein_id="ABG87299.1"
FT                   /translation="MFGDVDKSLKEIILKIANDNNFEISEMETDKDHIHLLIECSPQHQ
FT                   IPNIIKGLKGVSARLLFLKHPEIKRYLWGENLWNPSYFVATVSENTEEQIRNYIQNQQE
FT                   K"
FT   gene            745910..747064
FT                   /locus_tag="CPR_0626"
FT   CDS_pept        745910..747064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0626"
FT                   /product="ISCpe2, transposase orfB"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86802"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV97"
FT                   /protein_id="ABG86802.1"
FT                   /translation="MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNY
FT                   WNIVEEMVQQGYFQENNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGA
FT                   GYDKYYKKIGGRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVKIENSR
FT                   NVDGNIKRVTVSRTQSGKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEAN
FT                   PKHFRKAEKRLIKLQRDLARKEYNSKNYHKNRIMIAKLHERIANQRMDFLQKFSTKLIR
FT                   ENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAEWYGRKIVIAPPDYASSQ
FT                   LCSECGYKNIEVKNLGLREWVCPECGTHHQRDLNASINLEKLIA"
FT   gene            747268..748659
FT                   /locus_tag="CPR_0627"
FT   CDS_pept        747268..748659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87125"
FT                   /db_xref="GOA:Q0SV96"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV96"
FT                   /protein_id="ABG87125.1"
FT                   /translation="MKKNIKSMVLVLLIIFVVALIVITFKIIKFRKNTVTDIKACENKI
FT                   TFNSKVKREEIEYLKVDGEKDRPVNKIEGLNLFINNSKVNLSDKIYEKNLRYYISLEDL
FT                   EKNGQVSIDGNNVLSKTNKNYIDLEKKEILKEKDKLDLRGEVLDLDHKKYISINDFKEL
FT                   IEARDDWYENKNSIYMFQGKTNNINCNYKVNEGKAALIRIEDVSAGGVFSEDNNMEKMK
FT                   YLSDYFKANNIVFHIAWIPRYINPEKNIDNDLLKNNNFENVHFINMLDHLINRGAIIGL
FT                   HGYTHQHNKQISGLGVELKWNVNSNKNKVLKVVESSLKTAKTLNIPIGFFESPHYKADR
FT                   NQQKIIEQYFPVMFEPYAGYWNLNPLISFSNKSTLYVPAPLGYVKDNGETVARRIRNYS
FT                   NEILTAFFIHPYIFLGSIENKNNSTNNEEIYEFNENSPILKIISALKERGCKTITVNEL
FT                   NNQII"
FT   gene            complement(748907..749959)
FT                   /locus_tag="CPR_0628"
FT   CDS_pept        complement(748907..749959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0628"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85353"
FT                   /db_xref="GOA:Q0SV12"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV12"
FT                   /protein_id="ABG85353.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKEFHVYFADTGEAVYKKNRLKSNRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIIS
FT                   EMSSHSTISVTKALDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHP
FT                   YSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE
FT                   IHLDEIYSLY"
FT   gene            complement(750154..750612)
FT                   /locus_tag="CPR_0629"
FT   CDS_pept        complement(750154..750612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0629"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87861"
FT                   /db_xref="GOA:Q0SV94"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV94"
FT                   /protein_id="ABG87861.1"
FT                   /translation="MFFVILSIFFRFLIKKFPQFIFIYISISFGSFSLFSFIISCVKIY
FT                   YIGVFGAPFNVLFLLIAIIIYLLEIIFFIIFFINKEKKNSTSSYNNHTLSRSSISIIST
FT                   LGVLASYHYSFNSLKFMILILSYITLLISLVGINRFRLLIKYKVNIKK"
FT   gene            751113..752336
FT                   /locus_tag="CPR_0630"
FT   CDS_pept        751113..752336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0630"
FT                   /product="ISCpe3, transposase"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87231"
FT                   /db_xref="GOA:Q0SV93"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV93"
FT                   /protein_id="ABG87231.1"
FT                   /translation="MSKEINYQEEIKNCKSVEDLVGKNGLMKRLFKDVMQQLLDAEMEE
FT                   HLGRTKYERCSEENSKNYRNGTSNKTVRSSYGDVELDIPRDRNGDFNPVSVKKYKKDCN
FT                   EFDQKIIGLYARGMSTRDIQSEMEELYGIELSPSAISHITDKVLVAAAEWQNRMLDKVY
FT                   PIVYMDAIHFKVREDNKIVSKAAYICLGIDMNGYKDILGIWIGEAEGAKFWLSVCNDLN
FT                   NRGVKDILIACMDGLRGLPEAIKAVFPNVCIQNCIVHQIRNSLKYISYKDKKDFMKDLK
FT                   LVYTAETVELALSQLDMLKEKWDYKYANVIDSWYSNWNNLSTFFDFSSGIRKMIYTTNL
FT                   LEGFNRQLRKFTKIRTVFPTDESLRKSLYLATDQVMKKWTSPIANWGPILLQFEIIFAE
FT                   RIETALAI"
FT   gene            752746..753816
FT                   /gene="bcn_1"
FT                   /locus_tag="CPR_0631"
FT   CDS_pept        752746..753816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcn_1"
FT                   /locus_tag="CPR_0631"
FT                   /product="bacteriocin"
FT                   /note="identified by match to protein family HMM PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86442"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR028946"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV92"
FT                   /protein_id="ABG86442.1"
FT                   /translation="MNRCFPYNFSPQYTSRNYTGPNPLGAPEAVALKNLVERINSSSSE
FT                   MVVLDFHGWMNFTQDNAELGRYFGNQFGFGHNNGYSSGFFSSWATTLRNTKAVLIEYPT
FT                   NTYSYNDVINKNYIGKTFNGIINIIKNNPNGGDVDNGGNSGGSSSSDVRYIAAGEVINV
FT                   QSFLNVRKGPGTNYDSIGQLHQGEKVSIVATNKEWNKIEYGTGYGYVHKDFVNILYRDI
FT                   NEELRGLMVRYEYMYGPQWNGITSGVANLAKFYNLVRNGSIVDLKNQGWDENQYYFNGK
FT                   IYRKDAPGNILYGYLGKVFGFTDELLLRAAGFAQKEAGTSKPEFGDPFGNPPYGDDPYD
FT                   QECIKDGIDYFNKYRK"
FT   gene            complement(753868..754236)
FT                   /locus_tag="CPR_0632"
FT   CDS_pept        complement(753868..754236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP10150.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87738"
FT                   /db_xref="GOA:Q0SV91"
FT                   /db_xref="InterPro:IPR035406"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV91"
FT                   /protein_id="ABG87738.1"
FT                   /translation="MEVTMKKSIIVVFIILIFIITGISIIKFNSPSLKNIPSGEYISQT
FT                   ESPNHDYTVKFYLVNSHSTVDFAIRGELVNNKSGKQKNIYWSYHENTVSSQWINNNTIE
FT                   INGKTLNIEKDTYDWRLN"
FT   gene            754350..755456
FT                   /locus_tag="CPR_0633"
FT   CDS_pept        754350..755456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0633"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87118"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV90"
FT                   /protein_id="ABG87118.1"
FT                   /translation="MRNALQVNNVSYIDNLHSNSKGWITRSVIDKKGYRQWHYKYAELK
FT                   DLDISGENIYITLNTFYKPCRRLENIKELNTLFIDLDYYKTGKTKDQVLMDLEKNYFNQ
FT                   SIPIPNYVIDSGRGMYLIWRINSVPSKALPLWKAVQDYLYKQLKCFGADRQALDATRIL
FT                   RVPGSINSKSKTVVNILDEYEYIYDLREIQNGFLPELKPYEKKKGRPSKINYIYRERSL
FT                   YYGRIQDIIKLCELREYDLKGHRELILFLYRYYLCSFTEDIEKALNDVLELNSMFRQHL
FT                   SEREVIRATRSAERCYLDKNKQYKYKNETLIELLEITEEEQKYMTIIISKKEYKRRENI
FT                   RGKKLPRAIKSSRKSNKKREIIRNRRII"
FT   gene            complement(755938..756408)
FT                   /locus_tag="CPR_0634"
FT   CDS_pept        complement(755938..756408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0634"
FT                   /product="ISCpe7, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86898"
FT                   /db_xref="GOA:Q0SV89"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV89"
FT                   /protein_id="ABG86898.1"
FT                   /translation="MVFINGKKYYLWLAIDSETRFVLAFHLTQARDSDAAFILMNQAKS
FT                   MGKPKHFITDRLPSYNEAVKTLLNESTHIPVPPMSSDTNNNLIESFNKTFKAWYKTKKG
FT                   FNSFEKANNLIYMFIFHYNFIRPHGSLKGSTPAEVAGFSTNDSNKHNWFIAT"
FT   gene            complement(756396..756956)
FT                   /locus_tag="CPR_0635"
FT   CDS_pept        complement(756396..756956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0635"
FT                   /product="ISCpe7, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85668"
FT                   /db_xref="GOA:Q0SV88"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV88"
FT                   /protein_id="ABG85668.1"
FT                   /translation="MNKTNIKCPRCHSEKLYKFGFDKQANQKYQCKECGRQFAPDSVSS
FT                   RPKSKYPRCPKCNKATYLHHKYKHYNRYKCGSRKCNHAFSQYHNLNIDLASSEKLTDSL
FT                   SMKGMRFPLHTILTALTLYFLNNTSTRAISQFLKVTSNISVSHVTISSWVHKFAPYFKE
FT                   KAKIFNSQLDLNLDDWHADVWYS"
FT   gene            757082..758575
FT                   /locus_tag="CPR_0636"
FT   CDS_pept        757082..758575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P44744"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85435"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV87"
FT                   /protein_id="ABG85435.1"
FT                   /translation="MNRVLDILKDRSLTYHQQIKDLVAYAESTIEVLNIDDETKKLIDE
FT                   GCICTLFEGNAPFRPRYIIPDYSLLMEKGCEFLNLSVPEDIWEATNNLLIFYKHVPSIT
FT                   TFPVYLGNIDEFLEPFIEDEREAKRAIKLFLKHIDRTLTDSFVHANIGPRETVAGRLIL
FT                   ESMDELQCAVPNLSMKYDLENTPESFINLCAKVALSTAKPSFANHKMDVKSFGTDRYAI
FT                   ASCYNGFHIGGGGYTLVRIKLNEVAKKATSVEDFLENVLPYVSTKMIQYIDERIRFLVE
FT                   ETQFFTSNFLVKEGFIQKKLFTGMFGVVGLAEAVNTLLGAEKQSDRFGYSEKANKLGLR
FT                   IIEKLNKIVSEHEAKHVNCFGGHYVLHAQVGIDLDQNVSPGCRIPVGEEPELFNHIMQS
FT                   APFHKYFYNGIGDIFVFEDTYNDHPEALVDIIKGAFNSGIRYMSVYGSGADVVRVTGYL
FT                   AKRSEVEKLERGEAVLNNTDLFAMGAKNNCHAFERKIRK"
FT   gene            758584..759405
FT                   /locus_tag="CPR_0637"
FT   CDS_pept        758584..759405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0637"
FT                   /product="4Fe-4S binding domain protein/radical SAM domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87452"
FT                   /db_xref="GOA:Q0SV86"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV86"
FT                   /protein_id="ABG87452.1"
FT                   /translation="MALINKIIPFSCVDGPGNRMVIFFQGCNFKCFYCHNPETINKCIS
FT                   CGKCVENCEVGALSISDGKVIWDKEECISCDKCIKLCEHMSSPKLKEYSVEELVKKIEK
FT                   DSFFIRGITVSGGECTLNSEFLIKLFREVKKLGLTCFADTNGNTKLDDELINLTDKFML
FT                   DVKSIDEKENIWLTKSSNKLVLENFKKLLELDKMYEVRTVIAKGLNNEKTVDEVSKIIG
FT                   DKCRYKLIKYRPFGVREEGIKVHGTISPEDSYMNELKEKSIANGCIDTIIT"
FT   gene            759697..760212
FT                   /locus_tag="CPR_0638"
FT   CDS_pept        759697..760212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87102"
FT                   /db_xref="GOA:Q0SV85"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV85"
FT                   /protein_id="ABG87102.1"
FT                   /translation="MKKFFIMVLSIIIIVGGVLFYRFKTRKFLNFNLESISIEQATESD
FT                   FSNSLSKDNKNEEPLDYFDIVFSIRAKNTSKNLCTDNIVPHIILPKELKSNGYIDIGLN
FT                   PLSSTDEIILPGHEKGFPYKLFVKKGKYSKEELLKLLKECKFKVNIVSFKKTKMQFLTY
FT                   GGSVEYIE"
FT   gene            complement(760316..761119)
FT                   /locus_tag="CPR_0639"
FT   CDS_pept        complement(760316..761119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0639"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86563"
FT                   /db_xref="GOA:Q0SV84"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV84"
FT                   /protein_id="ABG86563.1"
FT                   /translation="MNIAYDFIIALILAFVLVMMKQYVFALIVVVIYALYKYNKKKPYI
FT                   LAYKGNVSFRNGEREKALELYKKACTYKNASDSIRLQYSYLTLYLGNLEEATKLLSAID
FT                   YDKLPERLKASYTMTDSLITWKNGDLKKAIENLKNLHTQYEHTTVYETLGYFLILDKRY
FT                   EEALKYNLLAYEYDQDNKVIMDNLAQSYYFTGNIEKAKEVYTKLLDEDPGIPEPYYYYG
FT                   LILRDEGDTKGALESFDKALTKRESYLSALNKDKIRAAIQELNIK"
FT   gene            complement(761437..762747)
FT                   /locus_tag="CPR_0640"
FT   CDS_pept        complement(761437..762747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0640"
FT                   /product="F5/8 type C domain protein"
FT                   /note="identified by match to protein family HMM PF00754"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85652"
FT                   /db_xref="GOA:Q0SV83"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV83"
FT                   /protein_id="ABG85652.1"
FT                   /translation="MNTTLANLTPTKEQRKYQEDELIAFLDLQMNTFTANSENNDEAPS
FT                   LLKQETSFNTDIWIENLFKFGFKKVILTAKLNNGVCLWQSNCSKVNINTFSLENSYDDL
FT                   VKKVSKSCKKFGLKFGIHLTLKDYLTLNLTPEEYDNYYTSQLKELITNYSQISEVIMDM
FT                   TSLDEYYDSLDFERYFKVIKEINPKCIISSPIGPDVRWTYYSDIESSKNYFYSSINLNL
FT                   LKEDFNNEEIRKGNIYGDTWIVGESIYSLSDCLNHNKDSLSNLKHVYNNSLGRNTNLVL
FT                   VLSPNTDGLLNHNELSLLSDFSKYIKETFSNNLIKGSSILATNSSSSDSYNLIDDYKKS
FT                   YWIANENAVNPYIEIDFKTITEFNILEIREWIAEGQNVEEFKVYAYNNSWFELYNGTSI
FT                   GYRHIAKLNNIKTDKIKISFTKYKNPPMINHIGAYLG"
FT   gene            complement(763038..763364)
FT                   /locus_tag="CPR_0641"
FT   CDS_pept        complement(763038..763364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:763254..763256,aa:Sec)
FT                   /locus_tag="CPR_0641"
FT                   /product="hesB family protein"
FT                   /note="This protein is a predicted selenoprotein, while the
FT                   next gene is homologous but not a selenoprotein.;
FT                   Selenoprotein. identified by match to protein family HMM
FT                   TIGR01911"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87712"
FT                   /db_xref="InterPro:IPR010965"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV82"
FT                   /protein_id="ABG87712.1"
FT                   /translation="MSVVKMSNEAYTEFKSFLQENGVEKFDIRINLAGVGUGGPVFNIV
FT                   LDEQSDNDEVVKIEDITFFVDKELVKDFEGFTLLSSDENGGRGLSLKPVKESEGGCSSC
FT                   SSCH"
FT   gene            complement(763466..763810)
FT                   /locus_tag="CPR_0642"
FT   CDS_pept        complement(763466..763810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0642"
FT                   /product="hesB family protein"
FT                   /note="identified by match to protein family HMM TIGR01911"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86978"
FT                   /db_xref="InterPro:IPR010965"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV81"
FT                   /protein_id="ABG86978.1"
FT                   /translation="MKKVAMSDDAYIEFKEFLKSNDIDSDVIRINFGGNGPMGPMFYVT
FT                   AGEKNEGDEVEVIKDLTFVIDSSLIDVFLGFSILSDEENFGEGLTLDPLMSDYEGGGCS
FT                   GNCGSCGSCH"
FT   gene            764454..764996
FT                   /locus_tag="CPR_0643"
FT   CDS_pept        764454..764996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0643"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87454"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV80"
FT                   /protein_id="ABG87454.1"
FT                   /translation="MRISPHEIQGAFEGIKRAKGKVGVLGLGLGYFVQEIAKSDQVREI
FT                   VVYEMSEEIIDLYLENFGENPKIRIVKGDGFKAKRENFDFFYVDIYEYKLTTKVVEDYV
FT                   KLTKLHDIVEYSFFGVESFILSCPTSEIIWVYILEEWMDMSKDLFTRFNHSEYIEYFSP
FT                   IEENKVLEVLKEFGEVL"
FT   gene            765499..766506
FT                   /locus_tag="CPR_0644"
FT   CDS_pept        765499..766506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85770"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV79"
FT                   /protein_id="ABG85770.1"
FT                   /translation="MAHKKVAKIIATAIVVNNLSSSVVLGKEVNLIDKNKDNSVINQNI
FT                   SHSKRHNNIFRIEKTVGNTEEFLKIINDGNLEEIKLSRDIDLSNLISSGVDIKSSNVVI
FT                   DGQGYSIYVPKLAENLNRDFFTLQGDGIVLKNLNIVCKDDEDLNNNNLITISGDDITLE
FT                   NVFVESNFNRAVNILEGNNIHINDCKIVNNQEKGNGLKVENGIVTLNNLDLQNKSGVGL
FT                   DILGKDSKVYLKGDIKINSPIEIRGQFRDGGILNCDNNQLIHEKRVFGYTYYNVAKETE
FT                   LVRNKDEFLEAIDNNIVKNIKLMDNIDLRGHESEYYKVFEKEIKVDKNNYHITM"
FT   gene            complement(766652..769102)
FT                   /gene="leuS"
FT                   /locus_tag="CPR_0645"
FT   CDS_pept        complement(766652..769102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="CPR_0645"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by similarity to SP:P36430; match to
FT                   protein family HMM PF00133; match to protein family HMM
FT                   PF08264; match to protein family HMM PF09334; match to
FT                   protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86559"
FT                   /db_xref="GOA:Q0SV78"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SV78"
FT                   /protein_id="ABG86559.1"
FT                   /translation="MGNYSTAIDKKWQDKWAESGLYKFDPNKEVEKLYVLEMFSYPSGS
FT                   QLHAGHWFNYGPVDSWARFKRMQGYNVFQPMGFDAFGLPAENFAIKTGIHPQDSTIKNI
FT                   AKMEEQLKAMGAMFNWENEVVTCSPEYYKWTQWLFLKLYEKGLAYRKKAPVNWCPSCQT
FT                   VLANEQVVDGACERCSTEVTKKDLTQWFFKITDYADELLDKLDGLDWPEKTVSMQKHWI
FT                   GRSTGSQVNFKVKDSDLNFDVFTTRVDTLCGVSYVVLAPENPLVDEIVSAEQKEAVENY
FT                   KEEAKKQSDIERQSISREKTGVFTGAYAIHPLTGKEVPIWVGDYVLATYGTGAVMAVPA
FT                   HDERDFAFAEKFNLPINRVIEAKDGSETNLPFCEHGILVNSGEFDGLTTDEAKEKIVEK
FT                   LASMGLGEKKVNFRLRDWLVSRQRYWGAPIPVVYCEECGIVPVPESQLPVELPYDVEFA
FT                   PDGKSPLAKSEAFVNTTCPHCGKPAKRETDTLDTFVCSSWYYLRYPDNKNTEAPFNPEL
FT                   INKMLPVDKYVGGPEHACMHLLYARFITKALRDMGYLNFDEPFTSLTHQGLILGPDGLK
FT                   MSKSKGNTISPDDYIKEYGADVFRMYLMFGFAYTEGGAWSDDGIKSVNRFVERIERIID
FT                   TAREAISKGENNKTTMDKAEKELNYWRHNTIKSVTDDTDKLQFNTAIARMMEFINALSK
FT                   YTQEKEMNLDFLKDVVSDYLRLLAPFAPHFSEEQWNLLGNSYSIFNEAWPKFDPKALVK
FT                   DEVEIAIQVNGKIKNKIMVSSDLDEEGIKAAALADEKIIASTEGKTVVKVIVIKGRLVN
FT                   IVVK"
FT   gene            769541..769684
FT                   /locus_tag="CPR_0646"
FT   CDS_pept        769541..769684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC14641.1"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87164"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV77"
FT                   /protein_id="ABG87164.1"
FT                   /translation="MGKKLKSATNNQWVSTTVDPNMVPAKDRQPKTAGDNQWTSTSKNP
FT                   MK"
FT   gene            769950..771002
FT                   /locus_tag="CPR_0648"
FT   CDS_pept        769950..771002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0648"
FT                   /product="IS1470, transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86761"
FT                   /db_xref="GOA:Q0SV76"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV76"
FT                   /protein_id="ABG86761.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKELNMYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDKVLLTLVERKTRYAIIS
FT                   EMPSHSAISVTQTLDKIKEFFGSKFSEVFKSITADNGSEFADLSEFELKTKTKVYFTHP
FT                   YSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIENWMNTLPRKLLDYKTPEELFE
FT                   IHLDEIYSLY"
FT   gene            complement(770999..771409)
FT                   /locus_tag="CPR_0647"
FT   CDS_pept        complement(770999..771409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0647"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87323"
FT                   /db_xref="GOA:Q0SV75"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV75"
FT                   /protein_id="ABG87323.1"
FT                   /translation="MTLKRLLNKKLRKLDISSRELSELKLELLDTAEEMKKDFLNEGFS
FT                   EKEANEKVINTLQIDELINSTKESYLKANLINTRILSSLFLGIYTIFILICISNTTNGG
FT                   GYLSKGAYLPFKFLSKLQYQIELVLNYDLRTN"
FT   gene            complement(771413..771736)
FT                   /locus_tag="CPR_0649"
FT   CDS_pept        complement(771413..771736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0649"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85604"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV74"
FT                   /protein_id="ABG85604.1"
FT                   /translation="MDREILKGSLEIILLSLLKNKDMYGYEMSKEIKNITENVLILGEG
FT                   TLYPALKRLKEKNLIQDYFIETNSSKKKRKYYKITEAGLIELNLKLKDFYLISNLIENI
FT                   KEE"
FT   gene            771961..772431
FT                   /locus_tag="CPR_0650"
FT   CDS_pept        771961..772431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86416"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV73"
FT                   /protein_id="ABG86416.1"
FT                   /translation="MNLVKTRDDLEREAPRLKKEWIQKIDSIDNANRKYVLVFEDLVFE
FT                   ADNEQDITSRLIRDYIETDDRNMQLLFRIDFARALSMYSIMNGINVEVYNNGKKVRNNY
FT                   AVSEDDPDYEKDYEIPDVILDVFDEFTLFKGLNELKYAKIYYKSDDGEYKLF"
FT   gene            772498..773028
FT                   /locus_tag="CPR_0651"
FT   CDS_pept        772498..773028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0651"
FT                   /product="lexa repressor"
FT                   /note="identified by match to protein family HMM PF01726"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86225"
FT                   /db_xref="GOA:Q0SV72"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV72"
FT                   /protein_id="ABG86225.1"
FT                   /translation="MKKREQIYTFLIDFIKEKGYQPTVREIAHAVNLKSSSTVYKHLEM
FT                   LEKDGLIKLGKREQRGRKRSIHIIDLNKKIKKNVSEETIKNLIKFSKKQVNTNNDIFSK
FT                   KVTNDYIVAVDNIFPDDIIIVEKVNSLKKDSIGLLLFENRTFIKKIFSDYEKVYNTDPI
FT                   VLGKIIGVYRDFF"
FT   gene            773314..773541
FT                   /locus_tag="CPR_0652"
FT   CDS_pept        773314..773541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0652"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86595"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV71"
FT                   /protein_id="ABG86595.1"
FT                   /translation="MRLSEEDKKCIKILYRNGLNVKETEKLLNNDFSKDAIKKHIYRHL
FT                   NEFRNEHIINISLNKNKLKKEFKNIIKNNF"
FT   gene            773607..773738
FT                   /locus_tag="CPR_0653"
FT   CDS_pept        773607..773738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85667"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV70"
FT                   /protein_id="ABG85667.1"
FT                   /translation="MRTAQEVANELDLTRTKVYNLLYSPLVKKNGGQVAISNELSNY"
FT   gene            complement(774122..774295)
FT                   /locus_tag="CPR_0654"
FT   CDS_pept        complement(774122..774295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0654"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86825"
FT                   /db_xref="GOA:Q0SV69"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV69"
FT                   /protein_id="ABG86825.1"
FT                   /translation="MKKNTKQILVSSILGASIALIVCLLFDYFGIPKNIFSYIFILIIF
FT                   LVISRSINNKYI"
FT   gene            complement(774295..774666)
FT                   /locus_tag="CPR_0655"
FT   CDS_pept        complement(774295..774666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87515"
FT                   /db_xref="GOA:Q0SV68"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV68"
FT                   /protein_id="ABG87515.1"
FT                   /translation="MSSIALQLPNSYVELEREEIEYVDGGFAVGVNFAGHAFNLIIAAI
FT                   CGGATASVSTFISSVGKKEAKKIFTRNIKSKLLEWGCERLAGKVAFAVDVALEFSDVGG
FT                   AIARFLDAHDTYPNNGWIG"
FT   gene            complement(774733..775845)
FT                   /locus_tag="CPR_0656"
FT   CDS_pept        complement(774733..775845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0656"
FT                   /product="putative bacteriocin ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85397"
FT                   /db_xref="GOA:Q0SV67"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV67"
FT                   /protein_id="ABG85397.1"
FT                   /translation="MKIYSINELTHSKILYDKNPPKFMMYIIIIVLALLVAFIVWSTKS
FT                   VKTYIIKGQGIVTTDTKSNVMTKMSGEITDVFIEEGKDVNEGDTLISLNPLESNLQLGQ
FT                   IQAQIQVINNRITLLDRAEKDATNGRNTFNKNNSDEVEFYNKLANLNTKRKEFIVDKEE
FT                   AKKQGATDEQIEKYEKSQKNKDDVTRYEGILQFTNEKKQLEFEKSKLEAQKKSLEEAAE
FT                   EFKIVAPKSGKLHLNVPLNKGMVLQAGSLIGTLTNKEEKIIIESLIPSNERPRIHIGDE
FT                   VSLAVLGLSQSEYGTIEGQVSSIDEDATIDNEKGNVFFKIKIEPQKTYLTDTKGEKVNL
FT                   TLGMLTETRVKYEKITYMKYFLDQLGIKIN"
FT   gene            complement(775832..776338)
FT                   /locus_tag="CPR_0657"
FT   CDS_pept        complement(775832..776338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86048"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV66"
FT                   /protein_id="ABG86048.1"
FT                   /translation="MMNTNMYKKITLKENKTLKLKNVLSRELTQSEFMNENKIMYMMES
FT                   YIKSKGNSIVGPMINYSSIISGENGQPKLVAKLMVQLKETIENLEEPYEFSSQIRVPNC
FT                   LFARFIEKEQNLQFAYAKLNLHAFENNIKLLGDNYTIFVERNKNNIVADIFMQMQNEVG
FT                   PIENI"
FT   gene            complement(776316..778598)
FT                   /locus_tag="CPR_0658"
FT   CDS_pept        complement(776316..778598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0658"
FT                   /product="lactococcin g processing and transport
FT                   atp-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87121"
FT                   /db_xref="GOA:Q0SV65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV65"
FT                   /protein_id="ABG87121.1"
FT                   /translation="MFYNNKYLIKQHDSTDCAAACLASVCMYYKKEITITKLRDILGTD
FT                   IKGTTLKGLENGANRLGFDTKAIRVDKSGFMSKFTLPAIAHIVTDEGLSHFVIIHKIKN
FT                   NKVIILDPAKGKEKENINEFFKRFDGILLLLAPNNDFSLDRSKEEGTLSKFIKILLPQK
FT                   KLFICSIISSVILTVLGISTSFFNKILIDEILPYGLKNQLIIFCICFITLGVTQVLISA
FT                   IRQHMLLYLSQKIDIPLLLGYFKHVYKLPTKFFETRKVGDILTRFSDAFVIKNILTSVT
FT                   LSLIIDIVLTVVSAIILCLMNKTLFLVVIILTLISASLIFIFKIPYKKINLKQMEASSS
FT                   LNSTIIESLRGIDTIKYHAAEEKTIEKLEKEYIKNLKITFQEGVLSNIQGSISSFISYT
FT                   GNLALMSIGATMVMSGKTTLGSLMAFTTLSGYFMGPINRLIGLQLSIQEASISLKRISE
FT                   IYEVEEEQEENDNKFKIKKIDGDIVLKNITFRYGSRSPVLKNLNLTIPKGKKVALVGES
FT                   GSGKTTISKLLLKSFDVEEGSIKISGKDINDIDLYSLRKAISYVPQNIELFSGTIKDNV
FT                   ILGKSNVTNEQISIACENAGCSSFIEKLPGKYDTFLEEAGRDLSGGEKQRIAMARALIK
FT                   DTDLLILDEATSNLDFISEARIYNTLFVKCKSKTMLIIAHRLSTIRNCDIIYVLHKGEV
FT                   VEQGNHQSLLDKKGYYYKLYVSQVGEISIEKKDRDKTIIKEESNIKIVDYNIENLEDME
FT                   NDEYEYV"
FT   gene            779002..779808
FT                   /locus_tag="CPR_0659"
FT   CDS_pept        779002..779808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0659"
FT                   /product="IS1470, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87597"
FT                   /db_xref="GOA:Q0SV64"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV64"
FT                   /protein_id="ABG87597.1"
FT                   /translation="MDYQNHNTESRKNKHLNMKERMIVEIRLKDGFSAYKIAKELNRPI
FT                   NTVLNEIRRGTTKQIKQGKELNVYFADTGEAVYKKNRLKSSRKYKLLECSDFIKYVVDK
FT                   VKNDHWSLDACVGEALHSSRFSPSQIISTKTLYNYVDLGLLPIKNIDLPAKLHRNKKST
FT                   RVRNNKKKLGTSISDRPNSIENREEFGHWEIDCVLGEKSNKDNVLLTLVERKTRYAIIS
FT                   EMPSHSAISVTKTLNKIKEFFGSKFSEVFKSITADNGSEFADLSEF"
FT   gene            779827..780054
FT                   /locus_tag="CPR_0660"
FT   CDS_pept        779827..780054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0660"
FT                   /product="IS1470, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85896"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV63"
FT                   /protein_id="ABG85896.1"
FT                   /translation="MYFTHPYSSFEKGTNERHNGLIRRFIPKGKRISDYSLETISFIEN
FT                   WMNTLPRKLLDYKTPEELFEIHLDEIYSLY"
FT   gene            complement(780153..780713)
FT                   /locus_tag="CPR_0661"
FT   CDS_pept        complement(780153..780713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0661"
FT                   /product="NUDIX domain protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86785"
FT                   /db_xref="GOA:Q0SV62"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV62"
FT                   /protein_id="ABG86785.1"
FT                   /translation="MNYIEDIKNYIPFNEQEEMDKELFLRCLNDFHDILTRDNKIAHLT
FT                   SSAFAVNKERNKFLMIHHNIYNSWAWTGGHSDNEKDQLKVAMKELKEETGVKNPTPLLD
FT                   KAFALDVLTVNGHIKRGKYVSSHLHLNLTYLIECSEEETLMLKEDENSGVIWIPFNEIS
FT                   KYCSEPHMIPIYEKLIEKLKSLK"
FT   gene            781006..781368
FT                   /locus_tag="CPR_0662"
FT   CDS_pept        781006..781368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0662"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV61"
FT                   /protein_id="ABG87010.1"
FT                   /translation="MEKDIKINEGLISICNDDYLNAMSLVKEKLNIYLEEPKVFSNEYI
FT                   LGTPGFKDNLRDNLKRALAIIFDFVAVYKKYEVNENIKNILEKARNIYAILEEAQGNIN
FT                   EDVLKSLKEIRAIEFK"
FT   gene            781565..782551
FT                   /gene="birA"
FT                   /locus_tag="CPR_0663"
FT   CDS_pept        781565..782551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="CPR_0663"
FT                   /product="BirA bifunctional protein"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by match to protein family HMM PF02237;
FT                   match to protein family HMM PF03099; match to protein
FT                   family HMM PF08279; match to protein family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABG86460"
FT                   /db_xref="GOA:Q0SV60"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV60"
FT                   /protein_id="ABG86460.1"
FT                   /translation="MSVKESVLKILEENRERSISGEELAKHLSVSRAAIWKTIKSLRGE
FT                   GYNISAVTNRGYQLTKDNDLISAEGIKIFLNPKYRENYIRVYKTIDSTNQEAKKLLMDN
FT                   DIPHGTILIAEEQTAGRGRFQRKFFSPFNKGIYMSVILRPNIELSKAIHITTSAAISVC
FT                   RAIETLTKKRPKIKWVNDIFLDDKKICGILTEATGNFESGRVENVVVGIGVNFKNDSKD
FT                   FPEDIKNIAGSIFGGEKPTITRNQLIAEILNELFELCENLEDKSIMTEYRILSSVLGKE
FT                   VSFLKNNKLNKGLAIDITDEGALVVKYENGEIDYLNSGEISVKTLNK"
FT   gene            782708..783793
FT                   /locus_tag="CPR_0664"
FT   CDS_pept        782708..783793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0664"
FT                   /product="HRDC domain protein"
FT                   /note="identified by match to protein family HMM PF00570;
FT                   match to protein family HMM PF08378"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABG87038"
FT                   /db_xref="GOA:Q0SV59"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV59"
FT                   /protein_id="ABG87038.1"
FT                   /translation="MLKEIIFGISSIKGPTWLKEFNENNKQLEDLKILSGKVYSEKKKL
FT                   IDRDIMYLTYGIEGEKNVSYEIKNSYIPMLALHDIRIEDGESVAQMDYILITKSFILVL
FT                   ETKALSGDITVNESGEFIRYFKNKEGKVYRKEGIYSPVAQNERPVRVLTEYLKKNKMIK
FT                   KYPIYSCVVIAKSKSVINKYKAPKEIKSQIIKYDQLTSFIKEKLNYHKIKQDFKVLDKV
FT                   EYSIGKFLLENNKPVEFDYYKKYSLSEEDFIKKESEVCSEEKSNNDNFNDEVLFNRDNK
FT                   SYEGKILINKNKEELRRKLKQLRINFAIKEKLPSYCIFNDETLNDLLDKMPKNKEELMK
FT                   VKGLAKVKINKYGEEILGVLN"
FT   gene            783954..784688
FT                   /locus_tag="CPR_0665"
FT   CDS_pept        783954..784688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CPR_0665"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CPR_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABG85342"
FT                   /db_xref="GOA:Q0SV58"
FT                   /db_xref="InterPro:IPR025238"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SV58"
FT                   /protein_id="ABG85342.1"
FT                   /translation="MPFTLAHPAAVVFFKNKKFNLTALILGSMAPDFIYFLNFRPYGNL
FT                   GHEILGFFILNLPLCILLAYIFHNFIKSPLISHLPRPLDNWYGYLRTEQFGLHSWKEVI
FT                   VFIYSALLGMITHVLWDGFTHKTGFFMRHITWLRQKIIIFGADEIYIYKLVQHTSTVIG
FT                   IIIVLFFLYKLRDSNTRILWGHKSFKDKFIYDLIVITTSIIVLVLSYIIFKYLSIPYGI
FT                   GNLVVSSINGIFIGILIASFKK"
FT   gene            784878..785183
FT                   /locus_tag="CPR_0666"
FT   CDS_pept        784878..785183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus