(data stored in ACNUC7421 zone)

EMBL: CP000316

ID   CP000316; SV 1; circular; genomic DNA; STD; PRO; 5200264 BP.
XX
AC   CP000316; AAFQ02000000-AAFQ02000045;
XX
PR   Project:PRJNA13121;
XX
DT   03-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Polaromonas sp. JS666, complete genome.
XX
KW   .
XX
OS   Polaromonas sp. JS666
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Polaromonas.
XX
RN   [1]
RP   1-5200264
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Munk A.C., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Anderson I., Richardson P.;
RT   "Complete sequence of chromosome of Polaromonas sp. JS666";
RL   Unpublished.
XX
RN   [2]
RP   1-5200264
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Munk A.C., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Anderson I., Richardson P.;
RT   ;
RL   Submitted (03-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b5020ca7d4d28fe34af00833c9cb8558.
DR   BioSample; SAMN02598293.
DR   EnsemblGenomes-Gn; Bpro_R0001.
DR   EnsemblGenomes-Gn; Bpro_R0002.
DR   EnsemblGenomes-Gn; Bpro_R0003.
DR   EnsemblGenomes-Gn; Bpro_R0004.
DR   EnsemblGenomes-Gn; Bpro_R0005.
DR   EnsemblGenomes-Gn; Bpro_R0006.
DR   EnsemblGenomes-Gn; Bpro_R0008.
DR   EnsemblGenomes-Gn; Bpro_R0009.
DR   EnsemblGenomes-Gn; Bpro_R0010.
DR   EnsemblGenomes-Gn; Bpro_R0011.
DR   EnsemblGenomes-Gn; Bpro_R0012.
DR   EnsemblGenomes-Gn; Bpro_R0013.
DR   EnsemblGenomes-Gn; Bpro_R0014.
DR   EnsemblGenomes-Gn; Bpro_R0015.
DR   EnsemblGenomes-Gn; Bpro_R0016.
DR   EnsemblGenomes-Gn; Bpro_R0017.
DR   EnsemblGenomes-Gn; Bpro_R0018.
DR   EnsemblGenomes-Gn; Bpro_R0019.
DR   EnsemblGenomes-Gn; Bpro_R0020.
DR   EnsemblGenomes-Gn; Bpro_R0021.
DR   EnsemblGenomes-Gn; Bpro_R0022.
DR   EnsemblGenomes-Gn; Bpro_R0023.
DR   EnsemblGenomes-Gn; Bpro_R0024.
DR   EnsemblGenomes-Gn; Bpro_R0025.
DR   EnsemblGenomes-Gn; Bpro_R0026.
DR   EnsemblGenomes-Gn; Bpro_R0027.
DR   EnsemblGenomes-Gn; Bpro_R0029.
DR   EnsemblGenomes-Gn; Bpro_R0030.
DR   EnsemblGenomes-Gn; Bpro_R0031.
DR   EnsemblGenomes-Gn; Bpro_R0032.
DR   EnsemblGenomes-Gn; Bpro_R0033.
DR   EnsemblGenomes-Gn; Bpro_R0034.
DR   EnsemblGenomes-Gn; Bpro_R0035.
DR   EnsemblGenomes-Gn; Bpro_R0036.
DR   EnsemblGenomes-Gn; Bpro_R0037.
DR   EnsemblGenomes-Gn; Bpro_R0038.
DR   EnsemblGenomes-Gn; Bpro_R0039.
DR   EnsemblGenomes-Gn; Bpro_R0040.
DR   EnsemblGenomes-Gn; Bpro_R0041.
DR   EnsemblGenomes-Gn; Bpro_R0042.
DR   EnsemblGenomes-Gn; Bpro_R0043.
DR   EnsemblGenomes-Gn; Bpro_R0044.
DR   EnsemblGenomes-Gn; Bpro_R0045.
DR   EnsemblGenomes-Gn; Bpro_R0046.
DR   EnsemblGenomes-Gn; Bpro_R0047.
DR   EnsemblGenomes-Gn; Bpro_R0048.
DR   EnsemblGenomes-Gn; Bpro_R0049.
DR   EnsemblGenomes-Gn; Bpro_R0050.
DR   EnsemblGenomes-Gn; Bpro_R0060.
DR   EnsemblGenomes-Gn; EBG00001133153.
DR   EnsemblGenomes-Gn; EBG00001133154.
DR   EnsemblGenomes-Gn; EBG00001133155.
DR   EnsemblGenomes-Gn; EBG00001133156.
DR   EnsemblGenomes-Gn; EBG00001133157.
DR   EnsemblGenomes-Gn; EBG00001133158.
DR   EnsemblGenomes-Gn; EBG00001133159.
DR   EnsemblGenomes-Gn; EBG00001133160.
DR   EnsemblGenomes-Gn; EBG00001133161.
DR   EnsemblGenomes-Gn; EBG00001133162.
DR   EnsemblGenomes-Gn; EBG00001133163.
DR   EnsemblGenomes-Gn; EBG00001133164.
DR   EnsemblGenomes-Gn; EBG00001133165.
DR   EnsemblGenomes-Gn; EBG00001133166.
DR   EnsemblGenomes-Gn; EBG00001133167.
DR   EnsemblGenomes-Gn; EBG00001133168.
DR   EnsemblGenomes-Gn; EBG00001133169.
DR   EnsemblGenomes-Gn; EBG00001133170.
DR   EnsemblGenomes-Gn; EBG00001133171.
DR   EnsemblGenomes-Gn; EBG00001133172.
DR   EnsemblGenomes-Gn; EBG00001133173.
DR   EnsemblGenomes-Gn; EBG00001133174.
DR   EnsemblGenomes-Gn; EBG00001133175.
DR   EnsemblGenomes-Gn; EBG00001133176.
DR   EnsemblGenomes-Gn; EBG00001133177.
DR   EnsemblGenomes-Gn; EBG00001133178.
DR   EnsemblGenomes-Gn; EBG00001133179.
DR   EnsemblGenomes-Gn; EBG00001133180.
DR   EnsemblGenomes-Gn; EBG00001133181.
DR   EnsemblGenomes-Gn; EBG00001133182.
DR   EnsemblGenomes-Gn; EBG00001133183.
DR   EnsemblGenomes-Gn; EBG00001133184.
DR   EnsemblGenomes-Gn; EBG00001133185.
DR   EnsemblGenomes-Gn; EBG00001133186.
DR   EnsemblGenomes-Gn; EBG00001133187.
DR   EnsemblGenomes-Gn; EBG00001133188.
DR   EnsemblGenomes-Gn; EBG00001133189.
DR   EnsemblGenomes-Gn; EBG00001133190.
DR   EnsemblGenomes-Gn; EBG00001133191.
DR   EnsemblGenomes-Gn; EBG00001133192.
DR   EnsemblGenomes-Gn; EBG00001133193.
DR   EnsemblGenomes-Gn; EBG00001133194.
DR   EnsemblGenomes-Gn; EBG00001133195.
DR   EnsemblGenomes-Gn; EBG00001133196.
DR   EnsemblGenomes-Gn; EBG00001133197.
DR   EnsemblGenomes-Gn; EBG00001133198.
DR   EnsemblGenomes-Gn; EBG00001133199.
DR   EnsemblGenomes-Gn; EBG00001133200.
DR   EnsemblGenomes-Gn; EBG00001133201.
DR   EnsemblGenomes-Gn; EBG00001133202.
DR   EnsemblGenomes-Gn; EBG00001133203.
DR   EnsemblGenomes-Gn; EBG00001133204.
DR   EnsemblGenomes-Gn; EBG00001133205.
DR   EnsemblGenomes-Gn; EBG00001133206.
DR   EnsemblGenomes-Tr; Bpro_R0001-1.
DR   EnsemblGenomes-Tr; Bpro_R0002-1.
DR   EnsemblGenomes-Tr; Bpro_R0003-1.
DR   EnsemblGenomes-Tr; Bpro_R0004-1.
DR   EnsemblGenomes-Tr; Bpro_R0005-1.
DR   EnsemblGenomes-Tr; Bpro_R0006-1.
DR   EnsemblGenomes-Tr; Bpro_R0008-1.
DR   EnsemblGenomes-Tr; Bpro_R0009-1.
DR   EnsemblGenomes-Tr; Bpro_R0010-1.
DR   EnsemblGenomes-Tr; Bpro_R0011-1.
DR   EnsemblGenomes-Tr; Bpro_R0012-1.
DR   EnsemblGenomes-Tr; Bpro_R0013-1.
DR   EnsemblGenomes-Tr; Bpro_R0014-1.
DR   EnsemblGenomes-Tr; Bpro_R0015-1.
DR   EnsemblGenomes-Tr; Bpro_R0016-1.
DR   EnsemblGenomes-Tr; Bpro_R0017-1.
DR   EnsemblGenomes-Tr; Bpro_R0018-1.
DR   EnsemblGenomes-Tr; Bpro_R0019-1.
DR   EnsemblGenomes-Tr; Bpro_R0020-1.
DR   EnsemblGenomes-Tr; Bpro_R0021-1.
DR   EnsemblGenomes-Tr; Bpro_R0022-1.
DR   EnsemblGenomes-Tr; Bpro_R0023-1.
DR   EnsemblGenomes-Tr; Bpro_R0024-1.
DR   EnsemblGenomes-Tr; Bpro_R0025-1.
DR   EnsemblGenomes-Tr; Bpro_R0026-1.
DR   EnsemblGenomes-Tr; Bpro_R0027-1.
DR   EnsemblGenomes-Tr; Bpro_R0029-1.
DR   EnsemblGenomes-Tr; Bpro_R0030-1.
DR   EnsemblGenomes-Tr; Bpro_R0031-1.
DR   EnsemblGenomes-Tr; Bpro_R0032-1.
DR   EnsemblGenomes-Tr; Bpro_R0033-1.
DR   EnsemblGenomes-Tr; Bpro_R0034-1.
DR   EnsemblGenomes-Tr; Bpro_R0035-1.
DR   EnsemblGenomes-Tr; Bpro_R0036-1.
DR   EnsemblGenomes-Tr; Bpro_R0037-1.
DR   EnsemblGenomes-Tr; Bpro_R0038-1.
DR   EnsemblGenomes-Tr; Bpro_R0039-1.
DR   EnsemblGenomes-Tr; Bpro_R0040-1.
DR   EnsemblGenomes-Tr; Bpro_R0041-1.
DR   EnsemblGenomes-Tr; Bpro_R0042-1.
DR   EnsemblGenomes-Tr; Bpro_R0043-1.
DR   EnsemblGenomes-Tr; Bpro_R0044-1.
DR   EnsemblGenomes-Tr; Bpro_R0045-1.
DR   EnsemblGenomes-Tr; Bpro_R0046-1.
DR   EnsemblGenomes-Tr; Bpro_R0047-1.
DR   EnsemblGenomes-Tr; Bpro_R0048-1.
DR   EnsemblGenomes-Tr; Bpro_R0049-1.
DR   EnsemblGenomes-Tr; Bpro_R0050-1.
DR   EnsemblGenomes-Tr; Bpro_R0060-1.
DR   EnsemblGenomes-Tr; EBT00001724633.
DR   EnsemblGenomes-Tr; EBT00001724634.
DR   EnsemblGenomes-Tr; EBT00001724635.
DR   EnsemblGenomes-Tr; EBT00001724636.
DR   EnsemblGenomes-Tr; EBT00001724637.
DR   EnsemblGenomes-Tr; EBT00001724638.
DR   EnsemblGenomes-Tr; EBT00001724639.
DR   EnsemblGenomes-Tr; EBT00001724640.
DR   EnsemblGenomes-Tr; EBT00001724641.
DR   EnsemblGenomes-Tr; EBT00001724642.
DR   EnsemblGenomes-Tr; EBT00001724643.
DR   EnsemblGenomes-Tr; EBT00001724644.
DR   EnsemblGenomes-Tr; EBT00001724645.
DR   EnsemblGenomes-Tr; EBT00001724646.
DR   EnsemblGenomes-Tr; EBT00001724647.
DR   EnsemblGenomes-Tr; EBT00001724648.
DR   EnsemblGenomes-Tr; EBT00001724649.
DR   EnsemblGenomes-Tr; EBT00001724650.
DR   EnsemblGenomes-Tr; EBT00001724651.
DR   EnsemblGenomes-Tr; EBT00001724652.
DR   EnsemblGenomes-Tr; EBT00001724653.
DR   EnsemblGenomes-Tr; EBT00001724654.
DR   EnsemblGenomes-Tr; EBT00001724655.
DR   EnsemblGenomes-Tr; EBT00001724656.
DR   EnsemblGenomes-Tr; EBT00001724657.
DR   EnsemblGenomes-Tr; EBT00001724658.
DR   EnsemblGenomes-Tr; EBT00001724659.
DR   EnsemblGenomes-Tr; EBT00001724660.
DR   EnsemblGenomes-Tr; EBT00001724661.
DR   EnsemblGenomes-Tr; EBT00001724662.
DR   EnsemblGenomes-Tr; EBT00001724663.
DR   EnsemblGenomes-Tr; EBT00001724664.
DR   EnsemblGenomes-Tr; EBT00001724665.
DR   EnsemblGenomes-Tr; EBT00001724666.
DR   EnsemblGenomes-Tr; EBT00001724667.
DR   EnsemblGenomes-Tr; EBT00001724668.
DR   EnsemblGenomes-Tr; EBT00001724669.
DR   EnsemblGenomes-Tr; EBT00001724670.
DR   EnsemblGenomes-Tr; EBT00001724671.
DR   EnsemblGenomes-Tr; EBT00001724672.
DR   EnsemblGenomes-Tr; EBT00001724673.
DR   EnsemblGenomes-Tr; EBT00001724674.
DR   EnsemblGenomes-Tr; EBT00001724675.
DR   EnsemblGenomes-Tr; EBT00001724676.
DR   EnsemblGenomes-Tr; EBT00001724677.
DR   EnsemblGenomes-Tr; EBT00001724678.
DR   EnsemblGenomes-Tr; EBT00001724679.
DR   EnsemblGenomes-Tr; EBT00001724680.
DR   EnsemblGenomes-Tr; EBT00001724681.
DR   EnsemblGenomes-Tr; EBT00001724682.
DR   EnsemblGenomes-Tr; EBT00001724683.
DR   EnsemblGenomes-Tr; EBT00001724684.
DR   EnsemblGenomes-Tr; EBT00001724685.
DR   EnsemblGenomes-Tr; EBT00001724686.
DR   EuropePMC; PMC2570305; 18723656.
DR   EuropePMC; PMC4702634; 26452553.
DR   EuropePMC; PMC6015842; 29967598.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000316.
DR   SILVA-SSU; CP000316.
DR   StrainInfo; 352284; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634502
CC   Source DNA and bacteria available from James Gossett
CC   (jmg18@cornell.edu)
CC   Contacts: James Gossett (jmg18@cornell.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5200264
FT                   /organism="Polaromonas sp. JS666"
FT                   /strain="JS666"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:296591"
FT   gene            40..1434
FT                   /locus_tag="Bpro_0001"
FT   CDS_pept        40..1434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41968"
FT                   /db_xref="GOA:Q12HM4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HM4"
FT                   /protein_id="ABE41968.1"
FT                   /translation="MSEVSIPSLSHDLWQNCVDHLAQELPEQQFNTWIRPLVVHVAADL
FT                   SKVTIQVGNRFKLDWIRAQYAARISALLEKISGHRISLELALAPREPAAKSASLTRSFE
FT                   GVGVAEPAGLGVPEEAAGAPFKNRLNSALTFDTLIEGTANRMGRAAALHVSSSLGQLYN
FT                   PLFIYGGVGLGKTHLMHAIGNKLLADNPAAKVLYIHAEQFVSDVVKAYQRKTFDEFKER
FT                   YHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLTKKSHIVMTSDTYPKGLTDIHERLVS
FT                   RFDSGLTVAIEPPELEMRVAILIRKAEAEGTVMPEEVAFFVAKNVRSNVRELEGALRKI
FT                   LAYSRFNLKEISIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKKRPAS
FT                   IARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKMSAERQQMTELNQQLHVL
FT                   EQTLKG"
FT   gene            1723..2829
FT                   /locus_tag="Bpro_0002"
FT   CDS_pept        1723..2829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41969"
FT                   /db_xref="GOA:Q12HM3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HM3"
FT                   /protein_id="ABE41969.1"
FT                   /translation="MIVLKATQDKVLSVLQSVAGIVERRHTLPILANVLIRKTGAQLQL
FT                   TTSDLEIQIRTSADLDGDAGNFTTTVGARKLIDILRSMPSDQTVSLESAQSKLILKGGK
FT                   SRFTLQTLPAEDFPLVQEAANFGPSFSVPQKVLKELLNQVSFAMAVHDIRYYLNGILFV
FT                   AEGKQLSLVATDGHRLAFSSATLDVEVPKQEVILPRKTVLEMQRLLSDKEGAIEMQFAG
FT                   NQAKFSFEGMEFVTKLVEGKFPDYNRVIPKNHKNIITLGRVPLLASLQRTAILTSEKFK
FT                   GVRLNIEPGTLRVASNNAEQEEAVDELDIDYGGDAIEIGFNVTYLIDALANMEQDMVKI
FT                   ELADSNSSALLTIPDDAAFKYVVMPMRI"
FT   gene            2944..5568
FT                   /locus_tag="Bpro_0003"
FT   CDS_pept        2944..5568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41970"
FT                   /db_xref="GOA:Q12HM2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HM2"
FT                   /protein_id="ABE41970.1"
FT                   /translation="MTEENNVNGADQVHVTDGTAGEESSNFQPKIDTNQAGASEAYGEG
FT                   SIQILEGLEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHTDN
FT                   SISVTDNGRGIPTGIKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSC
FT                   VNALSKMLRLTIRRDGKVHVMEFSRGFVQNRIIEQINGVDVSPMKVMDHTDKRGTEVHF
FT                   LPDTEIFKENNDFHYEILSKRLRELSFLNNGVRIRLKDERSGKEDDFAGAGGVKGFVEF
FT                   INKGKTVLHPNVFAAMGDRQSDQGTNIGVEVAMQWNSGYSEQVLCFTNNIPQRDGGTHL
FT                   TGLRAAMTRVINKYIDDSELAKKAKVEVTGDDMREGLCCVLSVKVPEPKFSSQTKDKLV
FT                   SSEVRGPVEDIVSRLLHDYLQERPNDAKIIVGKIIEAARAREAARKARDMTRRKGVLDG
FT                   MGLPGKLADCQEKDPAMCEIYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYE
FT                   KLLTSNEILTLITALGTGIGKAGGIGGTPGTDDFNVAKLRYHRIIIMTDADVDGAHIRT
FT                   LLLTFFYRQMPELVERGHIYIAQPPLYKVKAGKEEQYLKDTAALDGFLLRIALKDASVQ
FT                   TGADASTVLTGDTLAELARKHQLAESVIARLRGFMDAEALRAIADGVSLNLDTVADAEA
FT                   SAVTLQVKLRELNTTGAPADVAGEFDTRTDKPILRISRRHHGNVKSSVITQDFVHGADY
FT                   ATLADAAATFRGLISEGAKVMRGEGERQKEEKVSDFRQAMAWLIGQAENATARQRYKGL
FT                   GEMNPAQLWETTMDPQVRRLLRVQIDDAIEADHVFTMLMGDEVEPRREFIEQNALRAAN
FT                   IDV"
FT   gene            5583..7565
FT                   /locus_tag="Bpro_0004"
FT   CDS_pept        5583..7565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41971"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HM1"
FT                   /protein_id="ABE41971.1"
FT                   /translation="MTSRAYYSELIEEFVGESSDQILGVLSRRSSFAVEGTQRDAWVEQ
FT                   IRILKRILAPYRRRGKVYFEYSVPRLGKRIDVIAVIDHVVFVLEFKVGESEFSSSAIDQ
FT                   VWDYALDLKNFHETSHDKPVAPILVATRAESGATVVAAAHDDIVLRPILVASDDLSVAI
FT                   EQVLALCDGPIISPSVWERGRYYPTPTIVEAAMALYGGHAVAEISRNDASAINLSRTSE
FT                   SVAEVIRSAKENSRKAICFVTGVPGAGKTLVGLNIATKHIDKDSELYSVFLSGNGPLVD
FT                   ILREALARDRVSREVATGRKMKKGTAVSEVKAFIQNVHHFRDDCLQDMARPPVEHVAIF
FT                   DEAQRAWNLEQTAAFMSRKKGRADFKLSEPEFLISCLDRHQDWAVVVCLVGGGQEINTG
FT                   EAGIGEWIQSLQRSFPEWRIHISPQLHDEEYGAGAVMREIADRPGVHLNEHLHLAVSMR
FT                   SFRAEHVSALVKHLLDRDADAARAMLARVQDRYPIVVTRSLQKAKSWLKQQARGSERFG
FT                   MVVSSQAQRLRPHAIDVRSPMDPIHWFLDGKHDVRSSFYLEDVATEFHVQGLELDWACV
FT                   VWDADFRYGHDGWLHRSFVGSKWNKINLPHRQTFLKNAYRVLLTRARQGMVIVVPEGDI
FT                   EDPTRAPSFYDPTFDYLSSIGFSQS"
FT   gene            complement(7574..8014)
FT                   /locus_tag="Bpro_0005"
FT   CDS_pept        complement(7574..8014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41972"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HM0"
FT                   /protein_id="ABE41972.1"
FT                   /translation="MCPSFEPMSPQAMPWVTTWLAQPMLSAPQLFSKRMKHPAKDLPDW
FT                   GEMPTRPGLYLSLSHGRDFPQQTMRGRGFPGPKIGPVLYVRTQYGQEVTLRFANKRDAA
FT                   RFFPNATTTTHTLQVIEGTLVYSDKCFGDWNVCFIAAEFCVK"
FT   gene            8077..8559
FT                   /locus_tag="Bpro_0006"
FT   CDS_pept        8077..8559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41973"
FT                   /db_xref="GOA:Q12HL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL9"
FT                   /protein_id="ABE41973.1"
FT                   /translation="MHIVGTKHLSFRRSHMENRIPLPTDNIFKFYALFGLVLFIFCFAS
FT                   TIYTTKATNEFMSIAVVDLEELKAIPTPSVREAAKRQILQRQIEVARSDKEFFQWACAA
FT                   IGAVGLVAMVVGFAKWHKEIQPTLDEISRLQLLKLRHEVEGLQPRSNQVRRLSRKR"
FT   gene            8675..8914
FT                   /locus_tag="Bpro_0007"
FT   CDS_pept        8675..8914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41974"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL8"
FT                   /protein_id="ABE41974.1"
FT                   /translation="MKKLAYFLLRPRYLRAIPSLVVLTTAMAWGVAPDSDAMDTVQKKA
FT                   VGVTLSLNHTAAASANPKDDKPAADAAAGDSLAG"
FT   sig_peptide     8675..8767
FT                   /locus_tag="Bpro_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.741 at
FT                   residue 31"
FT   gene            9217..9795
FT                   /locus_tag="Bpro_0008"
FT   CDS_pept        9217..9795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0008"
FT                   /product="NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41975"
FT                   /db_xref="GOA:Q12HL7"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL7"
FT                   /protein_id="ABE41975.1"
FT                   /translation="MAVLILGLILFLGVHSTRIVADGWRTQMIAKVGEKPWKGVYALLS
FT                   IAGFVLLVWGYGLARQSPVVLWTPPVGMRHVAALLMLLAFILLVATYVPRNAIKATLHH
FT                   PMLLSVKVWALAHLLANGTLAGVVLFGSFLVWAVVCFKAARGRDRVAQTVYPPGTATGT
FT                   AITMAVGLVAWAGFAFWAHGVLIGVRPLG"
FT   gene            9806..10417
FT                   /locus_tag="Bpro_0009"
FT   CDS_pept        9806..10417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0009"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41976"
FT                   /db_xref="GOA:Q12HL6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL6"
FT                   /protein_id="ABE41976.1"
FT                   /translation="MKPIAVIDFETTGLSPAMGDRATEVAIVLVEGGRVVDRFQSLMNA
FT                   GVRIPAFITSLTGITNAMVASAPDAATVMTDANRFVGNAPLVAHNASFDRKFWEAELSR
FT                   AGERASQPFACTMLVSRRLYPQAPSHKLGVLVDYHHLPKAGRAHRALADAEMAASLLGQ
FT                   IQHDLRSRHGVDRPDHALLMALQRCAKPAVRALMAQYTGA"
FT   gene            10619..10816
FT                   /locus_tag="Bpro_0010"
FT   CDS_pept        10619..10816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41977"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL5"
FT                   /protein_id="ABE41977.1"
FT                   /translation="MTYKQNPRDEKVEHLGKVVNDHNKVGEQPLTQKNEAQRTSESRAD
FT                   REAHIGSANQTQSRRGNTGR"
FT   gene            complement(10874..12052)
FT                   /locus_tag="Bpro_0011"
FT   CDS_pept        complement(10874..12052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0011"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41978"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL4"
FT                   /protein_id="ABE41978.1"
FT                   /translation="MILRNIEPILCTRLATVVPAVVLLGPRQVGKTTLARKIAADWPGG
FT                   AVYLDMERPADRRRLDDADAYLRAQNGKLVVIDEIQRAPGLFEVLRGIIDDRRAAGERF
FT                   GHFLLLGSAALELMRQSSETLAGRVAYLEIGPIDILEAGTASLDAQTLWLRGGFPESLL
FT                   AQGDGPSLDWRRDFIRSYLERDVPMFAPRMPVQALGRLWTMLAHQQGGLLNQARLAAGL
FT                   GVSAPTVTRYTDLMVDLQLVRRLAPWSGNVGKRLVKAPKVYVRDSGIVHALLDLETWND
FT                   VLGHPVAGPSYEGFVIENLIQCAGPRWRPYFYRTHDGAEIDLLLERGGQPEIAIEVKKS
FT                   SAPTLDKGFGMACDDLKVLQRYVVYPGEETYPVRHGTQAIGLAALARQMQDA"
FT   gene            12199..12507
FT                   /locus_tag="Bpro_0012"
FT   CDS_pept        12199..12507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0012"
FT                   /product="Prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41979"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL3"
FT                   /protein_id="ABE41979.1"
FT                   /translation="MRARRHPIYNLTRLTRWEVLMSTWQLQEAKGKFSEVVKRALSEGP
FT                   QGITVRGEPVAVLISRAEYARLTHPKPRFVEFMRRSPMAGLELDTGRHTGLTREIAL"
FT   gene            12504..12926
FT                   /locus_tag="Bpro_0013"
FT   CDS_pept        12504..12926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0013"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41980"
FT                   /db_xref="GOA:Q12HL2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL2"
FT                   /protein_id="ABE41980.1"
FT                   /translation="MSYLIDTNVISELVRPKPDPAVLHWFANTPDDALFLSALTLGEIR
FT                   KGVEKLADTQRREELRLWLEHDLRDWFGPRILPIGPDVADHWGRLLAQAGRPVPAIDSL
FT                   LAATALHHDLRLVTRNTRDFDYAGLEVINPWETAAG"
FT   gene            13100..14320
FT                   /locus_tag="Bpro_0014"
FT   CDS_pept        13100..14320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0014"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41981"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL1"
FT                   /protein_id="ABE41981.1"
FT                   /translation="MPAKSQKFALYDHPAQMEPLLPGEHLLEPLLEQAHDLQREARSLA
FT                   GAGAPADLRQLLRAMNSYYSNKIEGQHTLPFEIERALRNDYSQDGDKARRQRLALAHME
FT                   TERAIETGWKGWSSQQVWSAQMVRDIHQDLFARLPDADRVLPEGDVLVPGALRDREVSV
FT                   GVHAAPAHAAISAMLERWGGFYGGVRRGELQVLAVAASHHRLAWIHPFRDGNGRVARLH
FT                   THLALGALGLTNGLWSPLRGFARSHEAYYLHLAAADEPRAGDLDGRGNLSERALMAWMR
FT                   YVLGLCIDQVRFMAGLLDMAGMKDRIAACLAFEENVVKRGVRSESLRALHYLLLTQAEL
FT                   ERSEFKALLGLGERLATAQVTALLKRGLLVTDSPHGKLRFGVPQHALRFYFPSLWPEAE
FT                   AGGDAGQ"
FT   gene            complement(14503..15492)
FT                   /locus_tag="Bpro_0015"
FT   CDS_pept        complement(14503..15492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41982"
FT                   /db_xref="GOA:Q12HL0"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HL0"
FT                   /protein_id="ABE41982.1"
FT                   /translation="MYRMSASETPASLLLPPQRSMASQLWVQRRPSRANPAGSPGAGRY
FT                   IGRQFQRKAAVRSKLFSLFSRFIAIGVLLMAALLSNMTHAQEKVGVLMLHGKNPGSNSD
FT                   PSMARIKTTLEQAGLLVQFPDMPWSRGRYLDGHWDKAMAEMAGHVKALRSQGAGKIVVM
FT                   GHSMGVPAAMGFAARGGDVQALVLLAPGHVPARYYVAQQNKVVRESVDEARQLVAAGKG
FT                   DSRERFSDINQGRQINVVATARDYLSYFDPESDADMGVTAPRVPATTPVLTVIGDADGI
FT                   IAYARGYFVDKLPAHPKSQYLEVKANHLTTPAVASDAVVQWIKAATAP"
FT   gene            15672..16328
FT                   /locus_tag="Bpro_0016"
FT   CDS_pept        15672..16328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41983"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK9"
FT                   /protein_id="ABE41983.1"
FT                   /translation="MTRFQNFPAQLPSTRPSRPARAARPRMLRAIPSMVILTTAMAWGA
FT                   ASYAGVPGLDGASAGQGGLIVAAGPAGVGVGAGVGAGAGGGVSVGTVGVGAGGGANTGV
FT                   TVGGGTANKGLGLDTAAQAGANRNVTAEERAAATAEADVRAGGAVNASGGTSRAGAVLD
FT                   DAKGTARATGSTVRKTGQGITRGVTSGAQGAGSVDAAAGAGVNASGGVAGGAVSR"
FT   sig_peptide     15672..15821
FT                   /locus_tag="Bpro_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.743 at
FT                   residue 50"
FT   gene            complement(16482..18260)
FT                   /locus_tag="Bpro_0017"
FT   CDS_pept        complement(16482..18260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0017"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41984"
FT                   /db_xref="GOA:Q12HK8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK8"
FT                   /protein_id="ABE41984.1"
FT                   /translation="MTQKTRFYVPDSVQHCTWTRQRYHRPMLLETLGAAREIGRINEIA
FT                   GVLIRHGFGDTVRRLGLADRLERAGHIVKWEHAADLARLEPPVQVRLALEELGPTFVKL
FT                   GQILAGRADLLGPEWIAELQRLHSQVPAVPLDDLRPQLREDLGDEPENIFARFDVEPLA
FT                   AASIAQVHRAQLHDGSEVVVKIRRPGIREVIEADLRLLDRLAAIAEADMPSLKPYRPRR
FT                   LVREFARSLRRELDLAVECHNAERVADNFAQTPHVLIPRVHWAHTSERINTQDFVDGIP
FT                   GERLDLLPADAGFDRTVLAQRGARAVLKMIVEDGFFHADPHPGNVFYLPGNRIAFIDFG
FT                   MVGSLSPQRREELLQLLLGLVTRDAQAVATVLLDWAGDDHGQSLSQLETEIEAFVDQYH
FT                   GSPLAQLNLGEMLTRITTLLREHHLTLPPDLALLIKAFISLEGMGRGLDPGFHMATEAM
FT                   PLLQEVARARYQPGAIAARGWKTLLRALRLAEQLPHDLSRLLRNARRGQLRVSIEVTHL
FT                   KRVGDQLDRAANRLAMALVIAALIIGSSIVMTVRGGPTLFGLPVFGFLGFCGAVACALW
FT                   LVRAIWRSSRPQDDDA"
FT   gene            complement(18471..18731)
FT                   /locus_tag="Bpro_0018"
FT   CDS_pept        complement(18471..18731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0018"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41985"
FT                   /db_xref="GOA:Q12HK7"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12HK7"
FT                   /protein_id="ABE41985.1"
FT                   /translation="MASFLSFLLGEKKQTASVAKERLQIILAHERTGRSHKPDYLPALQ
FT                   RDLIAVIAKYIHINPNDIKLHLERQDNLDVLEVKIELPDAK"
FT   gene            complement(18736..19554)
FT                   /locus_tag="Bpro_0019"
FT   CDS_pept        complement(18736..19554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0019"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41986"
FT                   /db_xref="GOA:Q12HK6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK6"
FT                   /protein_id="ABE41986.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASFATALALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIHGEATLNQALIKDKQCHNLYVLAASQTRDKDALTKDGVEK
FT                   VLKDLATMDFEYIVCDSPAGIETGALLAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TKRAIDGGDPIKEHLLITRYNPSRVDQGQMLSLEDIKDILRIKLIGVIPESESVLQASN
FT                   QGVPAVHIHGSDVSEAYKDVVDRFLGDKDKPLRFIDAQKPGLLKRWFGGK"
FT   gene            complement(19602..20399)
FT                   /locus_tag="Bpro_0020"
FT   CDS_pept        complement(19602..20399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0020"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41987"
FT                   /db_xref="GOA:Q12HK5"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK5"
FT                   /protein_id="ABE41987.1"
FT                   /translation="MTVALQATAPATFEIKSANLPLVALLLKTTDLVALSRELALRFGD
FT                   IPDFFDQDALLIDLSPLAATARAGSGDIDFPALITLLGDYQLVPITVKGGTPAQMAAAL
FT                   QAGLLPVPDAQLTGGRAAVQTQTHMQTAPTLEHAAPTHPPPPAPLGALVIDKPLRSGQQ
FT                   VYARGRDLVVLAMVNAGAEVIADGHIHVYAPLRGKAMAGARGNTDARIFSLALDAELLS
FT                   IAGVYRTSEHPLPPGVAGQPTQVRLVPGAEGEGDKLVMTVMGA"
FT   gene            20761..21927
FT                   /locus_tag="Bpro_0021"
FT   CDS_pept        20761..21927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0021"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41988"
FT                   /db_xref="GOA:Q12HK4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK4"
FT                   /protein_id="ABE41988.1"
FT                   /translation="MNLLPLAAVSALLHGYIGIRLVPGLAAVPPGQFLMMGVLVLSALL
FT                   MPLGLMARRVARPPLADTLSWVGLLCMGLFSSLLVLTLLRDAGLLVLWLGNLLVPGLLP
FT                   LAEVRRASAEAVPLLGLGATLLGFLNARRTAAVVRVDVPIKGLPAAWQGFTVAQISDIH
FT                   VGPTIKQRYLRRIVDKVNALGVDVVAITGDLVDGKVSELAAHVAPLAQLQSRHGTYFVT
FT                   GNHEYYSGVQPWIDELRRLGLTVLLNEHVVIRQPGSSSEAGDASAALVLAGVTDYSAAH
FT                   FDPAHRSDPEAALRGAPPAAVRVLLAHQPRSAEAAAKAGFDLQLSGHTHGGQFYPWNLF
FT                   VRFQQPFTAGLHRLHNLWVYTSRGTGYWGPPKRFGAPSEITWLRLVAG"
FT   gene            complement(22027..22536)
FT                   /locus_tag="Bpro_0022"
FT   CDS_pept        complement(22027..22536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41989"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK3"
FT                   /protein_id="ABE41989.1"
FT                   /translation="MLRQEKVSKEKATRSLGPLRCATGQPAVLEANGVSLELAALRQSR
FT                   ALIRLPLRSSAQLGRVGANTEYLKKNQYKQGRATECLCGLRSWVFEFGVWLLAFLSPTP
FT                   SVCAEERRARRIRDRDCLSEVQRSEFERDPAWPEHRRLPVAKRRDADSRVAFSFAYFSL
FT                   GEAKEK"
FT   gene            22740..23120
FT                   /locus_tag="Bpro_0023"
FT   CDS_pept        22740..23120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41990"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK2"
FT                   /protein_id="ABE41990.1"
FT                   /translation="MQPQVLTAAIMLALGGLAGPWALAQTSADSPTPMSSPETARPADS
FT                   DLQNVKPRPPTADQAVPLRNPLNRNPARRMAPVTDPVAPPDPRDSSVRPALPPGYQDGR
FT                   DTVLPAAGTAPLPTPGASAPVK"
FT   sig_peptide     22740..22814
FT                   /locus_tag="Bpro_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.685 at
FT                   residue 25"
FT   gene            complement(23414..24430)
FT                   /locus_tag="Bpro_0024"
FT   CDS_pept        complement(23414..24430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0024"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41991"
FT                   /db_xref="GOA:Q12HK1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK1"
FT                   /protein_id="ABE41991.1"
FT                   /translation="MTTSPDAARPAVPAPRRKSRHKFTGKAWWPWLKRGASVVFFALVI
FT                   GLLVSQARHIEWHQVLTSLQRYPLTAAWGAVLLALTSFALYSTFDLLGRHYTDHTLPAP
FT                   TVMLVTFISYAFNLNLGSLVGGVAFRFRLYSRLGLPTGVITRIMSLSMLSNWMGYLLLG
FT                   GLIFSLRPPAVPADWGIDTAHLRLIGFALLAGAAGYLGVCVFSRQRVFWLRGHEIDLPS
FT                   VRLAGLQLVMGATNWLVMSGIIFILLQHRIEFSAVVSVLLLAAIAGVITHIPGNLGVLE
FT                   AVFVALLSHQMARHELLAALVAYRVIYYLMPLGIATVAYLIIETRAKKASSPGKQAA"
FT   gene            complement(24438..25748)
FT                   /locus_tag="Bpro_0025"
FT   CDS_pept        complement(24438..25748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0025"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41992"
FT                   /db_xref="GOA:Q12HK0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HK0"
FT                   /protein_id="ABE41992.1"
FT                   /translation="MSPWISGNQFRLLENGEEYFPRVFACIAAAEREVVLETFILFDDK
FT                   VGQALHAALLQAATRGVQIDITVDGYGSPDLSHEFISALTQAGVRVHVFDPGPRLWGWR
FT                   TNLFRRMHRKIVVIDGQRAFVGGLNYSADHLADFGPAAKQDYAVEIEGPIVTFIHAFVH
FT                   RALAAGQRNAQDSLAGRLRERLSSRAHSLARSWGLAPPSQAAAAPAGEAAAIFVTRDNR
FT                   EHTNDIERHYRIAIRVARQRIVIANAYFFPGYRLLKEMRKAARRGVDVRLILQGAPDMP
FT                   FVKTAASMLYHHLLEAGVQIYEYCERPLHGKVAVADDEWATVGSSNLDPLSLSLNLEAN
FT                   VVIRDRAFNQVLSARLDHLMQHGCKQIGPGDLQESSGWRIVRSFFLFHLLRRYPAWAGW
FT                   LPAHAPRLTPALAPADPTAHISTAQADAVHRADPTTP"
FT   gene            complement(25975..26778)
FT                   /locus_tag="Bpro_0026"
FT   CDS_pept        complement(25975..26778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0026"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41993"
FT                   /db_xref="GOA:Q12HJ9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ9"
FT                   /protein_id="ABE41993.1"
FT                   /translation="MAAVKADTQAALAAASAESSFLFKVLTVNIHKGFTFFNRKFILPE
FT                   LREAVRTVGADVVFLQEVTGNHLKHADKFDNYPDTPHYEFLADTIWPQFAYGRNAVYTN
FT                   GHHGNAVLSKFPIVRFENRDVSISGPERRGLLHCELKVPGRSVNVHAVCVHLGLMETHR
FT                   VQQMEMLCDLVRKDIPPHAPVVVAGDFNDWRLRAHTLLESGADLHEVFVQANGQAARTF
FT                   PARLPLLRLDRIYVRNAIGHAPVVLPSRPWSHLSDHAPLAAEIEL"
FT   gene            27556..28011
FT                   /locus_tag="Bpro_0027"
FT   CDS_pept        27556..28011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0027"
FT                   /product="60S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41994"
FT                   /db_xref="GOA:Q12HJ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ8"
FT                   /protein_id="ABE41994.1"
FT                   /translation="MLKNFSVKAIPLAAAMTAALMLGAAAHAQIAPAGGTPKSVEERNA
FT                   AKPGKMAPTAAATKSQDDTVSPAPAGGAPKSVEERNAAKPGKMAPTAAATKSRDDIVSP
FT                   APAGGTPKSAEERAAAKAEKKATRDAKRAARKEKAPPTDSLKGVAPG"
FT   sig_peptide     27556..27642
FT                   /locus_tag="Bpro_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.965 at
FT                   residue 29"
FT   gene            complement(28114..29184)
FT                   /locus_tag="Bpro_0028"
FT   CDS_pept        complement(28114..29184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0028"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41995"
FT                   /db_xref="GOA:Q12HJ7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ7"
FT                   /protein_id="ABE41995.1"
FT                   /translation="MTDIRKGQAPAVLSRGVFHERFMQSFMDPAFRAEDSAISRVEQIA
FT                   WEAYQQGRKAPLTRKAGPGYADPDYELSVEWLETRSRLEKAQAAWQDPATRSRVLLVCG
FT                   SARNDGTCPGEISKTFRMLQWAQETLQQAQLDTDVLDLSLLTSSYQLHIHPCKGCVSTA
FT                   MPLCHWPCSCYPNHSLGQTGDWMADIYERWTAAHAVIIVTPVYWYQSPSPLKLMMDRLV
FT                   CADGGNPDPTSTHGKKPAEAKALEMTGWDYPKHLAGRAYGLVVHGDVAGIEGVRRGLSD
FT                   WLDWMGLIDAGSQARLDRYVGYYEPYATSHASLDADQPVQAEVRNVAGAVANAVKALRA
FT                   GTLSQPDQGLARPRPK"
FT   gene            complement(29716..30282)
FT                   /locus_tag="Bpro_0029"
FT   CDS_pept        complement(29716..30282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41996"
FT                   /db_xref="GOA:Q12HJ6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ6"
FT                   /protein_id="ABE41996.1"
FT                   /translation="MKSVLRPFPSSLKASVHSLIVAGLLATAGASVMAQGAPMAPPAGP
FT                   AAAGQPPAPRGEHMGRHDPAKMQAWIAKRQAELKAQLKLTPAQEGAWTAYTAAMHPPVH
FT                   GARPTPEQRAEFDKLTTPERIDKMRALRSQRMSEMAAAMDKRDAATKTFYAALMPEQQK
FT                   TFDVEHKKRGHHGGRGHHEGGPRKG"
FT   sig_peptide     complement(30178..30282)
FT                   /locus_tag="Bpro_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.694 at
FT                   residue 35"
FT   gene            30702..31676
FT                   /locus_tag="Bpro_0030"
FT   CDS_pept        30702..31676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0030"
FT                   /product="putative exonuclease, RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41997"
FT                   /db_xref="GOA:Q12HJ5"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ5"
FT                   /protein_id="ABE41997.1"
FT                   /translation="MFKNVMVYRIGPAWSVSLEQLEANLQAMRFVECGLTQEKSVGWVE
FT                   PRGEANGPLVESVGGQWLLKLMLESKAVPASVINRKAKERVAQIEAATGRKPGKKETRD
FT                   LKEELKLDLLPMAFTRQGSVQVWIDPEARLLMIDAASQAKADEVLTCLAKSMEGLGAML
FT                   LQTTASPVAAMSEWLVSQEPPAGFSVDRECELKAGDESKAVVRYSRHALDIDEVQQHIN
FT                   HGKLPTRLAMTWEGRVSFMLTDTLQIKKLAFVDGVFEDDAAASKADRFDADAAIATGEI
FT                   RRLIPDLLEALGGELVMGADAPAALAPALAPALAAAEAESPPF"
FT   gene            complement(31696..33045)
FT                   /locus_tag="Bpro_0031"
FT   CDS_pept        complement(31696..33045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0031"
FT                   /product="type III effector Hrp-dependent outers domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41998"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ4"
FT                   /protein_id="ABE41998.1"
FT                   /translation="MQASHKDSTLKIAYYGDDFTGATDTLATAARAGLRTLLFLGLPTA
FT                   TQLERAGPLDCLGIAGAARAMTPAEMQLELEPVGRLFAALGAPVMHYKTCSTFDSAPHI
FT                   GSIGAALRILRPHAGNALVPIVGGQPNLHRYCVFGNLFAGTGNGGAIHRLDRHPTMRQH
FT                   PVTPMHEADLRLHLAQQGLENLSAIAYPDYAQLDEALDRQLDALLAQGPDAVLFDIAHP
FT                   DNLAAVGRLIWQHARRQRLLAAGPSSVVQALAAHWQSGAGPARTAIAPAQGPVLVLAGS
FT                   LSPLTARQVKAATSYEHIALDAPRLAGDENYRMQMARQIATRLDQGAHVLACTSGADGA
FT                   TVSTSSSTSSSPTDGRALAQACGDLLAHVLATRPIRRLGIAGGDTSSHAVQALQAWGLS
FT                   YRAPLAPGVALCRLHSEQASLDGLEIMLKGGQMGGETLFEELLAGTPLPV"
FT   gene            complement(33048..34334)
FT                   /locus_tag="Bpro_0032"
FT   CDS_pept        complement(33048..34334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0032"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE41999"
FT                   /db_xref="GOA:Q12HJ3"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ3"
FT                   /protein_id="ABE41999.1"
FT                   /translation="MNADRFEATYLIETPLEPARVAEVMAGEQSCGTFTRVEGETDALR
FT                   LRARATVESIEELASVNAPSLPNALLERQGHTAPHGGPWRRARVRISFPVANVGANLPT
FT                   LAATVSGNLYDLGEASGLRLESMKLPAAYRAQFDRPRVGIAGTRQATGVASGALVGTIL
FT                   KPNVGFSAAQTAELVGRLCAAGVDFIKDDEVCADPAHAPLAKRVPAVMAVVRAHQQRTG
FT                   KHVMVAFNITDETDAMKRHADLVEREGGSCVMASLNWCGHSALQTLRRHTGLALHGHRN
FT                   GYGALSRHPLLGMSFQAYQTLWRLAGVDHMHVHGLQGKFSQPDAEVIESAHDCYTPLAD
FT                   GADGFDDRVMPAFSSGQWAGTVPATWAAVQSDDLLFMSGGGILAHPGGPAAGVASIRQA
FT                   WAAARQGVALAEFAREAPELAAALAFFGK"
FT   gene            complement(34346..34885)
FT                   /locus_tag="Bpro_0033"
FT   CDS_pept        complement(34346..34885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42000"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ2"
FT                   /protein_id="ABE42000.1"
FT                   /translation="MSKFFGEIRQLGYVVHDIEAAMDYWSNTLGVGPWFYNPKVPIKNY
FT                   SYKGESHEPHNSVALANSGFVQVELIQTRNDVPSMYRDFLQAGRTGLQHVAYWTSDYDA
FT                   DLARLLGQGFKPVMSGEVGEKGRFIYFDTEYHPGTVIELSEVAGPKGRMFDLIRASSEG
FT                   WDGREPVRPFPDLSKL"
FT   gene            complement(34935..36818)
FT                   /locus_tag="Bpro_0034"
FT   CDS_pept        complement(34935..36818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0034"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42001"
FT                   /db_xref="GOA:Q12HJ1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ1"
FT                   /protein_id="ABE42001.1"
FT                   /translation="MSHAPSPVAADALPANALSGLAHGVDRGLGAVVETIAAGLVLAEI
FT                   IVLFAGVVSRYVFHQPLVWSDELASIMFLWLSMLGAVVALRRGEHMRMTALVNHVQPHT
FT                   RALLDTVAITASLAFLVLVLFPAGEYAYEETFIVTPALEISNGWRASAIPVGMGLMIIV
FT                   ALLRLLRISSFQQIALALAGTAAVVLAFWLAQPLLAPLGKVNLVIFFVLVVAANVFSGV
FT                   PIAFSFALATFGYLALTTQTPLLVMVGRLDEGMSHLILLAVPLFIFLGALIEMTGMAKA
FT                   MIQFLASLLGHVRGGLSYVLIGAMYLVSGISGSKIADMAAIAPVLFPEMKKRGAKPGDL
FT                   VALLSATGAQTETIPPSIVLITIGSVTGVSIAALFTGGLLPAVVLGAALCAVVWWRYRG
FT                   EDLSGVTRYGKREIGKLLLIALPAIVLPFVIRAAVVEGVATATEVSTIGIVYSVLAGLL
FT                   LYRRFAWRRLMPMLVETASLTGAIIFIVGCATAMAWGLTQSGFSQDLAGIMGSLPGGAY
FT                   GFLAVSIVAFIVLGSVLEGIPAIVLFGPLLFPIAKAAGVHEVHYAMVVIFAMGIGLFAP
FT                   PFGVGYYGACAVSKVDPDDGIPHIWAYFGALLVGLIVVAAIPWFSTGFLKN"
FT   gene            complement(37198..38217)
FT                   /locus_tag="Bpro_0035"
FT   CDS_pept        complement(37198..38217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0035"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42002"
FT                   /db_xref="GOA:Q12HJ0"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HJ0"
FT                   /protein_id="ABE42002.1"
FT                   /translation="MTEVTRRSVLRTLSAVPAAGIAAALPSMARAAEFSYKYGNNLPVT
FT                   HPLNIRAQQAADRILKETNGRVEIKIFPNNQLGGDTDMLAQVRSGGIEFFTPSALVIAT
FT                   LVPVAAINAVGFAFSDYNQVWGAMDGKLGAHVREAISKSRLYAFEKMWDNGFRQTTSSK
FT                   APVTSAKDMDGLKIRVPVSPLSISMFKGLGAAPASLQFSEVYSSLQTKIVDAQENPLPI
FT                   IQVAKLYEVQKFCSMTNHIWDGYWFIANGRAWEKLPADLKTIVARAINEAGLQQRDDIK
FT                   KLNETVAADLQSKGLAINRPASDSFRAKLREAGFYGEWKGRFGDEAWGLLEQSVGKLA"
FT   sig_peptide     complement(38122..38217)
FT                   /locus_tag="Bpro_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 32"
FT   gene            38331..39395
FT                   /locus_tag="Bpro_0036"
FT   CDS_pept        38331..39395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0036"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42003"
FT                   /db_xref="GOA:Q12HI9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI9"
FT                   /protein_id="ABE42003.1"
FT                   /translation="MRVIPDETKDQPQRARVADIARAAKVSTATVDRVLNRRPGVRDAT
FT                   AQKVLKVAAELDYLPETGLYAALAAAPMRLTFLLPDGSNRFIRMLGDTVGYSQEHLTPF
FT                   NVKCRTELFESFNPQQLAASLLKHGQRSDGIAFMALEHPAVREAVSVLADRGVPTITLI
FT                   SDLSGSRRAGYVGLDNRAAGRTAGYLVGRFIAPGARGGKVALIAGSLSYRAHEEREAGF
FT                   LHVIEEMFPTLQVVGLREGQDDAQKNYEQTRTLLEQYPDLAGIYNIGGASDGVARALKE
FT                   MGREHKVVFIGHGLTPDTRAMLIDGSMDAVITQSPQSAMMSCVRMFTNLRDKRDVMSGV
FT                   DAVRSQVIFRENLP"
FT   misc_binding    39480..39591
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="Bpro_R0051; TPP riboswitch (THI element) as
FT                   predicated by Rfam (RF00059), score 83.84"
FT   gene            39663..41579
FT                   /locus_tag="Bpro_0037"
FT   CDS_pept        39663..41579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0037"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42004"
FT                   /db_xref="GOA:Q12HI8"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12HI8"
FT                   /protein_id="ABE42004.1"
FT                   /translation="MAKTRLTVDTNDLASRITRAPFPGSAKIYIEGSRPDIRVPFREVT
FT                   LTDTMVHEGAGEPRREANPPLRLYDASGVYTDPASPIDITRGLPPLRGAWINERADTEA
FT                   LPGISSAYGRERLNDPALAALRMAHAPVPRRAKAGANVSQMHYARKGIITPEMEYIAVR
FT                   ENLVRAQLAERLATERMPKKGHSFNASIPEQITAEFVRDEVARGRAVIPNNINHPESEP
FT                   MIIGRNFLIKVNANIGNSAVTSSIEEEVDKLVWSIRWGADTVMDLSTGENIHETREWIL
FT                   RNSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLAYVPL
FT                   TANRLTGIVSRGGSIMAKWCLSHHKESFLYERFDEICEIMKAYDVCFSLGDGLRPGSIA
FT                   DANDEAQFAELHTLGELTQIAWKHDVQVMIEGPGHVPLQLVKENVDKQLEACFEAPFYT
FT                   LGPLITDISPGYDHISSAMGAANIGWYGTAMLCYVTPKEHLGLPNRDDVKQGLIAYKIA
FT                   AHAGDLAKGYPGAQMWDNAVSKARFEFRWEDQFRLAIDPDTAMAYHDETLPKENAKVAH
FT                   FCSMCGPKFCSMKISQEVREFARLNPASTTLAAPGVIAIKQIDSGFEEKAKEFREGGSE
FT                   IYS"
FT   gene            41740..42801
FT                   /locus_tag="Bpro_0038"
FT   CDS_pept        41740..42801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0038"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42005"
FT                   /db_xref="GOA:Q12HI7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI7"
FT                   /protein_id="ABE42005.1"
FT                   /translation="MSTPHIGIAGAGLAGRTLAWRLLRAGCRVSLFDARLRDDQATASM
FT                   TAAAMLSPLAELAVSDEVVFALGQRSMQLWPRWIAELAATGAPPVYFRQQGTLVVAHAP
FT                   DQASLEHFTRLLHHKLPEACRAQVHTLDSASLAQYEPALAGRFGGGLFLESEGQLANDQ
FT                   LMAALAAQIDALGCHWHEGQRVDRLAPHFISCAGANYTVDVAVDARGVGSQAAWPQLRG
FT                   VRGEVLTVECPGVTLQRPVRLMHPRYQLYVAPRPDHRFVVGATELESEDTGAMTLRSML
FT                   ELGSALHSLHPAFGEARVVRLAAALRPALDDHRPAVALRDGVWHINGLYRHGYLCAPAL
FT                   VEELVHQLLESPA"
FT   gene            complement(42777..43025)
FT                   /locus_tag="Bpro_0039"
FT   CDS_pept        complement(42777..43025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42006"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI6"
FT                   /protein_id="ABE42006.1"
FT                   /translation="MPQLPSSYRCDHVDAVTVLQGAFGPLRPRHKGVVDRTGESALQRV
FT                   ALRQQQRLQRGRLGGHAFAVQRNFKRVHNRHAGLSSS"
FT   gene            43149..43964
FT                   /locus_tag="Bpro_0040"
FT   CDS_pept        43149..43964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0040"
FT                   /product="thiazole-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42007"
FT                   /db_xref="GOA:Q12HI5"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI5"
FT                   /protein_id="ABE42007.1"
FT                   /translation="MTTTPSAIAHGQPWTVAGITLQSRFFLGTSHYPSPQVLSEAVAAS
FT                   GTEVLTVGLRRLQPESGGGNSFWQRIQALGCHMLPNTAGCHSAEEAITLAQMAREIFGT
FT                   PWIKLEVIGDDYTLQPDTQATLHAASVLAREGFAVFAYTTDDLVIAQRLRDAGCAAVMP
FT                   WAAPIGTGRGPLNPYALEMMRRRLPDAVLVVDAGLGRPSHAAQVMELGFDAVLLNTAVA
FT                   QAGDPVRMARAFADGVAAGRAAYESTPMPERAAAQASTSTVGVPFWHAP"
FT   gene            44115..44762
FT                   /locus_tag="Bpro_0041"
FT   CDS_pept        44115..44762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0041"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42008"
FT                   /db_xref="GOA:Q12HI4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI4"
FT                   /protein_id="ABE42008.1"
FT                   /translation="MNTDAFAPLTGPIGFYPVVPDAAWVQRLLGWGVRTIQLRIKAADH
FT                   TPAEIEREVRAAVEAGRAVPGAQVFINDHWQLALAAGAYGVHLGQEDLSMAEADLNALR
FT                   KAGVRLGLSTHTPAELARAHAVQPSYLAIGPVYPTLLKVMPYEPVGLERLKEWALRAVP
FT                   YSVVAIGGISLARLPGVIACGVDGVAVVSAVTQAADPEQATRQALALFDAPA"
FT   gene            44836..45432
FT                   /locus_tag="Bpro_0042"
FT   CDS_pept        44836..45432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0042"
FT                   /product="Hemerythrin HHE cation binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42009"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI3"
FT                   /protein_id="ABE42009.1"
FT                   /translation="MAYATLRIIRDEHAALSAVLKSLLMMLDRGPGDAPETFFDVLRAM
FT                   LFYIDEFPERQHHPKESDLLFPKVVRGAPETMEAVARLEHDHLNGEMAVRALQHQLIAW
FT                   ELLGEARRPAFETAARAYVAFYLEHMKLEETVILPAAEKALNAADWHELDAVFGTNRDP
FT                   LTGSYPHDPAYDRLFTRIVMKTPAPIGLGPSSVNA"
FT   gene            complement(45480..45866)
FT                   /locus_tag="Bpro_0043"
FT   CDS_pept        complement(45480..45866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42010"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI2"
FT                   /protein_id="ABE42010.1"
FT                   /translation="MASIRFIPLAAALLVAGTLTACSSGPGMRMGMGGPGQTTMARMDM
FT                   QMGSMRQVHEKMMAAKTPEERQRLAAEHMKSMHEGMQMMDRARDMPADPEARHQMMEKR
FT                   MEMMQTMMKMMIDQMPAAPSAPAK"
FT   sig_peptide     complement(45801..45866)
FT                   /locus_tag="Bpro_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.495 at
FT                   residue 22"
FT   gene            complement(46179..47336)
FT                   /locus_tag="Bpro_0044"
FT   CDS_pept        complement(46179..47336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0044"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42011"
FT                   /db_xref="GOA:Q12HI1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI1"
FT                   /protein_id="ABE42011.1"
FT                   /translation="MHAELADLLPGLVSLRRDLHAHPELAFTEHRTAGIVARALREMGL
FT                   EVHEGLGGTGVVGVLRQGSSTRSVGLRADMDALPISEQSGVAHTSTRPGIHHGCGHDGH
FT                   TAMLLGAARQLVRTRGFEGTVNFIFQPAEEGHGGARAMINDGLFERFPCDAVYALHNWP
FT                   DLPLGSAQTRPGAIMAAADRFDITVRGRGGHAAQPQHTPDAILAASSLVTQLHTIVSRR
FT                   IDPGQSAVLSVTRIEGGQSHNVLPPSVGLTGTVRSFDAATQDRIEAALRQTAAGVAMAT
FT                   GTEIEVTYNRYYPATMNSAPEAALALQAATDAGLQASVAAHPAFTSEDFSFMLQQRPGA
FT                   YLWLGQGSGDETSVSLHHPRYDFNDAALGLGVRWFCAVAKLALKP"
FT   gene            complement(47348..48058)
FT                   /locus_tag="Bpro_0045"
FT   CDS_pept        complement(47348..48058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0045"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42012"
FT                   /db_xref="GOA:Q12HI0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HI0"
FT                   /protein_id="ABE42012.1"
FT                   /translation="MSLQDFKVLTFDVVGTLIDFERGMLDYLHRAVPDAAVSDDDFLAL
FT                   YRKARADEVTGLFPDDLVRVWHQIAPALGLPDTEALAEGLRDSAAQWPAFADSVEALKR
FT                   LSKHFKLVAMTNAQQWALTHFERTLGLPFDDTVCVDDAQCEKPDPKFFAFARAKLAIHG
FT                   FTQADNLHTAQSQYHDIGIAKSLGLATCWIERRHGQPGFGGTLAVKHITQPDYHYFTLA
FT                   QLADAVEANASTTA"
FT   gene            complement(48118..48513)
FT                   /locus_tag="Bpro_0046"
FT   CDS_pept        complement(48118..48513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0046"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42013"
FT                   /db_xref="GOA:Q12HH9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH9"
FT                   /protein_id="ABE42013.1"
FT                   /translation="MDAKQNPQTFMDAAERRTQRLQPVLAHINAHLGESLPLHQLAALS
FT                   GLSLWRFATVFREHMGVAPRRYIFLERVRYAKALLRAGMAPATVASEAGFCDQSHLSRR
FT                   FKHACRETPGQYQSRHHHFSGHAGMAA"
FT   gene            48710..49069
FT                   /locus_tag="Bpro_0047"
FT   CDS_pept        48710..49069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0047"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42014"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH8"
FT                   /protein_id="ABE42014.1"
FT                   /translation="MAIQILKQSASISTLSPQGPVGRPLTQPACETRGIEVELSGAGDN
FT                   RSGLWECLPGKFERQLAQAEVMHILSGSCSFTPTGGETQEIAAGDTLFFPANTTGVWHI
FT                   RETLRKVYVVMASTA"
FT   gene            complement(49129..50259)
FT                   /locus_tag="Bpro_0048"
FT   CDS_pept        complement(49129..50259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0048"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42015"
FT                   /db_xref="GOA:Q12HH7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH7"
FT                   /protein_id="ABE42015.1"
FT                   /translation="MSQDKRSDVLIIGGGLMGVTTAFFLRHHHGLGVTLLERELIGRQA
FT                   SGTNFGNVRRQGRALEQMPLANRAHAVWGRVKSLLGEDIEFLPLGHLRVCYTHEQAAKL
FT                   EEHARLARPMGLDLELLSADMLRQRYGFFSQEVVAGSLSPLDGHANPRLAGPAFGRAAR
FT                   RAGADILEHQEVVHIEKDGDDFVAHTAAGKTFRAAQLLVASGAWSDKLAAAFDEPVPME
FT                   ARGPQMGVTEPVPYAIGPSIGVSSPVEEEGLYFRQITRGNIVFGGGLKGPASTETIRAG
FT                   VRPDNTLRQFRELRRFVPAMARLQLLRVWSGIEGYVADSRPVMGPSARMPGLHYAFGFN
FT                   GEGFAISLGVGETMAELLATGKTVTPIEAFSIGRFA"
FT   gene            complement(50256..51632)
FT                   /locus_tag="Bpro_0049"
FT   CDS_pept        complement(50256..51632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0049"
FT                   /product="BFD-like (2Fe-2S)-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42016"
FT                   /db_xref="GOA:Q12HH6"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH6"
FT                   /protein_id="ABE42016.1"
FT                   /translation="MNPQVIVVGAGPAGIRAAQALAEAGLRPIVIDEGRRDGGQIYRRQ
FT                   PEGFKRSYATLYGSEAGKAQSLHQDFEALRQKIDYRSDTLSWNLTPGMLHTVSQGRAQS
FT                   LAYDALIICSGATDRLMPVEGWNLAGCYSLGAAQIALKSQACSIGASVVFAGTGPLLYL
FT                   VAAQYVKAGANVQAVLDTSPALPPLAALRGLLARPRLLLRGLGLIASLRRAGVKVWQGI
FT                   TPLRVEGAPDSGVSGITLRDAHGNKQTIPCDAVALGYHLRAETQLADLAGCDFVFDALS
FT                   RQWLPRMDGDGRSSMAGIYLAGDGARLLGADGAEAAGRLAALAALHDLGHGQGRTLFKE
FT                   QAPGLRSTLNTMNNFREGLARAFPWPHQQAATLPDAAVVCRCEAVTAGELRRSVHEMES
FT                   QEINRAKAFSRVGMGRCQGRYCGHAAAEVVAHAARIPIEDVGRLRSQAPVKPLLMDAQP
FT                   "
FT   sig_peptide     complement(51564..51632)
FT                   /locus_tag="Bpro_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.805) with cleavage site probability 0.545 at
FT                   residue 23"
FT   gene            complement(51629..51955)
FT                   /locus_tag="Bpro_0050"
FT   CDS_pept        complement(51629..51955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42017"
FT                   /db_xref="GOA:Q12HH5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH5"
FT                   /protein_id="ABE42017.1"
FT                   /translation="MPSPTSSQARFVRLAETGRPAITLQIDGASASALEGDTLLVALLS
FT                   HGKRVRDSEFGDGTRAGFCLMGACQDCWVWDQTGQRLRACTTPAQAGMVISTRSPEATW
FT                   PQHP"
FT   gene            complement(51994..52488)
FT                   /locus_tag="Bpro_0051"
FT   CDS_pept        complement(51994..52488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0051"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42018"
FT                   /db_xref="GOA:Q12HH4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH4"
FT                   /protein_id="ABE42018.1"
FT                   /translation="MNTDLKLDRLDIRILCQLQKNGRITNVDLADAVGLSPSPCLIRVK
FT                   RLEKAGYIASYGAQLKLDKLAEMLTVFTEVTLADHRREDFVRFELAIREIDEILECHLV
FT                   SGGYDYLLKFTTRGVNHYQSIIEGLLERNIGIEKYFSFIVIKSPFIKPHYPIERLIDPS
FT                   A"
FT   gene            complement(52521..53906)
FT                   /locus_tag="Bpro_0052"
FT   CDS_pept        complement(52521..53906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0052"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42019"
FT                   /db_xref="GOA:Q12HH3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH3"
FT                   /protein_id="ABE42019.1"
FT                   /translation="MPSNTSSLIDLDRAHLIHPVAPWRKHEQRGVTVLESGHGAWLKDA
FT                   AGNELLDAFAGLWCVNVGYGQESVVQAATEQMRKLPYATGYFHFGSEPAIQLAAKLVEI
FT                   APPSLKHVYLTLGGSEAIDAAVRLIVHYYNATGRPGKKQFISLERGYHGSSSTGAGLTA
FT                   LPVFHRGFDLPRPEQHYIASPYLYRSPEGSTAQSVIDASVQSLRAKVASLGADNVAAFF
FT                   CEPIQGSGGVIVPPTGWLKAMRQACTELGILFVVDEVITGFGRTGPMFACQAEGVEPDL
FT                   MTMAKGLTSGYAPMGALMMSGAVYAGIADGAAPGVPIGHGATYSAHPVSAAIALEVIRI
FT                   YQEGGMLAHAQKVAPHFAQGLDALTAHPLVGEARHRGLLGALELVSNKTTKAGFDPALG
FT                   LSDLLFETGYRNGLVFRSFGDNILGFAPALCYTEGEFSQLFERLEKTLDEVLAVPDVRR
FT                   ALG"
FT   gene            complement(54049..54975)
FT                   /locus_tag="Bpro_0053"
FT   CDS_pept        complement(54049..54975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0053"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42020"
FT                   /db_xref="GOA:Q12HH2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH2"
FT                   /protein_id="ABE42020.1"
FT                   /translation="MTFLYKADPERGAVWRQLFAQKAPQREFRIWPDIGDPERVRFLAA
FT                   WEPPKDIEKTFPNLEVLFSIGAGVDQFDLSVLPPELPVVRMVEPGLVHGMVEYACFAVL
FT                   GLHRNIPLYQRQQRAARWQALPVMPAAERRVGVLGLGSLGQAVLAQLRTFGFDCAGWSR
FT                   SQHHVEGVQCFAGQDSLPDFLARTDILICLLPLTPETRGMLNHRIFAGLPQGAALVHVG
FT                   RGQHLVTDDLLGALASGQLSEAVIDVCDPEPPPAGHPFWQHPNIWLTPHIGSMTQPESA
FT                   VDVMLDNLRRYEAGETMTGLVNRTRGY"
FT   gene            complement(55004..55879)
FT                   /locus_tag="Bpro_0054"
FT   CDS_pept        complement(55004..55879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0054"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42021"
FT                   /db_xref="GOA:Q12HH1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH1"
FT                   /protein_id="ABE42021.1"
FT                   /translation="MPSLSQTLKTSDDGVVLQAMTADDLPAAYGLSQEVRWPHRLADWE
FT                   FLLSFGEGLVARNDGEIVGTAICWPWGKHTATVGLVIVAPHCQGRRIGQRLMQGLLDRL
FT                   EGRSVLLYATAEGRGLYERLGFVAAGEVRQHQGKAVQAPLIALEPGLRLRPLSRNDTER
FT                   LIELDTAACGMPRDALMRHLISKADTVVLDRDGEAQGFAMLRRFGRGRAIGPVIAPDAE
FT                   GAKALIAYWVNQCVGKFVRVDVDFASGMTTWLESLGLQRAGGPLAMVRGPALQRDADVR
FT                   LFALAGQALG"
FT   gene            56105..57601
FT                   /locus_tag="Bpro_0055"
FT   CDS_pept        56105..57601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0055"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42022"
FT                   /db_xref="GOA:Q12HH0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HH0"
FT                   /protein_id="ABE42022.1"
FT                   /translation="MQAFDPNQISVPTGHFINGALVGDARAETVAVRRPSDGQVYAQLP
FT                   LADEALVDRAVEASWKAWRSGDWARRAPRERARVLRRWADLVEADAPTLGLIEAVGSTR
FT                   PVRDVMAWDIPFTAEGLRFFAEYADKIGGEVAATQHSQLGMTIAEPYGVVGAITPWNFP
FT                   LVMVSWKVGAALAAGNAVVLKPSELTPFSSLRLAELAVQAGVPADIFNVVQGYGHVAGD
FT                   ALSRHQRIAKMTFTGSTRTGSSIMATCAQYGPKPVTLELGGKSPQLVFDDAPDIDKLAA
FT                   LIAGAITGNAGQVCVAGSRLIVQRGIAEALTERVSARFAAHRPGPTWDTDATLPPIISA
FT                   AQGQRIGGIVGRAKEAGAVVRCGAGFADIAQARQGGSYYLPTLLEGVDSSNPAVREEIF
FT                   GPVLTVQTFDEEEEGLALAEHECYGLAAGVHTADISRALRAVRKLEAGTVWVNRYGRSN
FT                   DFVIPTGGYHQSGIGKDLGRQAVEANLRFKSVLVDFAAPV"
FT   gene            57853..58518
FT                   /locus_tag="Bpro_0056"
FT   CDS_pept        57853..58518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0056"
FT                   /product="haloacid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42023"
FT                   /db_xref="GOA:Q12HG9"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG9"
FT                   /protein_id="ABE42023.1"
FT                   /translation="MTFRPKFITFDCYGTLTRFRMGDMAREMFADRIPAAQMELFVADF
FT                   SAYRFDEVLGAWKPYADVLRNALNRTCKKWNIKCTDAEGRAYYDAVPTWGPHADVPAGL
FT                   SRIADKIPLVILSNASNDQIHKNVDKLGAPFHRVFTAQQAQAYKPRLQAFEYMLDQLGC
FT                   GPEDILHVSSSLRYDLMSADDLGIKNKVFVNRGHGPGNPAYNYVEIQDIGGLPGVVGL"
FT   gene            58536..59825
FT                   /locus_tag="Bpro_0057"
FT   CDS_pept        58536..59825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0057"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42024"
FT                   /db_xref="GOA:Q12HG8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG8"
FT                   /protein_id="ABE42024.1"
FT                   /translation="MKLHSYWTDSAPLFAPAQEALPARADVVIVGGGFTGLSAALALAR
FT                   RGAKVVVLEAGAVAGEASGRNGGHVNNGLAVDYALLAERVGSEKAGDWYRAYDAAVNTV
FT                   AQVVRDENIDCYFERNGKLKLASRPAHYDTLARGLDRLRREVDADVELLNASQVRQEVD
FT                   SDKFYGGLLQKRSGQMHMGRFAVGLAQAAIKHGAQIHARTPAMKLERITSTGHAHRVHT
FT                   ARGVIEAAQVLVATGATLHGNYGSFGFWRRRIVPIGSFIITTESLGRERALKVLSGRRT
FT                   YTTTANIHNYFRLTHDDRLVFGGRARFAMSSPQSDAKSGLILQQALAQMFPQLGDARID
FT                   YCWGGLVDMTQDRLPHAGQHNGLYYSMGYSGHGTQMSVHMGQCMARVMGGEVSANPWRD
FT                   LRWPAIPGHFGPPWFLPAIGLYYRIKDKLL"
FT   gene            59868..61487
FT                   /locus_tag="Bpro_0058"
FT   CDS_pept        59868..61487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0058"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42025"
FT                   /db_xref="GOA:Q12HG7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG7"
FT                   /protein_id="ABE42025.1"
FT                   /translation="MNESKKLQALIGPQESMRVMNAMQAGAKRRDVLAMLMAGGMQATL
FT                   AGSLAGIAGAAHAQTPRRGGRIRVAGATAAINDTLDPAKQSNQSDYIRGSMFYNGLTVL
FT                   DGSLTPRPALAEEFTTRDATTWVFKLRKGVVFHDGKPLVPADVVFSLMRHKDPATASKA
FT                   KALADQIDDVKASGPNEVTIKLKAPNADLPVILGTFHFHIVKDGTTDFNAGIGTGPYKV
FT                   KEFKPGVRSIAVRNEAYWKPGRPYLDEIEYVGIGDEGARVNALLSGDLDLVGSVNPRSV
FT                   QRVRDSAGHAIFETQSGGYTDLVMRRDGGPGSNPDFVMAMKYMFDREQMKRSIALGHAV
FT                   VANDQPIDPTNRFYFAGLPQRAFDLDKAKFHLQKANLGSAPIPVVASPAALYSVEMALV
FT                   MQQTAQKLGLNLDVKRMPADGYWSNHWMKSPVGFGNVNPRPSADTLFTQFFKSDAAWNE
FT                   SGWKSEKFDQLLVAARAETDDTKRRKMYADMQVLVHEQGGIGIPLFLASIDGHSKKLKG
FT                   LSPIPVGGLMGYAFAEHVWLEA"
FT   sig_peptide     59868..60044
FT                   /locus_tag="Bpro_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.634) with cleavage site probability 0.627 at
FT                   residue 59"
FT   gene            61678..62634
FT                   /locus_tag="Bpro_0059"
FT   CDS_pept        61678..62634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0059"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42026"
FT                   /db_xref="GOA:Q12HG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG6"
FT                   /protein_id="ABE42026.1"
FT                   /translation="MNLQLLRLIAGRLAVGVVSLLIVSAVVFAITGLLPGDAAQEQLGQ
FT                   EATPEALAALRQQMGLTQSGPERYWQWLNGLLRGNPGQSIVSSAPVADLIGSRLPNSLM
FT                   LAGVTALVSVPLALLLGILSAVWRGSWFDRAASMGAVAVVSVPEFLVATLAVLVFAVHL
FT                   RWLPALSYSVDISSPGQMLRSFAMPVMSLSCVIIAQMMRMTRAAVIDQLRAPYIEMVKL
FT                   KGASPARMVLAHALPNAIGPIANAVALSLSYLLGGVIIIETIFNYPGIAKLMVDGVSQR
FT                   DMPLVQACAMIFCAAYLILVTLADLCGIVANPRLRHQ"
FT   sig_peptide     61678..61767
FT                   /locus_tag="Bpro_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.786 at
FT                   residue 30"
FT   gene            62631..63506
FT                   /locus_tag="Bpro_0060"
FT   CDS_pept        62631..63506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0060"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42027"
FT                   /db_xref="GOA:Q12HG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG5"
FT                   /protein_id="ABE42027.1"
FT                   /translation="MSSAIETIPPAAVPARLVPRLSRWSRTGLLGLAVLVFWLFIAAAG
FT                   PWILPHGSGDMSTAGVFDAISRTHWLGTDYLGRDILSRVMDGARYTVGVALAATVMACA
FT                   AGTLLGLLAAVNGGWFDAVLSRLLDTLVSIPSKMLALIIVAAFGSSIPLLIVTVAVVYT
FT                   PGAYRIARALAVNINAMDYVTVARARGEGRTYIMLREVLPNIAGPLLADMGLRFVYAVL
FT                   LLASLSFLGLGVQPPVADWGSLVRENIGALPTGGAAVIAPALAIATLTIAVNLVIDNLP
FT                   GRAQANQESR"
FT   gene            63506..65332
FT                   /locus_tag="Bpro_0061"
FT   CDS_pept        63506..65332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0061"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42028"
FT                   /db_xref="GOA:Q12HG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG4"
FT                   /protein_id="ABE42028.1"
FT                   /translation="MGARVEVSHLNIVAQAGGKDLPIVTDVSFRIEPGEVLALIGESGS
FT                   GKTTIALSLMGYARQGCRISGGTIRVGDVDVLGLSAGEQRSLRGRTVSYIAQSAAASFN
FT                   PSRTIMDQVVEVASIHGLMPREQAEAKAVALFRDLALPNPQTIGQRYPHQVSGGQLQRL
FT                   MAAMALICDPALVILDEPTTALDVTTQIEVLQAFRRVVRERNTTAVYVTHDLAVVAQMA
FT                   DRILVLRQGRQQEQAETRQIIESPQDDYTKSLIAAAKPAPRDAGRLAPDAAATPLLEVR
FT                   SLIAGYGALDKRGLPSSPVLSDVSFTLHRGQALGVIGESGSGKTTLARAIAGLVAPARG
FT                   QILFDGQALAPDVPGRSRDQLRRVQIVFQMADTALNPAHTIEMLLARPLQLYFGLKGEP
FT                   LKKRIAQLLDLVQLPAQCAQRLPGGLSGGQKQRVNFARALAAEPDLILCDEVTSALDTV
FT                   VGAAVLDLLAQLRRELGLSYVFISHDLNTVRAVCDDIVVLYAGNKVESVPRAAFSQAAR
FT                   HPYFELLASSVPELRQGWLDQRSSTSRLALPPMAVGTPPNPELCSFLDRCPLRVSGACD
FT                   TTAPPRRRLRGDVEILCHRSEADLIALQPASV"
FT   gene            65371..66849
FT                   /locus_tag="Bpro_0062"
FT   CDS_pept        65371..66849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0062"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42029"
FT                   /db_xref="GOA:Q12HG3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG3"
FT                   /protein_id="ABE42029.1"
FT                   /translation="MPLTLSQTDLLRQQNFINHQWQDAQSGARLPVSDPATGLDFAHVP
FT                   DSGAADALAAVDAAHAVFPAWRARSARERAQFLKRWHALILANQHDLGRLISREQGKPL
FT                   AEGVGEVAYAASYVEWFAEEATRTYGDMIPEPARGRKLMVVKEPVGVVAAITPWNFPAA
FT                   MIARKIAPALAAGCTVVAKPAEDTPLTSLALVLLAQQAGLPPGVLNMVTASREKTPEVV
FT                   DVWLADARVRKITFTGSTPVGKHLARESAGTLKKLSLELGGNAPFIVFDDADIDAAVNG
FT                   LMVAKFRNGGQTCVCPNRVFVQDAVHDAFVEKLRARVGALKVGPASAPDSQIGPMINAR
FT                   AVEKIERHVADAVAKGARIAVGGQRMEGAAYASPNYYAPTVLTGAHSGMACSLEETFGP
FT                   VVPVTRFGSEAEVIAAANDTPFGLAAYFYSSNIARVWRMADALESGIVGINEGALAAEV
FT                   APFGGVKESGYGREGSRYGLEDYMHTKYLCQGLV"
FT   gene            complement(66905..68005)
FT                   /locus_tag="Bpro_0063"
FT   CDS_pept        complement(66905..68005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0063"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42030"
FT                   /db_xref="GOA:Q12HG2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG2"
FT                   /protein_id="ABE42030.1"
FT                   /translation="MPSLFDPTQAGDIHLANRIVLAPLTRNRAPDAIPTSLMAEYYAQR
FT                   ASGGLLVTEATAISHQGQGYADVPGLYGTAQLDGWKEVTRAVHEAGGKIVVQLWHVGRV
FT                   SHTELQPDGGQPVAPSAITARTKTVLLKDGAPTFVATSEPRALRADELPGIVHAYEAAA
FT                   RNAVETAGFDGVEVHGANGYLLDQFLKRGSNQRTDDYGGSIENRARLLLEVTRAVTGAI
FT                   GGGRTGIRLSPVTPANDVHDADPQPLFDYVVRQLATLNLAYIHIIEGATGGPREIADRP
FT                   FDYAALKTAYREAGGKGAWMVNNGYDQALAKQAVANGADLIAFGKPYIANPDLVERLRR
FT                   NAPLNLPDQATFYGGGAKGYTDYPTL"
FT   gene            68339..68812
FT                   /locus_tag="Bpro_0064"
FT   CDS_pept        68339..68812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0064"
FT                   /product="cytochrome c family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42031"
FT                   /db_xref="GOA:Q12HG1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG1"
FT                   /protein_id="ABE42031.1"
FT                   /translation="MLKKLAATLIFLLGAGAVAAQEVTYRTDIAPLWKSRCVACHGAQS
FT                   PERADFLLDEKGYAEKSQGPRMDSYERLIAFISWPDTGAFMRRLDDGSSQYAGGKSGNM
FT                   YQYLGSTDAERAANLKLLKGWVGDGAWNLNRWNKRGDVPMVSKEQLDKIQLKY"
FT   sig_peptide     68339..68401
FT                   /locus_tag="Bpro_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 21"
FT   gene            69250..70635
FT                   /locus_tag="Bpro_0065"
FT   CDS_pept        69250..70635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42032"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HG0"
FT                   /protein_id="ABE42032.1"
FT                   /translation="MAKVFKWAVYVSLGLAVLLAAVAFTLHRWVSTDDFRQRVEHEASA
FT                   ALGMPVTLAGVAVDVWPLPAVALTGIVVQSKPPLTLERVEVRPQWQPLLQGRLAISTLL
FT                   VRRAVLPQQGIDAVLLALQKKKQPASAKQGPKPKTPDPAPESAGLEGLPRRTVLDEVTW
FT                   ISAAGARTTVAAEAALADDGLPDSVSFKLLKGNLQGLRATLQREEPKPADNASKAGDAV
FT                   VGEDRWALRVEVGGGKIEGRLALRRAPAGAPVKPGEALALQGQLQTRGVEVSALTAPAG
FT                   ALSGQLEATTSLNARAATTGGLVDALQSHTTFTVRNAVINGLDLAKAVQTVGLSRGGQT
FT                   RLDTLAGQVNTQGRAAQLSNLVASSGVLSATGNVAISPAKALSGRVIVNVAGDSKVGQA
FT                   IGGAVGVPLTVGGTLDKPEVTLSRSALLGAAIGTALLPGVGTGAGANLGDRVGEGFRSL
FT                   FGK"
FT   sig_peptide     69250..69321
FT                   /locus_tag="Bpro_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.764 at
FT                   residue 24"
FT   gene            70905..71090
FT                   /locus_tag="Bpro_0066"
FT   CDS_pept        70905..71090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0066"
FT                   /product="protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42033"
FT                   /db_xref="GOA:Q12HF9"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12HF9"
FT                   /protein_id="ABE42033.1"
FT                   /translation="MLKYAIIFAVISLIAGALGFGGVAAGAAGIAKILFGLFLILAVIF
FT                   VVLAALGVGAVRKGMK"
FT   sig_peptide     70905..70988
FT                   /locus_tag="Bpro_0066"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.450 at
FT                   residue 28"
FT   gene            71091..71492
FT                   /locus_tag="Bpro_0067"
FT   CDS_pept        71091..71492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42034"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF8"
FT                   /protein_id="ABE42034.1"
FT                   /translation="MASLPPITPLPSEPSAPSSSSLTPAPCAPASTLMSRVRQRLFPPR
FT                   PPGSSAAPRLDIAHRAANLPAPVSVRAGFQAGIAEFLLVIRLRARRRAEPSADVLERAA
FT                   RIVFVTCKNWFAAADSGHGHGAGHHRTRI"
FT   gene            71565..72410
FT                   /locus_tag="Bpro_0068"
FT   CDS_pept        71565..72410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0068"
FT                   /product="transglutaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42035"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF7"
FT                   /protein_id="ABE42035.1"
FT                   /translation="MHTTLIDLLLEYEVGSPSHFLFNIEAAFHEGHHVLQERLTITPSM
FT                   KVRNFCDERSGNRFIRLDAPKGMLSVNYHARVRLIAVPVPLHLDETPVSGVPDDVLRYL
FT                   MPSRYCESDSMSRAAQQLFGDLPPGIGRVRAVENWIHDSIAYLPGCTSSTTTARDVFVQ
FT                   RAGVCRDFAHLGITLCRALNIPARLVVGYVHFDEPPQDFHAVFEAWLEGRWVLFDPSHL
FT                   APIDRLVRVGTGRDAKDVAFATIFGNVQMLRKELIVDEGELLPDTPPGSHPPMLSLVST
FT                   "
FT   gene            complement(72477..73247)
FT                   /locus_tag="Bpro_0069"
FT   CDS_pept        complement(72477..73247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0069"
FT                   /product="class II aldolase/adducin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42036"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF6"
FT                   /protein_id="ABE42036.1"
FT                   /translation="MNIPSLKKTVSAEEWQLRCDLAACYRLVALYGWSDLVFTHISAKL
FT                   PEEVAGPGAHHFLINPYGLMFDEITASSLVKVDGQCNKVIDSPFPVNPAGFVIHSAVHD
FT                   ARPDAGCVLHTHTRAGVAVSAQKCGVLPISQQSTFVLASLAYHDYEGVAFRGEERPRLQ
FT                   ADLGSANFLMLRNHGLLVVGKTIADAFLNMYIFENTCRIQLDAQAGGELILVNPQIIQG
FT                   VSEALRVQTGGMGGAFAWPSLIRRLERLDDSYRT"
FT   gene            complement(73407..74297)
FT                   /locus_tag="Bpro_0070"
FT   CDS_pept        complement(73407..74297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0070"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42037"
FT                   /db_xref="GOA:Q12HF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF5"
FT                   /protein_id="ABE42037.1"
FT                   /translation="MRELNLDQLRTLVSIADLGTFSAAARALHLAQPTVSLHISELEAR
FT                   LGAQLVVRGGRSVVPTAAGAVLVERARRLLRDADDATDAVKRHVEGRLGRVRLGTSTGI
FT                   VVHLLPRVLELMARAHPEIDVEVSILGSAETMERLGQGTLDVGLVATPQPARRELVMSH
FT                   WRSDPMMAFIPTGWPAPKRITPPWLMDKPLIFNDSTTHMYRLTMEWFAKAGHTPRARIE
FT                   LNYTEAMKSLVVAGYGAALLPLEQAGAAATPNGVQVLPLKPALTRHTAVVHRPLAALDG
FT                   ATRNLLQTLAQFRQT"
FT   gene            complement(74624..74881)
FT                   /locus_tag="Bpro_0071"
FT   CDS_pept        complement(74624..74881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0071"
FT                   /product="protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42038"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF4"
FT                   /protein_id="ABE42038.1"
FT                   /translation="MNCRSGCGACCIAPSISSPIPGMPEGKPAGVRCVQLDDANACRIF
FT                   GQPGRPAVCGQLAPSAEMCGSNRTQALLYLARLETLTAPQ"
FT   gene            complement(74984..75562)
FT                   /locus_tag="Bpro_0072"
FT   CDS_pept        complement(74984..75562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0072"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42039"
FT                   /db_xref="GOA:Q12HF3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF3"
FT                   /protein_id="ABE42039.1"
FT                   /translation="MKLLIFAGSTRQNSFNRKLAHATAAMARASGAEVTHLELADLDVP
FT                   MYNADLEAKGTPPDVMKLKQIMYEHPAWIICSPEYNGSYTALLKNTIDWASRPVPSDPA
FT                   WTDGNKPFTGKVVGVLSASPGALGGLRSQSHLVPLLLNLHCWVAPKAFALSRAGEAFDA
FT                   DGQLPGEAHRKNVQAVIDQVLFAGSRLAR"
FT   gene            75959..77980
FT                   /locus_tag="Bpro_0073"
FT   CDS_pept        75959..77980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0073"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42040"
FT                   /db_xref="GOA:Q12HF2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12HF2"
FT                   /protein_id="ABE42040.1"
FT                   /translation="MQSPYIYPQEFDVIVVGGGHAGTEAALASARMGCKTLLLSHNIET
FT                   LGQMSCNPSIGGIGKGHLVKEVDAMGGAMALATDEGGIQFRILNSSKGPAVRATRAQAD
FT                   RILYKAAIRRRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGIRFRSRTVVLTAGTFL
FT                   DGKIHVGLNNYAAGRAGDPPAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKCIEQ
FT                   PGDGMPGGTAGPVPVFSFMGGAIPHPQQMPCWITHTNERTHEIIRSGFDRSPMFTGKID
FT                   GVGPRYCPSVEDKINRFADKESHQIFLEPEGLTTHEIYPNGISTSLPFDIQYELVRSMA
FT                   GMENAHILRPGYAIEYDYFDPRALKTTFETRAIGGLFFAGQINGTTGYEEAAAQGMFAG
FT                   INAALQCRALGGLPNDHGGAWLPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEYRLML
FT                   REDNADMRLTEKGRELGLVDDARWDAFSRKRDAVSRETERLRSLWVNPHNLPLAEAERV
FT                   LGKSIEREYNLLDLLRRPDVNYAGLMSLEEGKYANPELAAEAAASDDLAKSVIEQIEIT
FT                   AKYAGYIDLQKTEVERAAHYENLKLPTDLDYLQVSALSFEARQTLARHRPETLGMASRI
FT                   SGITPATVSLLLVHLKKNLWKNTVPLKTTDTSTEKAQA"
FT   gene            77980..78660
FT                   /locus_tag="Bpro_0074"
FT   CDS_pept        77980..78660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0074"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42041"
FT                   /db_xref="GOA:Q12HF1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12HF1"
FT                   /protein_id="ABE42041.1"
FT                   /translation="MRGGEQDLRAGLKALQLELTDSQVGQLLDYQDLIGKWTKVYNLTA
FT                   VRDPVEMMTHHLLDSLAAVPPLRRHLRKTGQEQGACLLDVGSGAGLPGVVIAICCPEVA
FT                   VTCVDTVAKKAAFIKQAALALKLPNLSGLHARVETITTLFDVICSRAFASLADFTQWSG
FT                   DALASHGVWMAMKGKQPAEELASLPPTVEVFHVEQLQVPGLDAERCIVWMRCKSAAAGL
FT                   DQQG"
FT   gene            78774..79400
FT                   /locus_tag="Bpro_0075"
FT   CDS_pept        78774..79400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0075"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42042"
FT                   /db_xref="GOA:Q12HF0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HF0"
FT                   /protein_id="ABE42042.1"
FT                   /translation="MLGSFVGVADYGAFVVAIIVFLLIPGPGNLALITSTGKGGIPGGL
FT                   GATLGVIAGDQVLLWAAVAGVAAVMAAYPTAFHAVQWMGAIYLTWLGIKMLIAKPGDAP
FT                   LLQIKPRHYFRQAVLITLLNPKAIVFYMAFFPLFVDPAQHQGLKTFGVMAATIAVLTFL
FT                   YGLTSVMLTYHLAERIRANPQISAVLNKLAGVFLIGFGLKLAVSK"
FT   gene            79516..80286
FT                   /locus_tag="Bpro_0076"
FT   CDS_pept        79516..80286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0076"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42043"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE9"
FT                   /protein_id="ABE42043.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAAGLAKVGQRVLMIDLDPQGNA
FT                   TMGSGVDKRKLELTVYDVLLESASVMEARVHSEKCGYDVLGANRELAGAEVELVEVERR
FT                   ERRLKLALNAVDKDYDFVLIDCPPSLSMLTLNGLCCAHGVIVPMQCEYFALEGLTDLVN
FT                   TIKQVHANLNKDLQIIGLLRVMFDPRITLQQQVSEQLKEHFAEKVFNTVIPRNVRLAEA
FT                   PSYGLPGVVFDPSSRGAQAFVTFAEEMVARIKGM"
FT   gene            80382..80921
FT                   /locus_tag="Bpro_0077"
FT   CDS_pept        80382..80921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0077"
FT                   /product="protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42044"
FT                   /db_xref="GOA:Q12HE8"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE8"
FT                   /protein_id="ABE42044.1"
FT                   /translation="MNPRNVLILPGWQNSGPEHWQSRWERAHGFTRVEQHDWERPLRGD
FT                   WIARLEDVLLSCDEPAVLVAHSLGCIHVAAWAAHSRNTHRVKAALLVAPPDVEQDGVRE
FT                   MLPSWSPIPLQTLPFKTMLFASSDDPFCAPERARRFAAAWGAELMDAGARGHLNAESGL
FT                   ADWPQAYAELQHLTRL"
FT   gene            81003..81938
FT                   /locus_tag="Bpro_0078"
FT   CDS_pept        81003..81938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0078"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42045"
FT                   /db_xref="GOA:Q12HE7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE7"
FT                   /protein_id="ABE42045.1"
FT                   /translation="MVTKKPKGLGRGLEALLGPKVSESGDVDNANSSATSPGLPATLRL
FT                   ADMVPGQYQPRTRMDEGALYELAESIKAQGIMQPILVRRLNSGAHDGKYEIIAGERRFR
FT                   AAKIAGLDSVPVLVRDVPDESAAAMALIENIQREDLNPLEEAQGLQRLVKEFGLTHELA
FT                   AQAVGRSRSAASNLLRLLNLADPVQTMLMAGDLDMGHARALLALDRATQITAANQISAK
FT                   KMSVRETENLVKKLSAEFSLRPQKAAKEKSRDTRRVEEELADLLMAEVEVRVKKQVKRN
FT                   GRHEEMGEVAIQFASMDELNGLIERLRGDK"
FT   gene            82151..82816
FT                   /locus_tag="Bpro_0079"
FT   CDS_pept        82151..82816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0079"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42046"
FT                   /db_xref="GOA:Q12HE6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE6"
FT                   /protein_id="ABE42046.1"
FT                   /translation="MTLPMTPTITAFERSPDRGRGLARDMRVRWALEEVGQPYEVRLVS
FT                   FGAMKEPAHRALHPFGQIPTYEDGDLALFESGAIVFHIAERHAGLLPDDANARARAITW
FT                   MFAALNTVEPPILDRGIATLLEHNKPWYGERLPILEDRVRVRLGELSSRLGRANWLDDA
FT                   FSAGDLLMVTVLRRLNGSGLLEKYPNLSAYVARGEARPAYKRAFDAQLAVFTGKPPTG"
FT   gene            83292..84251
FT                   /locus_tag="Bpro_0080"
FT   CDS_pept        83292..84251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0080"
FT                   /product="Indigoidine synthase A like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42047"
FT                   /db_xref="GOA:Q12HE5"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE5"
FT                   /protein_id="ABE42047.1"
FT                   /translation="MVTNLAHSWLIRSAPVVAAQAAGRPLVALESTIIAHGMPYPENVR
FT                   TAREVEAVIRDLGAEPATIALIGGRIRIGLSDDELELLGRSGQALKVSRRDLPAVLAGG
FT                   GLGATTVAGTMICAALAGIEVFVTGGIGGVHRGAQETFDISADLQELARTSVAVVCAGA
FT                   KSILDIALTLEYLETHGVPVLSCEQDNFAAFYTRDSGFRADFRLDDAAAQARFIRTKWD
FT                   LGLAGGVVLSTPVPQAAAMAREEIDALTEQALAEAKAQGVTGKAVTPFLLARIKALTGG
FT                   RSLATNIALVKHNAAVGARLALALARAERGAGHGAGAA"
FT   gene            84470..85696
FT                   /locus_tag="Bpro_0081"
FT   CDS_pept        84470..85696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0081"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42048"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE4"
FT                   /protein_id="ABE42048.1"
FT                   /translation="MVMDSLITASARALAAGDALGALKRVALRDDPPALALRGIAMAQL
FT                   GEHPRARELLRRAARGFGAHEELARARCVVAEAEVAMAMRDFAGSPRALAAAAATLQAH
FT                   ADSANALQAWLITARRLLLLGRLDEAAAALAHLDARGLPPSLRAVAELTAAELALRSLR
FT                   VGEARMALARAHAAAERAQVPALMAEVTEARAALDRPAARRLAASGEQALRLDEVSALL
FT                   ASDALVVDACRRGLGAGDQWRPLARRPVLFSLARSLAEAWPGDVSREALIESAFRTKRP
FT                   DETHRARLRVEIGRLRALVKPLAAIEATERGFILKPLAGRDVAVLAPPIDGEQASLVAL
FT                   LSDGAAWSTSALALALGASQRTVQRALADLEADGRVRSIGRARAQRWLAPPLAGFTTIL
FT                   LLPAALPIG"
FT   gene            85761..86429
FT                   /locus_tag="Bpro_0082"
FT   CDS_pept        85761..86429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42049"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE3"
FT                   /protein_id="ABE42049.1"
FT                   /translation="MTRKTLNDKPEVKARPAEIVREYGFPGVNDVAGVTHDGQRVWAAT
FT                   GAKLIAFDPASGEQTRTLECAGDAGTAFDGTHLYQIAETRIDKIDPATGKVVATIPAPG
FT                   SGSDSGLTWAEGSLWVGQYRDRKIHQVDPKTGAIQRTIESNRFVTGVTWVDGELWHGTW
FT                   EGDDSEIRRIDPQSGAVLERLEMPHGVGVSGLESDGADLFYCGGGKSGKVRAVRRPKAA
FT                   "
FT   gene            86568..87365
FT                   /locus_tag="Bpro_0083"
FT   CDS_pept        86568..87365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0083"
FT                   /product="protein of unknown function DUF899,
FT                   thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42050"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE2"
FT                   /protein_id="ABE42050.1"
FT                   /translation="MSTATAEANKVKTVNHPVASRERWLAERKTLLAQEKELTRLRDQI
FT                   ASQRRGLPWVRIEKNYVFDAPEGRRALADLFEGRRQLMVQHFMFGPGWEQGCPSCSFMA
FT                   DHTAGMQIHLEHRDVTFVAVSRATLAEIERFRRRMGWQFKWVSSNSSDFNYDFHVSFKP
FT                   EERVNGTVNYNYGMVEFPAEEAPGISLFYKDDAGEVFHTYSTYGRGVEVMMGTYNMLDL
FT                   TPKGRDEHDGFYKMDWVRHHDRYETASAFTPAPEVASCCSAKA"
FT   gene            87391..87978
FT                   /locus_tag="Bpro_0084"
FT   CDS_pept        87391..87978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42051"
FT                   /db_xref="GOA:Q12HE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE1"
FT                   /protein_id="ABE42051.1"
FT                   /translation="MSSLWPWFVVAGVGALHGLNPATGWMLAAAWGLRSRDRAQALRAL
FT                   VPIAAGHAASVALVAGAVVFGLAMDRFALQVLAGGLLAAFAVVHLSGRTPKVARAPAGH
FT                   AGLALWSFMMSTAHGAGLMLVPALVPLCAGDASAREITASGSLTLALAAVGLHTAAMLA
FT                   VTGVVATGVCRGFDAGARLLRDLKREPPEAPR"
FT   gene            88293..88634
FT                   /locus_tag="Bpro_0085"
FT   CDS_pept        88293..88634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0085"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42052"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HE0"
FT                   /protein_id="ABE42052.1"
FT                   /translation="MPTIPACPQCALENTYPDGDNYVCADCGHEWPMLETADADDSADA
FT                   VVKDANGNVLADGDAVVLIKDLKVKGSSITLKMGTKVKSIRLVGGDHEVDCKMDAGSFM
FT                   LKACYLRKA"
FT   gene            88826..90343
FT                   /locus_tag="Bpro_0086"
FT   CDS_pept        88826..90343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0086"
FT                   /product="2,5-dioxopentanoate dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42053"
FT                   /db_xref="GOA:Q12HD9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD9"
FT                   /protein_id="ABE42053.1"
FT                   /translation="MSTLRRIAGQCPSPDTSQIPSCQDPNLMTYPNTQLFIAGEWQEAA
FT                   DGRSLAVFNPATGKEIGRVAHAAKVDLDRALAAAQQGFETWRKVPAFERSKIMRRAAGL
FT                   MRERAGEIAAVLTQEQGKPLAEAKVEAMAAADIIEWFAEEGFRVYGRVVPSRNLATRQL
FT                   VLKDPVGPVAAFTPWNFPINQAVRKLSAALATGCSIIVKAPEETPAGPAALIQAFADAG
FT                   IPAGVIGLVYGNPAEISGYLIPHPVIRKITFTGSTPVGKQLAALAGQHMKRVTMELGGH
FT                   APVIVAEDADVELAVKAAGGAKFRNAGQVCISPTRFLVHESIRNDFAAALVKHAQGLKV
FT                   GDGLGEGIQMGPLANPRRLTAMAEFTQDAVQRGAKVAAGGERIGDLGNFWAPTVLTDVP
FT                   LDAKVFNDEPFGPMAAIRSFNTLDEAIAEANRLPFGLAGYAFTRSLKNAHALSQHVEVG
FT                   MLWINQPAAPWPEMPFGGVKDSGYGSEGGPEALEAYLNTRAVSIMNV"
FT   gene            90837..91667
FT                   /locus_tag="Bpro_0087"
FT   CDS_pept        90837..91667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42054"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR031663"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037161"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD8"
FT                   /protein_id="ABE42054.1"
FT                   /translation="MKTTIALFGAGGKMGVRLARNLQGSDYRVRHVEVGAVGRQRLKDE
FT                   LGVDCVSVDAALDGAGVVILAVPDTLIGKVAAEISPKLQPGTMVITLDAAAPFAGHLPD
FT                   RPDLVYFVAHPCHPPIFNDESTSEARRDFFGGAHAKQSIVSALMQGTDADFELGEAVAK
FT                   VIYQPILRSYRLTVEQMALLEPGLSETVCATLLDVMREAMDEVVARGVPKDAARDFLLG
FT                   HMTILGAVIFKEIPGQFSDACNKAIAFGKPRLMRDDWKKVFDHDEIADSIRRIT"
FT   gene            91762..92757
FT                   /locus_tag="Bpro_0088"
FT   CDS_pept        91762..92757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0088"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42055"
FT                   /db_xref="GOA:Q12HD7"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:4PDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD7"
FT                   /protein_id="ABE42055.1"
FT                   /translation="MTPRSRSSRSSRAVLAASALLMALAGTASAQTILKIGYTPPKDSH
FT                   YGVGATTFCDEVEKGTQERYKCQHFPSSALGGEREMIESVQLGTQDLVNTSTGPLGNFV
FT                   PETRIVDIPFLFRDYEHARKVMDGAIGQDLLKKMQAKGLIGLAWTENGFRHMTNSKRPI
FT                   LQASDAAGLKVRTMENKVHMDGYKTFGLLPTPMAFPELFTALQQGTVDGQENPIPVILS
FT                   SKFSQVQKHLSLTGHVYSPAVLILSSRVWDKLSEADKKVFVAAAQKATVAQRKRVNDDE
FT                   ANGITQLKKDGMQVVEKVDGESFRKAVAPAYAGFAKEFGAERIAAIQAVK"
FT   sig_peptide     91762..91854
FT                   /locus_tag="Bpro_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT   gene            92760..93326
FT                   /locus_tag="Bpro_0089"
FT   CDS_pept        92760..93326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0089"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42056"
FT                   /db_xref="GOA:Q12HD6"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD6"
FT                   /protein_id="ABE42056.1"
FT                   /translation="MTPPSAPGLAMPLASQGRAAGITAALRAGVLALDRRTTELALHVG
FT                   CLLLAVICGLGMWQVVTRFVLSQPSTWTEEAMRRLLIWCVMLGVVVAFRRGALVSVDLM
FT                   LRVSRGWWRHTVRSLITLASLAFLATLLWFGIELTWRVRFQTFASMELSMAWAYAALPV
FT                   GAALSVLAVLAQHIDPMNEELENAQ"
FT   sig_peptide     92760..92819
FT                   /locus_tag="Bpro_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.744 at
FT                   residue 20"
FT   gene            93350..94690
FT                   /locus_tag="Bpro_0090"
FT   CDS_pept        93350..94690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0090"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42057"
FT                   /db_xref="GOA:Q12HD5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD5"
FT                   /protein_id="ABE42057.1"
FT                   /translation="MPITLLTSMVLAFALSISISVAIGGSAMLGLALFDMDKLVLAPKE
FT                   MFAAIDKFPLAAVPFFILAGNLMETGGISRRLVEFAKSLVGGVQGGLPMTCVLTCMIFA
FT                   AVSGSSVATTFAIGSILIPALIKHGYPTSYAAALQATSAELGVIIPPSIPMILFGVSAE
FT                   VSIGELFIAGFGPGLLIGGALMLFVHLYCRFKGWGKRDGDGRLPVRIATAKAGWALLMP
FT                   VIILGGIYGGIFTPTEASVVAVFYALTVGLFIHRELELKDLVPVFRKSLISSAVIMFII
FT                   ANAGLFAFLITRAGVPEALGTWLTEVLKSPTWFLLGVNAALFVIGMFIETSAAIIVLAP
FT                   ILVPVARHFGVDPVHFGTIMVVNLALGMITPPFGVNLFAACTVARISLDQIVRHLVPFV
FT                   LVIVGCLMVVTYVPSISLALRDLVYPPKVASVAPSPSPWVAPAPASN"
FT   sig_peptide     93350..93418
FT                   /locus_tag="Bpro_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.461 at
FT                   residue 23"
FT   gene            94731..96179
FT                   /locus_tag="Bpro_0091"
FT   CDS_pept        94731..96179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0091"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42058"
FT                   /db_xref="GOA:Q12HD4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD4"
FT                   /protein_id="ABE42058.1"
FT                   /translation="MKSIEPQLNLIAGERCAATSGRTLDVLDPSDGEVFTTLPRSDARD
FT                   IDAAVAAARAAFHGAWGRTTATERGRIMMRLSALILQHHTALSELECRDTGKPIQQAQA
FT                   DIMACARYFEYYGGAADKLHGEMIPYAQGTTVMAVRVPHGVTGHIIPWNYPAQIFGRSV
FT                   GGALAAGNACVVKPAEDACLTPLRIAALALEAGLPAGALNIVCGLGIEAGAALASHTGI
FT                   NHISFTGSPQTGTAVAQAAAVNHVPVTLELGGKSPQILFADADLEQALPVVVNAIVQNA
FT                   GQTCAAGSRVLIDRAIHAQVMAQLKERFEALSTGPGLQGLDCGPLINRKQLERVQTMVE
FT                   AARGDGVRVAARARLVGGAPSGGFFFPPMLLDDVPPAHTIAQSEVFGPVLAAMTFDGED
FT                   EAVDIANGTPFGLTAAVWTRDGARQLRVAHRIEAGQVFINNYGAGGGIELPFGGMKHSG
FT                   YGREKAFEGLRGFTTIKTIAIKHG"
FT   gene            96213..96974
FT                   /locus_tag="Bpro_0092"
FT   CDS_pept        96213..96974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0092"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42059"
FT                   /db_xref="GOA:Q12HD3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD3"
FT                   /protein_id="ABE42059.1"
FT                   /translation="MKKLQDRVAIITGAGGGFGEGIAKHFAELGAKVVVADLRAEAAQQ
FT                   VAAAIESAGGQAIAVHVDVTQDASVADMVAAAVKRFGRLDILVNNAGTTHKNQPMLETD
FT                   EKTFDRVYATNVKSIYLGARHAVPLFRQQGGGVIINIASTAGLRPRPGLSWYAGTKGAA
FT                   ITLTKAMAVELAPDKIRVNAINPVMGETGLLADFLPGADSEEVRQKIIATIPLGRLSKP
FT                   IDIAKATAFLASDEADFITGVALEVDGGRCI"
FT   gene            97094..98335
FT                   /locus_tag="Bpro_0093"
FT   CDS_pept        97094..98335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0093"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42060"
FT                   /db_xref="GOA:Q12HD2"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD2"
FT                   /protein_id="ABE42060.1"
FT                   /translation="MSERIHATYWLETGDDPRRAAEVIAGEQSSGTFITLPNETPALKA
FT                   RSGARIERLEVLEQVGQPSLPVATPAKVYTRCTLELSWPIENLGPSLPNLMSTIAGNLF
FT                   ELRQVSGLRVLDLKLPASFAAAYPGPAFGIAGTRRLSGVAQGPLIGTIIKPSVGLDPAQ
FT                   TAEQVRQLIDGGIDFIKDDELQADGPHCPFDERVRAVMQVVNDAAQRDGRKVMVAFNLT
FT                   GDLDQMRRRHDLVQSLGGTCVMASLNSIGLVGLLELRRHASLPIHAHRCGWGYLSRSPA
FT                   LGWDFAPWHQIWRLAGADHLHVNGLANKFSESDASVIAAARAVLRPLFAHQPMPAMPVF
FT                   SSGQTGLQAPGTYAALGSADLIHAAGGGIFGHPGGIASGVSAFRQAWEAAMAGTPLHEH
FT                   AKTHAELRSALEFW"
FT   gene            98341..99714
FT                   /locus_tag="Bpro_0094"
FT   CDS_pept        98341..99714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0094"
FT                   /product="type III effector Hrp-dependent outers domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42061"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD1"
FT                   /protein_id="ABE42061.1"
FT                   /translation="MADNRWPDGLLLAYYGDDFTGSTDVMEAFSAAGVPTVLFLRPPTA
FT                   DWLKRFPEVRCVGLAGQSRGRSPDWMDRELPQAFASLAKLGAPILQYKVCSTFDSSPAV
FT                   GSIGRAIDIGVPLMPGNWSPMVVGAPRLKRYQAFGNLFAAVDGVGYRLDRHPTMSRHPV
FT                   TPMAEADLRLHLAAQTPRRSELIDMVQLRTGDAAARVQALAGADVPVVLLDVLDEETLA
FT                   AAGRLVWTQRGRGLFTASSSGLQYALAAHWRSQGLLPEQPSLPVAAPVPVIAVVSGSCS
FT                   PVTAAQIAWAQGQGFQAERLNLPRLLDARESEVEIERVVAAAVGAIALGVSPLVYSAAG
FT                   PDDAAVRQFDATATQAGLARGEAAQRVGEGLAEVMRRLLERAPLQRIVVAGGDSSGEVA
FT                   SALDITALSVVAGLAPGAPLCKAWSERRERDGLEIVLKGGQMGTASFFGAVRAGRLLD"
FT   gene            99774..100487
FT                   /locus_tag="Bpro_0095"
FT   CDS_pept        99774..100487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0095"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42062"
FT                   /db_xref="GOA:Q12HD0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HD0"
FT                   /protein_id="ABE42062.1"
FT                   /translation="MTTEQIQRRKLYQEVLDRLLERIRSGEIPPGAHLPSERELMEFYG
FT                   VGRPAVREALQALERSGIVEITHGERARVVIPTAGRLIEQLAGGARHLLHSQPDMLEHL
FT                   KDARVFLEVGMARVAAERATDEDIARLRQRLAEHRASVGKVDEFIQLDMAFHREIARIS
FT                   GNPIFPAILEALFGWAIEYYHPFVRAPGAEQLTLAEHARLVEAIATRDPQAAEAAIREH
FT                   LTRANELYRQLDPSR"
FT   gene            100500..100679
FT                   /pseudo
FT                   /locus_tag="Bpro_0096"
FT   gene            100735..101523
FT                   /locus_tag="Bpro_0097"
FT   CDS_pept        100735..101523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0097"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42063"
FT                   /db_xref="GOA:Q12HC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC9"
FT                   /protein_id="ABE42063.1"
FT                   /translation="MTSDNSSMSVAVITGGARGIGLAIGQWFLKHGHRVALLDIDGDTL
FT                   AQTAARLNDDHVLAVHCDVSDPQQVQAAVDKVRAAFGRIDALVNNAGVAVFKPIAETTF
FT                   AEWRHVMATNLDGAFLCTQACAPVMQKTGGGSVVNIASISGLRASTLRVAYGTSKAALI
FT                   HLTKQQAVELGNVGIRVNAIAPGPVETEMAKLVHSVAIRSDYYDAIPLNRYGTTEEIAS
FT                   VAGFLCSAAASYVNGQVVAADGGFDAAGVGLPTLRKRAAA"
FT   gene            complement(101791..102594)
FT                   /locus_tag="Bpro_0098"
FT   CDS_pept        complement(101791..102594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42064"
FT                   /db_xref="GOA:Q12HC8"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC8"
FT                   /protein_id="ABE42064.1"
FT                   /translation="MESLLTYDRLHSDTAGESHFARLEISLSTRHFAPPAPPFGVSELT
FT                   PVSRCGFLRVLAGFVGDLHPSPLHMWIFFLNGEMEFEASDGERRRDVPGNALLLEDTTG
FT                   KGHRSRVPGAGCRVPGAGCRAPPTRFSRLSSCALSFFNEEDSMGNRFLRLAVIYLLVGV
FT                   TLGIGMAASHNYTMRPVHAHLNLLGWASMGLFGLWYRSAPAAADTRLAKVHFWLHNLAL
FT                   PVQMVTLAMFMGGNQAVEPVLALASVVIGVGLVCFAINLWKHTGS"
FT   gene            102896..103237
FT                   /locus_tag="Bpro_0099"
FT   CDS_pept        102896..103237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0099"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42065"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC7"
FT                   /protein_id="ABE42065.1"
FT                   /translation="MSTIPACPQCALENTYPDGDNYVCADCGHEWPMLETADADDSADA
FT                   VVKDANGNVLADGDAVVLIKDLKVKGSSITLKMGTKVKSIRLVGGDHEVDCKMDAGSFM
FT                   LKACYLRKA"
FT   gene            103719..104111
FT                   /locus_tag="Bpro_0100"
FT   CDS_pept        103719..104111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0100"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42066"
FT                   /db_xref="GOA:Q12HC6"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC6"
FT                   /protein_id="ABE42066.1"
FT                   /translation="MTTLRNDQLDLLRRALAERDAQLQVEVRAAKEVAAERPPATARDV
FT                   QDPGEDAEERYRQGLEHVDLQRDQEELRAIQQAQERMADGSYGGCIDCGQPIPFERLKA
FT                   QPSASRCIACQTRFEQGRDTTPRYTV"
FT   gene            complement(104975..105679)
FT                   /locus_tag="Bpro_0101"
FT   CDS_pept        complement(104975..105679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0101"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42067"
FT                   /db_xref="GOA:Q12HC5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC5"
FT                   /protein_id="ABE42067.1"
FT                   /translation="MKIENSVVLVTGANRGIGQAFSRELLARGARKVYAGARDPATVTQ
FT                   SGVQALRLDVTKPADVAAAAALASDVTLIINNAGIAQPGGFLAADSEDVARRIFETNFF
FT                   AMLRMSKAFAPILKANGGGALLNVLSVASWVNGGELAAYSASKSAAWSLTNALRNELAT
FT                   QKTQVLALHMAYVDTDLTHGFDVPKSSPEEIVKRALDGLESGLDEVLADELTLQVKRGM
FT                   TVARPSYLPQAS"
FT   gene            complement(105757..106758)
FT                   /locus_tag="Bpro_0102"
FT   CDS_pept        complement(105757..106758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0102"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42068"
FT                   /db_xref="GOA:Q12HC4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC4"
FT                   /protein_id="ABE42068.1"
FT                   /translation="MKAFILERYGKKRALRLADMPTPELRDDEVLVQVHAAGVNLLDSK
FT                   IRDGEFKLILPYRLPLILGHDVAGVIVKVGPQVRQFKLGDEVYARPDDFRIGTFAEFVP
FT                   VKEASLALKPKGLTMEEAASIPLVALTAWQALVEKANLKKGQKVFIQAGSGGVGTFAIQ
FT                   LAKHLGATVATTTSTTNVALVKSLGADVVIDYKTQDFEDVLRDYDVVLNSQDGKTLEKS
FT                   LRVLKGGGKLISISGPPDPEFGKESGAPGFVKLVMRLLSSGIRRKARSRGVSFSFLFMK
FT                   ANGSQLREVTRLFDAGVIRPVMDRVFPFESTNEAMAYVEAGRAKGKVVVKIK"
FT   gene            complement(106768..107292)
FT                   /locus_tag="Bpro_0103"
FT   CDS_pept        complement(106768..107292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42069"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC3"
FT                   /protein_id="ABE42069.1"
FT                   /translation="MPSITLKPLTAGQAASTVGAMAILRLKQTGSVGLILAAALMAPPV
FT                   RADDASPAGLWRNVDDVSGKPRALIRITESNETLQGRIEKVFPGPTEDPNPKCDKCQGA
FT                   NKDAPVIGLVILNGLTKDGDEYGGGQILDPDNGKVYRSKVRLTDNGKKLSVRGYIGVPM
FT                   LGRSQTWVRQE"
FT   sig_peptide     complement(107149..107292)
FT                   /locus_tag="Bpro_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.971 at
FT                   residue 48"
FT   gene            complement(107306..107728)
FT                   /locus_tag="Bpro_0104"
FT   CDS_pept        complement(107306..107728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42070"
FT                   /db_xref="GOA:Q12HC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC2"
FT                   /protein_id="ABE42070.1"
FT                   /translation="MSMPRHRPMKISFRRVAILSALIFFALALTWMLAPGVLLSSWGVD
FT                   LTSQAGLVGRRGAPLYAGIGVMFLSARNAEPSPARSALLSGAVVTCLLLAVLGTSELVN
FT                   GHAGPGILVAVAIEIVLAMTFLHVAITRKSTRQSSH"
FT   sig_peptide     complement(107597..107728)
FT                   /locus_tag="Bpro_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.467 at
FT                   residue 44"
FT   gene            complement(107725..108711)
FT                   /locus_tag="Bpro_0105"
FT   CDS_pept        complement(107725..108711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0105"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42071"
FT                   /db_xref="GOA:Q12HC1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC1"
FT                   /protein_id="ABE42071.1"
FT                   /translation="MSFKALLASKTGKTISTSVVEMNEQDLMPGDVVVDVDYSTVNYKD
FT                   ALAVTGRADVIRQFPLIPGIDFAGTVKASSYPGIAAGDRVVANGWGLSQTHHGGYAQKA
FT                   RVNGEWLIKLPAALSTKDSMAIGTAGYTAMLCVLALEHGGLTPQHGDVLVTGANGGVGS
FT                   VAIAILSGLGYRVVASTGRLEESDYLRSLGAADIIDRRMLSEPGAPMGSERWAGAVDSV
FT                   GSRTLANVLAQTRYRGVVAACGLAQGMDLPASVLPFILRNVTLAGIDSVNAPQQVRIEA
FT                   WSRLARDLDLGKLARTTHLVGLAEVPAVIERLFEGKVQGRTVVDVNA"
FT   gene            complement(108739..109593)
FT                   /locus_tag="Bpro_0106"
FT   CDS_pept        complement(108739..109593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0106"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42072"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HC0"
FT                   /protein_id="ABE42072.1"
FT                   /translation="MNMMNKIALVTGASSGIGEVTAQRLSKAGYKVYGTSRRGGQAGQQ
FT                   SFEMLPLDVTKNESVEAAVQKLMQLEGRIDLLVNNAGFGVAAAGAEESSIEQAQSMFDT
FT                   NFFGIVRMTRAVVPHMRRQGSGRIINIGSVFGFLPMPYMALYAATKHAIEGYSESLDHE
FT                   LRTWGIRVSVIEPANTNTQFDANLLEPDSKLDEYREVRAALTKKMKELVEAGDKPGVVA
FT                   DAVLKAALAARPKLRYPAGIRAGGLRLLRRFAPAGLVDAGIRKNLQLDAPTVSLPRTPV
FT                   LEK"
FT   sig_peptide     complement(109525..109593)
FT                   /locus_tag="Bpro_0106"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.681) with cleavage site probability 0.655 at
FT                   residue 23"
FT   gene            complement(109745..110344)
FT                   /locus_tag="Bpro_0107"
FT   CDS_pept        complement(109745..110344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0107"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42073"
FT                   /db_xref="GOA:Q12HB9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB9"
FT                   /protein_id="ABE42073.1"
FT                   /translation="MMLIMQNRKPNARAAAKDATHERIVAVAARAIRRSGYDGTGVADI
FT                   MKEAGLTHGAFYAHFTSREAMLAEAAGRACAESAAVVAEVVASVPSEQAFASMLRTYLS
FT                   REHLEQVEMGCPLAALGSETPRQAPEVRRVTTRHIKEMIDLVARQSPDWGQPGAHERAL
FT                   VTVATMVGTLLLARAVDEPALSDSLCAAALKHLPPA"
FT   gene            complement(110684..110983)
FT                   /pseudo
FT                   /locus_tag="Bpro_0108"
FT   gene            complement(111118..112083)
FT                   /locus_tag="Bpro_0109"
FT   CDS_pept        complement(111118..112083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42074"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB8"
FT                   /protein_id="ABE42074.1"
FT                   /translation="MRHLLIGLLILLGSATSAIAQVSIGIHLSLFPEFVRVPGYPVYYA
FT                   PRLDSNFFFYDGMYWVYQRDHWYASSWYNGPWVLVVPEFVPLFILRVPVRYYRLPPGYF
FT                   YGWRPDAPPRWGEYWGREWEQHRRGWDKWDRRSAPAPAPLPVYQRQYSGDRYPQMEQQQ
FT                   TLHSQNYRYQPRDAVVRQHYQGQAVQRAPAPSQREQPGAQQERQRSARQQDIQRPDQPP
FT                   PLQQGRPAAPRAQPPQRGGEEDQRDQRSAPGQARPQQQRGPAVQDQQQPPQGAAPREQQ
FT                   TPRASQENVPKGKGAPQEPRRKQGQGKDRDKDEDRGQDRK"
FT   sig_peptide     complement(112021..112083)
FT                   /locus_tag="Bpro_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 21"
FT   gene            complement(112569..113006)
FT                   /locus_tag="Bpro_0110"
FT   CDS_pept        complement(112569..113006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42075"
FT                   /db_xref="GOA:Q12HB7"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB7"
FT                   /protein_id="ABE42075.1"
FT                   /translation="MIYLSIKAFHIVAVVTWIGGMLTLSLVLGSLAHATLPREANEHRL
FT                   LVAIHRWDRKVTTPALGLVWLLGITLAVMSGWYSAPWLWAKLAGVVLLSALHGNQSATI
FT                   RRMSGDSALQAPGYMRLTAGFTVAAITAIILLVTLKPPGAL"
FT   sig_peptide     complement(112902..113006)
FT                   /locus_tag="Bpro_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.633 at
FT                   residue 35"
FT   gene            complement(113164..114585)
FT                   /locus_tag="Bpro_0111"
FT   CDS_pept        complement(113164..114585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0111"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42076"
FT                   /db_xref="GOA:Q12HB6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB6"
FT                   /protein_id="ABE42076.1"
FT                   /translation="MNAPLPVHLLPEIHQRETPAALLDALKARFAERCSTALVVREQHG
FT                   RDESSFAAPPPAAVVFAESTLDVADAVKLASQYNVPVIPFGVGTSLEGHLLAVQGGISI
FT                   DVSRMNKVLSINAEDLTVTVQPGVTRKQLNEEVKSTGLFFPIDPGADATLGGMSATRAS
FT                   GTNAVRYGTMRENVLALEVVTASGEVIRTGTRAKKSSAGYDLTRLMVGSEGTLGVITEV
FT                   TVRLYPLPEAISAAICSFPSIEAAVRTTIEVIQMGVPIARVELIDHNTVRMVNAYAKLG
FT                   LREEPMLLMEFHGSPSSVKEQAELVQELASGHGGQAFEWASTPEERTRLWTARHNAYFA
FT                   AIQSRPGCRAISTDTCVPISRLADCLLESVAEVDASGIPYFLVGHVGDGNFHFGYLIDP
FT                   EQPKEREVAEELNHKLVSRALALEGTCTGEHGVGLHKMDFLVTETGDAAVEMMRTIKRA
FT                   LDPKNIMNPGKIFTL"
FT   gene            complement(114744..115124)
FT                   /locus_tag="Bpro_0112"
FT   CDS_pept        complement(114744..115124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0112"
FT                   /product="acid shock protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42077"
FT                   /db_xref="GOA:Q12HB5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB5"
FT                   /protein_id="ABE42077.1"
FT                   /translation="MTVKNHSIPNFGNFELRSVVLVAALAMGAAAAARAQNSPPSPTSP
FT                   ASPTNPSAQMAPSATTGTIPPNRVTRNDLEAAFNRADTNRDGKLDRQEAEHFPAVAQRF
FT                   ELIDTDHDTFISRGEFSSAAGS"
FT   sig_peptide     complement(115017..115124)
FT                   /locus_tag="Bpro_0112"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.912 at
FT                   residue 36"
FT   gene            115324..115893
FT                   /locus_tag="Bpro_0113"
FT   CDS_pept        115324..115893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0113"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42078"
FT                   /db_xref="GOA:Q12HB4"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB4"
FT                   /protein_id="ABE42078.1"
FT                   /translation="MANRLSQIATRTGDNGTTGLGDNTRVSKDSLRVHAMGDVDELNSQ
FT                   IGVLLCEEMPPGVRDLLVEVQHQLFNLGGELSIPGFELLKPEAVALLDAALAEHNAQLP
FT                   RLAEFILPAGSRAAALAHVCRTVARRAERAVVALGAAEPLKEAPRQYLNRLSDLLFVLS
FT                   RVLNRMNGGDDVYWKSERMARAASEE"
FT   gene            complement(115929..116357)
FT                   /locus_tag="Bpro_0114"
FT   CDS_pept        complement(115929..116357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0114"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42079"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB3"
FT                   /protein_id="ABE42079.1"
FT                   /translation="MRIWKQPISIELLTASNANCAVTHLGIEFLEVGDDFIRARVPVDR
FT                   RTVQPYGLLHGGVSVVLAETLGSCGAAYTAPAGHRAVGLDINANHLKGTTSGWVTGITR
FT                   PVHIGRSTQVWQIEMTNDAGELTCVSRITMAMLQPKQS"
FT   gene            116495..117802
FT                   /locus_tag="Bpro_0115"
FT   CDS_pept        116495..117802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42080"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB2"
FT                   /protein_id="ABE42080.1"
FT                   /translation="MTRAHRWLVGLGLVLGLPVLLWVAMMRLVPSDDELARRAALQLEA
FT                   WLGVKVNVGALHWRLLPAPTLVMENIITVQPQPIVIQKLTAYPDLLALWQRRVKMDRVD
FT                   LHGATVPQLSLGWALARPEHGREPTESSVGDIPLARLVFRDVTWISRHGVPVIYDGEVD
FT                   FDPGWRPRHALLRRPGFTPVTDLTLTREGQDDRWAARINVGGGTAHGTVELQTRPNGRF
FT                   HLEGALQPKDMEVESALAAFNRRSIVAGKASGNTVLSAHGDNVVELAQSLHTRTTFAMG
FT                   SSKLLRFDLDKAIRSAGQEFAGQTALESVTGQLDTQNTPQGMVVDYTGIKAGSGALTAS
FT                   GKARVANQQVQAELSVDLVDGVVGVPLQINGPLENVRVSVSRGALAGAMVGTAILPGVG
FT                   TAIGARIGATLGKILSPDPAGKPVPRSGTGSPGKQP"
FT   gene            118008..118400
FT                   /locus_tag="Bpro_0116"
FT   CDS_pept        118008..118400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42081"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB1"
FT                   /protein_id="ABE42081.1"
FT                   /translation="MSPKQSASPLSTPLARALDQNDTAKETMEQAADELMVINTVLKQE
FT                   IPDPLQTGEVAQALRKTDEIERRIQESADELAQVHQVLAQEIGARVDLERELVATKIAL
FT                   AQARGQRLHEVEPCSTGGQGGSPRPR"
FT   gene            complement(118684..119970)
FT                   /locus_tag="Bpro_0117"
FT   CDS_pept        complement(118684..119970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0117"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42082"
FT                   /db_xref="GOA:Q12HB0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HB0"
FT                   /protein_id="ABE42082.1"
FT                   /translation="MGMLDWKEKSVDVLKQGGVIAPDERLPWPQTAVMGVQHVIAMFGA
FT                   TVLAPILMGFDPNIAILMSGIGTLIFFAVTGGKVPSYLGSSFSFIGVVIAATAYAGKGP
FT                   NANLGVALGGIIACGVAYTLIGVIVQLVGTGWIERVMPPVVTGAVVAVIGLNLASIPVK
FT                   NMAASNFDAWMQLVTFVSVALVAVMTRGMVQRLLILVGLLVASIVYAVLTNGLGLGKPL
FT                   DLSGIASAGWVGLPGIAAPVFSLNAMLLIAPVAIILVAENLGHIKAVTAMTGKNLDVYI
FT                   GRAFIGDGVATIVSGSAGGTGVTTYAENIGVMAATKIYSTAVFVVAALIAILLGFSPKF
FT                   GALIQAIPLPVMGGVSIVVFGLIAVAGAKIWVDNKVDFSDNRNLIVAAITLVLGTGDFT
FT                   LKFGQFAMGGIGTATFGAILLYALLNRQR"
FT   gene            complement(120086..120970)
FT                   /locus_tag="Bpro_0118"
FT   CDS_pept        complement(120086..120970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42083"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA9"
FT                   /protein_id="ABE42083.1"
FT                   /translation="MTRTSLQAATAYYNASPLTRVFRWGLGASQRIWPALAVRAAYRLF
FT                   GTPLPPKWLSRRRAWSPAWHLEQWPFEDASLTLYSRPIAPQGPVVLLVHGWGGHAGQML
FT                   ALADTLAAQGMRPMIVEMPAHGRSRGSTSNLPQFARVIEYVSARLQQQGYSVHGLVAHS
FT                   LGANAGAYAASRGLPVNRLVLLAPPASPYEYTRLFAHVFGLSETTRAAMQHRVEAREGI
FT                   LMPQFEPAAVGPRIHLPTLVVHDRQDNINHFADGVAYSQTIEGARLVATEGLGHQKILK
FT                   DTGVLQHVASFLA"
FT   gene            complement(121214..121816)
FT                   /locus_tag="Bpro_0119"
FT   CDS_pept        complement(121214..121816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0119"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42084"
FT                   /db_xref="GOA:Q12HA8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA8"
FT                   /protein_id="ABE42084.1"
FT                   /translation="MDAKTQKSEMTRTAIIGAGIDLAAAEGLEAITLQAVADRIGLSKS
FT                   GVFSRIGSREALQKAVIEEFGRRFLADVFVPAMQQPKGLPRLNEIVRRWIVRTRDVEVQ
FT                   QGCIYTAGAFELDDKEGELRNTLLQEVTRWRAALRRTVLQAIEAGHLQPDTDPEQLVSE
FT                   ISSLSIGLLHDARFLRDPRAAERTQASWERLINSYKT"
FT   gene            121916..124006
FT                   /locus_tag="Bpro_0120"
FT   CDS_pept        121916..124006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0120"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /EC_number="6.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42085"
FT                   /db_xref="GOA:Q12HA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA7"
FT                   /protein_id="ABE42085.1"
FT                   /translation="MSAPFTPQIRLYQDWLKATRGLSFDSYDALWRWSVTDLEAFWQSI
FT                   WDYFELQSPTPHTAVLADRRMPGARWFPGAQVNYARQVLRHVDKAHAAGFPALVNHNEK
FT                   SLASGQHRELSWPALRQQVASLALHLKAQGVEPGDRVAAYLPNIPEAMVAFLAVVSIGG
FT                   VWSICAPDMGTHAVLDRFKQIEPKVLIACDGVRYGGRDFDRTAVLAELRAALPSLQHVI
FT                   VHENLGSTNSIADSTLLESATARNDAQTAAFEPLWLPFDHPLWIVYSSGTTGLPKPIVH
FT                   GHGGTQLVALALKTLHNDIGCSYEANSWGERYHWYSSTGWVMWNAQLSGLLNGTTCCLF
FT                   DGNPGGSKDKPDWTTLWRFAADLDVTFFGAGAAFFANCMKAGVELAECGDLTRIRALGS
FT                   TGSPLSEDTQRWGTQQFRKLHAVRSEPVKEPFDLAQDRLRQAQPEREDIWWCNISGGTD
FT                   FAGAFIGGNRELPLVPGEMQCRLLGCAVEAWNEQGQPVINEVGELVCTQPLPSMPLYFV
FT                   GDEGNQRYLSSYFDIYPNVWRHGDWLKIGANGGCVIYGRSDATINRHGLRMGTSELYSA
FT                   IEALPEVLDSMVVDLEYLGRESYMPLFVVLREGVALDDALKARLNGAIKTALSPRFVPD
FT                   AIFQVPEIPRTLSGKKQELPIKKLLLGQPIEKVVNRDAMANPDCLAWYVQFSQNYLAER
FT                   GA"
FT   gene            124003..124452
FT                   /locus_tag="Bpro_0121"
FT   CDS_pept        124003..124452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42086"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA6"
FT                   /protein_id="ABE42086.1"
FT                   /translation="MNRRMMGAAALAVLGLLTACATGPASAPPADVPAASATSGLRVTG
FT                   TVSYLQRVALPPDSDVIVQLRDISRLDSPSGVLAEQRFTPRSQVPLPFELSVDPGRIDP
FT                   RMRYAVAARIQRNGKLLFINDKLHLVLTQGHGNRVDMVLHMVSKP"
FT   sig_peptide     124003..124068
FT                   /locus_tag="Bpro_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.624 at
FT                   residue 22"
FT   gene            complement(124466..125365)
FT                   /locus_tag="Bpro_0122"
FT   CDS_pept        complement(124466..125365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0122"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42087"
FT                   /db_xref="GOA:Q12HA5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA5"
FT                   /protein_id="ABE42087.1"
FT                   /translation="MTARKTHLDTLAVSLLLGCCLFWGLQQVLIKATISEIPPMFQASL
FT                   RLLGATALLGLWCLWRGIALFGRDGSLRAGLLAGALFGAEFACIYLGLQYTSASRLTVF
FT                   LYTSPFWVALLVPLWVKAERLRGLQWVGLLGAFVAVVFALREGFTAGHGSTARGDLLAL
FT                   LAGLLWGLTTVVIRASSLTNIAAEKLLFYQLAVSGLAFPALSLALGEVWVWQFSPFAIT
FT                   SLLLQTVIGAFASYLAWMWMLGHYPATRISVFVFLTPLFALLFGALWLRESVTPGLLAA
FT                   LALVAVGVVLVNRQPAAA"
FT   gene            125452..126354
FT                   /locus_tag="Bpro_0123"
FT   CDS_pept        125452..126354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0123"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42088"
FT                   /db_xref="GOA:Q12HA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA4"
FT                   /protein_id="ABE42088.1"
FT                   /translation="MDHKWLEDFIVLARERSFSRAAELRHVTQPQFSRRIRALELWAGA
FT                   DLINRASMPLGLTAAGEELLPVAHRAAASLNDARARIRHARGSLDWVTLATGRTLSRTA
FT                   VPDWLARVKRSAGEFRLRILTGSIHEGATALEQGAADFLLSFTHPRLPLLLDEQTFEGI
FT                   TLGTDELVAVSAPRGDGQPRHALPGTDRHPVPVLGYAPTLALSQILQDGLSRSSRELHL
FT                   HTVTESDFAESLHEQALQGVGMAWLPRGLVDGDLRSGRLVEADGKGAAVRFEIRLYRPR
FT                   SPRNDLVQRIWSASTAAGA"
FT   gene            126442..127449
FT                   /locus_tag="Bpro_0124"
FT   CDS_pept        126442..127449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0124"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42089"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA3"
FT                   /protein_id="ABE42089.1"
FT                   /translation="MPETFTLNRRGVGRTLCLAAAGLLCLPAAWAQAWPAGKPISLVVG
FT                   YPAGGSVDLVARIIAEPLAKRLGTPVVVDNVGGAGGTIGAQKVVNAAADGYTLLLGSGS
FT                   EVSIARLFNAAVRYNGETDLAPVGLIGVTPMVFVTSPRTGVKTIEEALAKSRRERNQLN
FT                   FASSGIGTPLHVSGELINLLAGTTFRHVPYRGAAQQLQDLLGGNIEFSVSVLSSALPHI
FT                   ESGKMVPLGVTTATRSRAAPQIPALGENPRLKGYDMNVWFGLFGPAKLPAPLVARLNRE
FT                   LNDILREEAVWQKLQKAGISNEGGTPQALTAFIRAETQRVRSVVNKAVATGAAS"
FT   sig_peptide     126442..126537
FT                   /locus_tag="Bpro_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.949 at
FT                   residue 32"
FT   gene            127446..128420
FT                   /locus_tag="Bpro_0125"
FT   CDS_pept        127446..128420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0125"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42090"
FT                   /db_xref="GOA:Q12HA2"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA2"
FT                   /protein_id="ABE42090.1"
FT                   /translation="MSGGPIKAHAVQLEPPGLSGWAASPTGTAYVHERASVEAGPEVLL
FT                   TALVHGNEYSGAWALDAFLRSGLHPRRGRITAAFCNTAAFARFEARHPDASRFVDEDFN
FT                   RVWSASVLDGSRHSAELSRAREIRPFVDRASHLLDLHSMHEPCGPLLVTGLLPRNIAFA
FT                   QSLGTASQVVVDAGHADGVRMRDYGPFAEKEGSRIALLLEAGQHWELASLQAARNVLMR
FT                   FLVGCGVMDHGDVPPGWLLPDAMPPPPVMVTHRIVARSADFAFVQDFRGGEIIRRAGTP
FT                   IAHDAGEAVVTPYDDCVLVMPSVRQLRPGVTTVRLGQRGDGMV"
FT   gene            complement(128541..129101)
FT                   /locus_tag="Bpro_0126"
FT   CDS_pept        complement(128541..129101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0126"
FT                   /product="flavin reductase-like, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42091"
FT                   /db_xref="GOA:Q12HA1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA1"
FT                   /protein_id="ABE42091.1"
FT                   /translation="MAGALQALQLNYPSMPTPSIPRKASSPSFSQREFRASLAMFATGV
FT                   TIVTARTPAGVLVGLTANSFNSVSLNPPLVLWSLAQAAGSMAALSAGSHYAINILAADQ
FT                   KALAERFASRREDRWADVLFTEGASGSPLLSGAAATFECFNRSRYEEGDHVIFVGEVER
FT                   CSHRAGAAPLLFHGGRFYTEHPL"
FT   gene            complement(129205..131019)
FT                   /locus_tag="Bpro_0127"
FT   CDS_pept        complement(129205..131019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0127"
FT                   /product="sigma54 specific transcriptional regulator with
FT                   PAS sensor, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42092"
FT                   /db_xref="GOA:Q12HA0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12HA0"
FT                   /protein_id="ABE42092.1"
FT                   /translation="MGNTSRISLADVARATGTTLGNFDSALVAKALGGFANAHIGGDAH
FT                   PNIADISECLFFSPGDGRIWLQDQRMVLLHTEALGSLRREMIDSLGLEQARGLFTRAGY
FT                   VSGARDAQLVRRQWPDADPSAIALAGTRLHALEGVVKVEVVRASYKPETGSYEGEFLWH
FT                   NSSEDDEHIAAYGIGGSPACWMQVGYATGYVSTLFGHLVVFRETQCRSMGEAHCQVVGK
FT                   SADQWDDIAQDMRYLNVREFVDTAAYARPAPSAAELPQVEASAGDAMVGASSAFNAACH
FT                   QLSRVARTSATVLFTGESGVGKEKFARMLHKISPRKDRPFVAVNCAAIPETLIESELFG
FT                   VERGAYTGASHSRPGRFERASGGTLFLDEIGSLSYVAQGKLLRALQEGEVERVGGTRSI
FT                   AVDVRVVAATNEALRQAVLEGKFREDLFFRLNVFPIHLPPLRERRDDIPLLMNHFLNHY
FT                   RRKHGCNTGGFTQAAVRSLLNYAFPGNIRELQNLIERAVIMADMEGLIDVHHLFTSGET
FT                   LSADIMTLRLKGSSATLNFAEPAGCAQALAIATPSSTAQAPQSLDQTERDTLLRAISTS
FT                   QGNLSAAARLLNTTRAKLAYRARKHRLL"
FT   gene            131278..132732
FT                   /locus_tag="Bpro_0128"
FT   CDS_pept        131278..132732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0128"
FT                   /product="benzaldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42093"
FT                   /db_xref="GOA:Q12H99"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H99"
FT                   /protein_id="ABE42093.1"
FT                   /translation="MGAADATAFFNFSGLKQAALGGGARDVIEPATGQVLCTVGIADAA
FT                   DVAAATATAAAAQKAWVAVPPREKAEIFRRAAALFQQHGDELALYAARETGGILAKGQH
FT                   EIREAALICNLAASIPLQSQGHVLPSVPGRTSIARRVPHGIVGVISPFNFPMILTIRSV
FT                   APALAAGNAVVVKPDSRTPVTGGLMIARIFAQAGLPKDLLQVLPGDAEAGEALVIDPLV
FT                   PMIAFTGSPAVGRRIGELAGRHLKKVSLELGGANSLIILDDADLDVAASNAAWGAYFHQ
FT                   GQICMASNRILVHESMAAELTRRLIAKATHLPMGNGASGQVALGPLIDARQRDRVHALV
FT                   QDSVKAGAKLEAGGVFDGLFYKPTVLTGVKAGMRVYDEETFGPVANIITYKTDAEAIAL
FT                   ANNNTGSLSSAVISRSVGRAMAVGQQLKSGMVHINDQTVNDDCVNPFGGPGIAGNGTSV
FT                   GGPADFEEYTMWQWMTIKDTAPNYPF"
FT   gene            132756..133523
FT                   /locus_tag="Bpro_0129"
FT   CDS_pept        132756..133523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0129"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42094"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H98"
FT                   /protein_id="ABE42094.1"
FT                   /translation="MSLQGKTIVVTGTSSGIGAEVARLARFQGAKVIGMDRNDPSLTLD
FT                   DFVKADLGTAAAIDAAVARLPAHIDAFCNVAGVPGTAAGDLVARVNYLGLRHLTQAVLP
FT                   RMPRGGSIVNVASILGAEWPLRLDLHKELAAVKGFEAGAAWLRDHPVPHATCYQYFKEA
FT                   LIVWSATQSQEWFLGKGVRMNCVAPGPVFTPILGDFVSMLGEERIQKDAHRMLRPAFAD
FT                   EVAAVIAWLCSDAARWVSGVNIPVDGGLASTYL"
FT   gene            133577..135250
FT                   /locus_tag="Bpro_0130"
FT   CDS_pept        133577..135250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0130"
FT                   /product="protein of unknown function DUF1302"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42095"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H97"
FT                   /protein_id="ABE42095.1"
FT                   /translation="MTKKITPFQLGALALASSLLCALSAQAMELGSNPDTRIRLDFTPK
FT                   YSTAYRLKDASAALTVPSPDAGVANENDGNANFSKKGIVSNRIDLLTEFDVTHGNFGLR
FT                   ISHSAWYDSKYRGTNANDGTLGVSNFVGQPANQFIPATSAQHGRDDEFLDAFAFAKGNL
FT                   GSMPASIRVGKHALQYGESLFFGQNGIANAQGPVDIAKIVSVPNWQFKEVLLPVEQISG
FT                   SLQVAEGVTLGGYYQLKWRPSKIPGVGSYFSNQDYIGGGRVYLGPTTVLNTDNSKDQTP
FT                   GNSGQFGAQLRWSPAGSAFEYGLYAARYNDKTPSVPVFDLINGNVHKVYAKGIKTFGAS
FT                   VTSSVGQLNWALEGSVRTDAPLASDPAVLGGAPFMPPANCDGSASNPCHAIGKTAHLNL
FT                   SGIYVLTKSSLWDGGALLAELAWNRVLSVTRNPSAVGFGGLDPNTTRDAAAFRMIFEPQ
FT                   YFQVLPGLDLSIPIGLGYNFGGRSSAIFNFAGGVSKGGDFSVGVKGKYQEWNVGLNYTA
FT                   FFGKENTFTVTDARTPTRMLSYGQTLKDRSYLSFTASRTF"
FT   sig_peptide     133577..133660
FT                   /locus_tag="Bpro_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            135259..136635
FT                   /locus_tag="Bpro_0131"
FT   CDS_pept        135259..136635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0131"
FT                   /product="protein of unknown function DUF1329"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42096"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H96"
FT                   /protein_id="ABE42096.1"
FT                   /translation="MTETYTMMKFAKPPLLAAALLTAALTAQAAVSADEAAKLKTTLTP
FT                   LGAEKAGNKDGTIPSWDGGLSKATPGYKSGDARPDLYPNEKPTLSINAKNMAQHADKLS
FT                   DGVQALMKKYPDFRIDVYPTHRTAAAPQSVYENTLKNATRAKTIEGGYGMEGAFGGVPF
FT                   PIPKDGYEAMWNQRTAWRGGNVTLPMRVWVVTADGRRAMASGGTQTLSQAFYARDGSLE
FT                   KFDGYYSLGKFVANAPGSKAGEAILALDGVSEAAPRGLWQYLVGQRRVRKAPSVAYDTP
FT                   DSVTSGIGLFDEAFTLFGPIDKHELKLVGKKEMYIPYNNNRAASAKVEDLVTPNTLNPA
FT                   QVRWELHRVWEVEATLAPGKRHVVPKRKYYIDEDSWQIALFDGWDAKGQLWRTNYALML
FT                   TMPDVPAVSNFVLWGGYDMQNGSYYLNMASNEMPRQYEIVPPIPRSFFSAESLSNEGAR
FT                   "
FT   sig_peptide     135259..135348
FT                   /locus_tag="Bpro_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.718 at
FT                   residue 30"
FT   gene            136635..137714
FT                   /locus_tag="Bpro_0132"
FT   CDS_pept        136635..137714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0132"
FT                   /product="glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42097"
FT                   /db_xref="GOA:Q12H95"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H95"
FT                   /protein_id="ABE42097.1"
FT                   /translation="MSGFAHAGVARRAALLGLLGMAATATLPAWSATAPAVLSQAALMT
FT                   PKALGAATLAVTRAGKRLVAVGERGTVLLSDDHGARWKQAQVPVQATLTTVRFTDEKTG
FT                   WAAGHLGVILRSIDAGATWHKQLDGIQAAALALQAAQGTGDAKAIANARRLVEEGADKP
FT                   FFDLEFIDAQRGFAVGAYGLMFTTVDGGKTWAAVGPRLPNPRSLHLYGVRAHGSTLVIA
FT                   GEQGLLLRSTDGGASFSALESPYKGSFFGLLHTAGDVWVAYGLRGTAYRSTDAGTHWEK
FT                   LDTGLPMAVGAGAALAGGGFVLMGQAGDALVGRDDGPALKRVPAREPVPVSGVAIAADG
FT                   SLVLASLRGMRRLPALSVD"
FT   sig_peptide     136635..136730
FT                   /locus_tag="Bpro_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 32"
FT   gene            137725..140151
FT                   /locus_tag="Bpro_0133"
FT   CDS_pept        137725..140151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0133"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42098"
FT                   /db_xref="GOA:Q12H94"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H94"
FT                   /protein_id="ABE42098.1"
FT                   /translation="MHADSSSINASSQPVVARLEDFDTRSGTLLERAFFNHRPWVMALC
FT                   LLLTLVLGWQATKLQLNASFEKTIPTSHPYIVNYLAHKGDLAGQGNALRLVVQAKKGTI
FT                   FDKRYLDALQKINDEIFLLPGVDRPFMKSLWTSNTRWVAVTEEGLDGGPVIPDVYDGSA
FT                   ASLADLRANVERSGEIGQLVAGDFKSSIVFVPLLDRNPETGKALDYGDLSRQIEVLRAR
FT                   YGSDTLEIGVTGFAKVVGDLIEGLQQVLLFFLLALAITTMVLFAYTRCGRSTALVVACS
FT                   LVAVVWQFGLLALLGYELDPYSVLVPFLVFAIGMSHGAQKMNGIMQDIGRGTHRVVAAR
FT                   YTFRRLFMAGLTALLCDAVGFAVLVIIQIKVIQDLALIASIGVAVLIFTNLVLLPILLS
FT                   YTGVAPSAAARSLREETVQAGARRPWLWALLDHFTQKRWATAAIVVSGLMAAGGYAVSV
FT                   NLKIGDLDPGASELRADSRYNRDNAYQISHYAASADILTVMVTTPVDQCTSYGTLARLD
FT                   SLAWGLEQLPGVESTNSMAALSRLAMVGYNEGNFKWFELLPNDGALGGVQTRAPRELFN
FT                   QNCSFLALYVYLKDHKAETLSRVVAEVEKFAAANNTPEVTFKLAAGSAGIDAATNIVVG
FT                   KAMQEMLLWVYAAVVVLCWITFRSWRAVVVAVLPLVLTSILCEALMVWLGMGVKVATLP
FT                   VIALGVGIGVDYALYVLSITLARMREGASLSDAYHHALQFTGRVVMLTGITLALAVGTW
FT                   AFSPIKFQADMGILLAFMFVWNMVGALVLLPALGHFLLRKPVVAVVAPAAISVSI"
FT   gene            140163..141122
FT                   /locus_tag="Bpro_0134"
FT   CDS_pept        140163..141122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0134"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42099"
FT                   /db_xref="GOA:Q12H93"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H93"
FT                   /protein_id="ABE42099.1"
FT                   /translation="MTTSPVRTTLDATPLDPAFAGFLAQAAAQGAPPLEALPPPIARQV
FT                   YRDLANALGLPAPAIGKVEDKSIPGPGGVLPLRAYSPTTQGPWPVLLYVHGGGFVMGDL
FT                   QTHDEVCRTLCHLTGMLVVAVDYRLAPEHPFPAAPDDAEAALRWICVHADTLGGDPHRI
FT                   AVAGDSAGAQLALVAVRRVQSPAVRALGLIYPVAQHPDEPSPSYQENEGKFLTKGVMQW
FT                   FTASYLGGPSPTPPDHPDVALLKSELAALPATWVATMGHDPLRDEGHALALRAEAAGVL
FT                   VAHQHYPSAIHACIHFSAVSPIGPQVLADLAQWLREQA"
FT   gene            complement(141156..141974)
FT                   /locus_tag="Bpro_0135"
FT   CDS_pept        complement(141156..141974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0135"
FT                   /product="D-aminopeptidase DppA, Metallo peptidase, MEROPS
FT                   family M55"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42100"
FT                   /db_xref="GOA:Q12H92"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H92"
FT                   /protein_id="ABE42100.1"
FT                   /translation="MKVLISTDIEGVAGVFHHEQVRSGNPEYERARLLMTHEANAAIAG
FT                   AFEAGATEVLVNDSHGGFRNMPPDLLDARAQAVMGKPRYLSMMAGVDNGMDAVCMIGYH
FT                   SRAQGRGILAHTINSFAFARVRFNGVELGEAGIYGALAGEYGVPVVMASGDDVFIEEHR
FT                   PVFPHATFVQTKRATGQTSGISLSPAQACSAIQVGVAAALAQLGTARPFVLAGPIAVHI
FT                   QTQTPALADLFCQWPTLQRLDGDEVGFEAPTVEAAVRMVNCLSAMSTLLR"
FT   gene            complement(141985..143061)
FT                   /locus_tag="Bpro_0136"
FT   CDS_pept        complement(141985..143061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0136"
FT                   /product="L-aminopeptidase DmpA, Serine peptidase, MEROPS
FT                   family S58"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42101"
FT                   /db_xref="GOA:Q12H91"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H91"
FT                   /protein_id="ABE42101.1"
FT                   /translation="MLRHLLPHIGSLPPGPRNAITDVAGVTVGHCTLDAHEVQTGVTVV
FT                   CPHGGDLFRDRVPAAAVVLNGFGKSVGLVQVEELGVLETPIALTNTFSVAPVAEAQIRQ
FT                   CIAANPETGRSLPTVNPLVFECNDGFLNDIQRMAVTGQHYLQACAQAGTDVEEGSVGAG
FT                   RGMSSFGLKGGIGTASRRVPAPGGGEHTVGALVLANYGRLPQLVMAGQALGARLASQLA
FT                   GPLALEADEPEKGSIILLIATDAPLDARQLRRLALRAGAGLARTGSVFGHGSGDIALAF
FT                   STAYTVPQQTDRPMPAVAMLHDGLIDPLFQAVADSTEQAIVHALCCARAVTGRNGHHRK
FT                   ALADLLPDGAAPTHPQTP"
FT   gene            complement(143077..143997)
FT                   /locus_tag="Bpro_0137"
FT   CDS_pept        complement(143077..143997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0137"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42102"
FT                   /db_xref="GOA:Q12H90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H90"
FT                   /protein_id="ABE42102.1"
FT                   /translation="MTQTIVNEAVVAIAATPVATQNTRVRTPWTEFWRKFKKQHVAMAA
FT                   LAFVLLLVLLALLAPVIVPYDAENFFDYDKLNAGPSWQHWLGVDPLGRDIFSRILVGAR
FT                   ISLAAGFASVAIGGLIGTALGLLAGYYEGWWDRIVMRISDVLFAFPGILLALGVVAILG
FT                   SSMVNVVVAVSVFSVPAFARLVRGNTLVLKQMTYVEAVRSIGASDWTIIMRHILPGTIS
FT                   SIVVYFTMRLGTSIITAASLSFLGMGAQPPTPEWGAMLNEARADMVNAPHVALFPSLAI
FT                   FLTVLAFNLLGDGLRDALDPKIDRQ"
FT   gene            complement(144011..144931)
FT                   /locus_tag="Bpro_0138"
FT   CDS_pept        complement(144011..144931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0138"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42103"
FT                   /db_xref="GOA:Q12H89"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H89"
FT                   /protein_id="ABE42103.1"
FT                   /translation="MLNYFLKRLLGLTPTLLIVAVLVFLFVHMLPGDPARLAAGQDADQ
FT                   QTVELVRQELGLDRPLPEQFVSFFTHMLKGDFGTSLRTRRPVSTEIAERFLPTLLLTLT
FT                   SMSWAVIFGMAIGVVSAVFRNEWPDRLGMTIAVSGISFPAFALGMLLMQVFSVQLGWLP
FT                   TVGADSWRHYVLPSLTLGAAVAAVMARFTRASFVEVIQEDFVRTARAKGLKERTVIFKH
FT                   CLRNALIPVITMMGLQFGFLLGGSIVVEAVFNWPGLGRLLVDAVTMRDYPVIQTLVLLF
FT                   SLEFILINLVVDVLYGFINPTIRYK"
FT   sig_peptide     complement(144848..144931)
FT                   /locus_tag="Bpro_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.668) with cleavage site probability 0.230 at
FT                   residue 28"
FT   gene            complement(145010..146572)
FT                   /locus_tag="Bpro_0139"
FT   CDS_pept        complement(145010..146572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0139"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42104"
FT                   /db_xref="GOA:Q12H88"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H88"
FT                   /protein_id="ABE42104.1"
FT                   /translation="MTERMTPLRPKALAASLLALLALASTGSALAAKDVVLAIGGQPET
FT                   LDPYNTNTTLTTAVTKSFYQGLFEFDKDLKIQNVLAESYTASKDGLVYTLKLRQGVKFH
FT                   DGTDFNAEAVKVTLDRVLNPDNKLARFNQFNRVDKVEAIAPYSVRITLKEPFGPFINSL
FT                   AHASAAMISPTALKKYGNKDIAFNPVGTGPFTFVEWKQTDFVKVRKFDGYWKKGYPKVD
FT                   SVTWKPVLENNTRAAMLQTGETDFAFPLPYEQATELEKNAKLKLVSGPSIITRYLSFNM
FT                   QQKPFDNLKVREAINYAINKEALAKVAFGGYAVPAEGIVPQGVKYAHKMAPWPYDPKKA
FT                   RELLKEAGYANGFESVLWSAYTTTTAQKTIQFVQQQLAQVGIKISVQSLEPGQRTEWVQ
FT                   TAPDPKTAKVRMYYAGWSSSTGEADWALRPLLATEAWPPKLNNTAYYSNEKVDGAIAKA
FT                   LKSVDDKEKADLYRQAQEQIMKDAPWAPLVTEKNLYATSKRLSGVYVMPDGNINADEIA
FT                   VAE"
FT   sig_peptide     complement(146477..146572)
FT                   /locus_tag="Bpro_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 32"
FT   gene            complement(146634..148532)
FT                   /locus_tag="Bpro_0140"
FT   CDS_pept        complement(146634..148532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0140"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42105"
FT                   /db_xref="GOA:Q12H87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H87"
FT                   /protein_id="ABE42105.1"
FT                   /translation="MQPTVAEASQPSALYLPDNRVVAVNDLSVRFTTSERTVDAVRHLS
FT                   FHVDRGETLAIVGESGSGKSVTSLALMRLVEHGGGRIINGSMAFRRRSGEVLDLAQARN
FT                   ATLRSIRGADIAMIFQEPMTSLNPVFTAGDQIAESIQEHQGKSASAARAEALRMLELVR
FT                   IPEARNVLSRYPHQLSGGMRQRVMIAMALSCKPSLLIADEPTTALDVTIQAQILQLIRA
FT                   LQDEMRMGVVFITHDMGVVAEVADRVLVMYRGDKVEEGASEEVFARPRHPYTRALLSAV
FT                   PRLGAMEGTELPLKFELLRTEEADAAPREAAQPQDTIAPGSAPILRVQDLVTRFDVRSG
FT                   LFGRVARRVHAVEKVSFDIRPGETLALVGESGCGKSTTGRSLLRLVESQSGLIEFGGQN
FT                   IRDLPTSTLQGLRRNIQFIFQDPFASLDPRVTVGFSIMEPLLVHKIAKGKEAQARVDWL
FT                   LGKVGLPAEYAQRYPHEFSGGQRQRIAIARALALNPKVVIADESVSALDVSIQAQIVNL
FT                   MLDLQRELGIAFLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAIFENPQHAYTRKLM
FT                   AAVPVADPSRRHLSRQLMSDEIPSPLRAIGDEPVVPPLVEVSPGHFVAQHRIAGAY"
FT   gene            complement(148605..149591)
FT                   /locus_tag="Bpro_0141"
FT   CDS_pept        complement(148605..149591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0141"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42106"
FT                   /db_xref="GOA:Q12H86"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H86"
FT                   /protein_id="ABE42106.1"
FT                   /translation="MTPSKPLPVIAIHGGAGTMSRNHISAEQTAAYHAALQGILRVAQQ
FT                   LLADGGSALDAVSLAVDLLEDCPLFNAGHGSVFTHDETHELDAAVMDGATLRAGAVACV
FT                   SRVRRPLRAARAVMEHSEHVLLVGAGAEAFAEGLGMEMVSPDYFSTEARREQLRRALST
FT                   DQAMLDHDGAALVFRPSAAGAAPLDDDRKFGTVGAVALDAHGNLAAATSTGGMTNKRPG
FT                   RVGDTPLIGAGTYADNRTAAVSCTGTGEMFIRTVAAYDLCARMAYGGLSLDAAAQQVVM
FT                   DVLPAMGGRGGLIAVDVQGKLSLPFNTEGMYRGHARVGEAPQTAIFR"
FT   gene            complement(149588..150547)
FT                   /locus_tag="Bpro_0142"
FT   CDS_pept        complement(149588..150547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0142"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42107"
FT                   /db_xref="GOA:Q12H85"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H85"
FT                   /protein_id="ABE42107.1"
FT                   /translation="MTTVPGNPSMAQRIARVLPTLTRSHRQMADYVLAHPLQAATMPID
FT                   ELAATLGVSVATANRFARALEFDGYQQFRAALVLGFETTLAPVEKLRSTLEHPTTVADV
FT                   FASALAENQRNIDLTRQSLDAHSCEQAVGAILNAKRIYIMGFGASSWLGGLLQRSLDPY
FT                   CDNVQLLANIESSSHAARVLTRLQPTDLLIAIAYPRYFADTVLLTRRAREAGVPVLALT
FT                   DRVTSPLAPLATVALYAHTDSQYFANSEASALALIEALSSAVAHSAKGSLKAATQLAES
FT                   VLPWLHGSHSGRLRAVAEAAAPAPRKANAKSKSSKAPK"
FT   gene            complement(150886..151188)
FT                   /locus_tag="Bpro_0143"
FT   CDS_pept        complement(150886..151188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42108"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H84"
FT                   /protein_id="ABE42108.1"
FT                   /translation="MSRPKPAGRPGEPVDPSAAGKGMPGKSPRAQRPLPDQPITPADRS
FT                   VESSLELPHERDEAVDMTGEQTSPLIEQAERDVRKGLKDTSKAPEMDRAYKKLKS"
FT   gene            151361..151774
FT                   /locus_tag="Bpro_0144"
FT   CDS_pept        151361..151774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0144"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42109"
FT                   /db_xref="GOA:Q12H83"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H83"
FT                   /protein_id="ABE42109.1"
FT                   /translation="MIHIREIDHIVLRVIDLQRMLGFYTGVLGCTVERRQDDIGLVQLR
FT                   AGRSLVDLVPVDGKLGRAGGAAPGAQARNVDHFCFRVEPFDAVAIRGHLAANGVQAGEV
FT                   ESRYGAEGEGPSIYLTDPEGNTVELKGPPGAPA"
FT   gene            complement(151790..152425)
FT                   /locus_tag="Bpro_0145"
FT   CDS_pept        complement(151790..152425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0145"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42110"
FT                   /db_xref="GOA:Q12H82"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H82"
FT                   /protein_id="ABE42110.1"
FT                   /translation="MDHFSHLWLFFLMVLGIIVLPGMDMAFVMASSLTGGRRSGLFAVS
FT                   GIVAGGICHVVAGVLGLGLLLQLVPGMVHVMLLAGSAYIAWIGWSLIQSTSVFGDLPAV
FT                   HSRSPWRTFRQAALTCLLNPKAYLFMLAIFPQFLRLEYGSLWLQAIALGLIIAITQTGV
FT                   YGSLALAAGGTRRWLASRPAASVALARAVGAMLMLSAAFTAWQGWRQL"
FT   sig_peptide     complement(152333..152425)
FT                   /locus_tag="Bpro_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.863) with cleavage site probability 0.658 at
FT                   residue 31"
FT   gene            complement(152485..153012)
FT                   /locus_tag="Bpro_0146"
FT   CDS_pept        complement(152485..153012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42111"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H81"
FT                   /protein_id="ABE42111.1"
FT                   /translation="MMTTANPAQAAQPIQLTDGRHDFNFITGRWLVSNQRLLKRLQGCT
FT                   EWESFEAVQDGALLLGGLGNMNDLMVEGQGVIGMALRFFNPQTRQWSIYWVSRSDGLLQ
FT                   PPVVGAFAKGIGRFEGTDTHEGRPVRVRFLWSEITPGRARWEQAFSDDGGRHWEANWVM
FT                   TLTRPAYYAAHY"
FT   gene            153139..154089
FT                   /locus_tag="Bpro_0147"
FT   CDS_pept        153139..154089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0147"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42112"
FT                   /db_xref="GOA:Q12H80"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H80"
FT                   /protein_id="ABE42112.1"
FT                   /translation="MYSPTTRVLTVLELLQAHGRLSGAELARRLEVDGRTLRRYIAKLE
FT                   SLGIPVVAERGRYGCYSLVAGFKLPPMMFTDDEALALSIGLVAARGLGLAEAAPAVQSA
FT                   QAKLERVMPGKLKNRIRALGETVTLDLTRAVAPGDNTALLALSAAAHGWQRVHLSYQSA
FT                   DGVVTERDFDPYGLAYRGGRWYVVGLCHLRGGLRSFRLDRVQQVQPLNAVFTPPADFNA
FT                   VQHLALGLATMPRAITVRVLLHADLQCAQQALPESIGVFQPSEEGVLLHSQTDHVPWFA
FT                   RQLARLPFAFEIQEPPALREALRAWAQQLLDQHAA"
FT   gene            complement(154148..155485)
FT                   /locus_tag="Bpro_0148"
FT   CDS_pept        complement(154148..155485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0148"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42113"
FT                   /db_xref="GOA:Q12H79"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H79"
FT                   /protein_id="ABE42113.1"
FT                   /translation="MKVVVLGAGIIGVSTAWHLLERGHDVTVVDRQADAALETSFANAA
FT                   QISVSYCEPWANRDAPLKALKWMFRNDAPLLFRPKLDIHQWRWGLQFLAQCNDAAFERN
FT                   VQQLVALGAYSHAALKEVVNATGIEYKRLERGIAHYYTDQKSFDTAGDAAVLMQKYGVA
FT                   RRVVSTAELLAIEPAFQAFAHRIVGGTYTASDESGDARMFTQALARRCADRGVRFLYGH
FT                   DIDHLEKAGGAIESVAVRARTENGKRENIVRLKADEVVAACGSYTAPLLRTVGVDLPIY
FT                   PGKGYSATFKLLKPELAPFVSTIDDEVKCAMSRLGDHLRVAGTIEVGGYNLSLDTPLAK
FT                   ARCKMLADRIEQVLPGVCDTRLADQGGEPNFWTGLRPATPTNIPYIGRTRVGRLWVNAG
FT                   HGTLGWTHGAGSGKAIAELISGEVPAMDFGFYGFARPSEPQRALAT"
FT   gene            155593..156507
FT                   /locus_tag="Bpro_0149"
FT   CDS_pept        155593..156507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0149"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42114"
FT                   /db_xref="GOA:Q12H78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H78"
FT                   /protein_id="ABE42114.1"
FT                   /translation="MSTFDPDALECLAAIVEEGGFERAAQRLSITQSAVSQRLRALEAQ
FT                   VGTVLIVRSRPLKPTSAGQLLLKHTKMLRLLRADLERDLKELAPSWLGGAREEERISIA
FT                   INADSIATWAMQALTDLAQQGLPMEIIADDQDFTQEWLREGQVLGCVTTLRQALRGCKV
FT                   VSLGAMEYVAVAAPEFARDRLAHATLTAHNFRDIPFVAFNRKDDMQSEFVGKAFGLKRV
FT                   TLNQLFVPSSEGQVRAVLAGWGASVVPRLLAQGLIDQGLLVNVLPTCTLPIQLYWHCWN
FT                   LESEVLDALTAALRQAAALSLVP"
FT   gene            156670..157923
FT                   /locus_tag="Bpro_0150"
FT   CDS_pept        156670..157923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0150"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42115"
FT                   /db_xref="GOA:Q12H77"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H77"
FT                   /protein_id="ABE42115.1"
FT                   /translation="MFINSRLAGFGVAGAVAAIVALGTALPAAAQGVSAAAAPPSPAAN
FT                   TLKIGVIGPFTGASSDFGVPMLNGIQQAVDEINAVGGYLGRKLEIVRKDDKANPDVGLK
FT                   MSQELVAEKVSVTLGFCNTGVAAKSLEVYQANKLPLIIPCATGSPLTAKYPAAESYIFR
FT                   TSASDSIQAPFVVEDILKRGWNRVAVFADTTGYGEAGLQDVEKALAAKNLKPVYVARFA
FT                   LGVKDLGEELKAAKAAGANVVFSYTVGPENAVIAHGRQALNWKVPQVGAWTLSFPFFID
FT                   GGKDAADGALMAQTFIAEPSNERRASFLTSYARKFNVRKIPVPMAAAQGYDAVYLLIYS
FT                   LFGIRDGNLSGPAIKAALESKSRTYYGVVATYDQPFSKQDKDATTQNMLVMGMVKNGAV
FT                   TFAYPEDAKRNLFVQRKQ"
FT   sig_peptide     156670..156762
FT                   /locus_tag="Bpro_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.703 at
FT                   residue 31"
FT   gene            158058..162122
FT                   /locus_tag="Bpro_0151"
FT   CDS_pept        158058..162122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0151"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42116"
FT                   /db_xref="GOA:Q12H76"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H76"
FT                   /protein_id="ABE42116.1"
FT                   /translation="MLSWGGLRFRLVWLALIALVPVFGLFACTAAKNQQTALELARSRL
FT                   QSDVLLAAAHQQRLVDRVAQLLGDIASGPSVKDTRNRLCVQYLKNLQSQDAAYANLGVV
FT                   GLDGKVSCHAMDSGFDVYAGDRPFFQQVLAGRKFSVGEYSTGRASGRPGISFAVPVYSS
FT                   EGMLNGVAFAALDVGKMAQALAAGPVLDGAQLRLMDRRGTIVAMHPAGAGLQGTPERDA
FT                   VVLEAAQAQRSGIREAVDANGVGRVYAYAPVGGTGGDGLFLAISAPRDVITAGPQKTLL
FT                   INLLALLGMTAFGMGCAWWLGGRSIVKPAAAILTTANEIAGGNLAARVRLGPLHRGEFG
FT                   EIGSSFNRMAESLQARQDEVGAALGRVDKERALLDLIINSMSEGVVAVDTGGRFLLFND
FT                   TVGKLFSAAELGSPLDEWRRDHELLALDGETVYASVDRPLTQALRGATVDNRDVLFRKP
FT                   GFEDRVLRVSARPLRDHDNQLVGAVAVFNDVTDLKAAESFFRGQREVLALIASGAPLSQ
FT                   SLEAIVRLIEGRVAGGLCSILLVEGQQLHHGAAAGLPESFMRLIDGLPVGQGAGACGTA
FT                   AFLKQAVIVEDIATDPLMKDFREVARTYGLQACWSTPVISGEGEVLATFAVYHRTPCKP
FT                   RDKDLELLETGIRLARIALEHTRAQAALVSSEARFRELADNIQDVFYNRDARTGRMLYV
FT                   SPGYERIWGLSCESLYADPKSYRGAVLPEDRPVLEMADELTAAGKVCDLEYRIISPDGQ
FT                   TRWIRDNAYPVFNAAGELERVVGTARDITDRKLADRALDSTNRAMQMLSRSSVALNRID
FT                   DEASLLAEVCRVAVEVGSYRMAWVGYARDDEARSIEPMAHAGEEAGYLAMVNVSWQEDD
FT                   ATGQGPAGQAIRSGQPQQTGDIAAASNHFFWQEAALQRGYRSAICLPLRDDGRRGFGVL
FT                   CLYAAEVQHFVAGEVSLLQELADNLAFGIVSLRARLERRRSEELVRQTAAKMREQASLL
FT                   DRAQDAIMVRNLDRTLRYWNKGAERLYGWTAEEVLGKTMDEFMYRSPQVLISAMNRTLA
FT                   NHGEWTGELEQVARDGSTVYIEARWTVVRDEHGQVNGVLGINTDIRERKRAHEEILRLN
FT                   TSLEERVQQRTAQLEFANKQLESFSYSVSHDLRTPLSAIDGFSDLLDKALAKTVSGPQA
FT                   DRSRHYLSRIRAGVSQMGELIDAMLSLAQVSRASLRWETVDLSALALDVLARQRDREPG
FT                   RVAQLQVDPGLAAQGDPRLLQQVLENLLGNAWKFSAGTARTEITFGQQAGPGSETVYFV
FT                   RDNGAGFDMAYSEKLFGAFQRLHSPSEFSGTGIGLTTVQRIIARHGGRVWGEAALGRGA
FT                   TFYFTLGAARL"
FT   sig_peptide     158058..158141
FT                   /locus_tag="Bpro_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.604 at
FT                   residue 28"
FT   gene            complement(162162..162713)
FT                   /locus_tag="Bpro_0152"
FT   CDS_pept        complement(162162..162713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42117"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H75"
FT                   /protein_id="ABE42117.1"
FT                   /translation="MKNTTSYLGAWLGAASLAFAFALVAPNESSVMGRLPAFMTHTLLQ
FT                   QPVAVPDGLPSERTLALITFQRDQRGQAESWIQGLNLQNDPSIAWMRMPVLHDPGTPTG
FT                   RSAIENKLRQHYTADTERARLVPVFTDRASFVRAAGLNGVEQAYAVVINRQGDVLARVE
FT                   GQFDPDKAQTLRETLLTHGL"
FT   sig_peptide     complement(162645..162713)
FT                   /locus_tag="Bpro_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.377 at
FT                   residue 23"
FT   gene            163013..163594
FT                   /locus_tag="Bpro_0153"
FT   CDS_pept        163013..163594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0153"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42118"
FT                   /db_xref="GOA:Q12H74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H74"
FT                   /protein_id="ABE42118.1"
FT                   /translation="MQMLQAREEAIVQATNRLLAEKGFDLMTVDEVAAEVGIAKASLYK
FT                   HFSSKEDLAAAAMVRVLGHARTFLAGLAADARPIEQLKAVVRWMMQMRLAGEMPSLPSQ
FT                   NSSLRAALMANKAYLDGLMVISDQIGGWIEQAQQDGSLNPALPPILVLYTLYARACDPV
FT                   LEFLKAGGQHSDAEIVELVVGTCFEGLSSR"
FT   gene            163950..166487
FT                   /locus_tag="Bpro_0154"
FT   CDS_pept        163950..166487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0154"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42119"
FT                   /db_xref="GOA:Q12H73"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H73"
FT                   /protein_id="ABE42119.1"
FT                   /translation="MAGLALAVGLVFTGLGAFWVHDSIQAEARARFGRQVDRLQSDVEN
FT                   RLNAPLVGLRGAAGVYAASHSVERAEFRAYVESLQLQRDFPGVRGYGFLAWMLRDDLGR
FT                   FVSAERGDGAPAFSVNAAGSAPDLYVVKYIEPEADNHPLLGEDLGADAVRREAIEGALA
FT                   TGMPTLSKAVMLSGASRQERGFVYLLPVFRTGTDPSTPAQRRAALVGLLFAPLAVGEVM
FT                   SGAVAAVQGQADFELFDGARATADQLIYDFDGHLAAVRGEIGPAHYADRLLHASRAISA
FT                   GGRTLTLHVSSTAAFEAQAASPLPALLGLGGAALSLLLAICIWLLGSSRARALAAAQRM
FT                   TLSLAHEQQRLLSMVEGTNVGTWEWNVQTGEIRLDERWAGIIGYTLGELQPVSIQTWRG
FT                   QSHPDDLARSDALLEQHFAGQTSYYDFEARMRHKDGRWVWVLVRGRVSAWTDRRRPALM
FT                   AGTLMDITERQMAQLALRNSEEHFRQLYETSLDGILQTRPDGQVLHANPAACELFGMSL
FT                   DELRQRGRHGLVDPGDARLEPLLEERQREGKAYGELRMLRSDGSYFECELSSSMYLDQG
FT                   NQACANIVLRDITVRKRSEARITELNTELEQRVKRRTAQLEASNRDLQEFAHSVAHDLR
FT                   QPIIAIGGFSGLLERMVTDPHGKHYLARIKAGVQQAGELTEALLALANLSRVQLRPQAV
FT                   DLSAIARSVMDNLQQQDSRRVASICIEGNLVVQADPMLLRLVMEELLGNAWKFTSRQSC
FT                   TEISFGVREVAVGEVAQTVYEVRDNGVGFEMAHAGKLFRSFQRLHSQVDFPGVGVGLAN
FT                   IRRIIVRHGGQIWAQSAIGQGASFCFTLAYPRP"
FT   gene            complement(166533..167468)
FT                   /locus_tag="Bpro_0155"
FT   CDS_pept        complement(166533..167468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0155"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42120"
FT                   /db_xref="GOA:Q12H72"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H72"
FT                   /protein_id="ABE42120.1"
FT                   /translation="MTAVHTWRGQWRGAALLPHNHPVNIQLLSDLHLESDPHFRAQPLP
FT                   GADLLVLAGDIGSYQNGSQLGSLNIGDFGLARFSPLPVSQGGAGWPTPVFFLPGNHEYD
FT                   GLDFDETEARLRETCERLGMVWLERDTVVLQGVRFVGCTLWTDFDALGIAAARSGPVTE
FT                   EALLKAREKAFRAANFYLNRHHAFRGGQPMLADAVREEGLKSQAWLRQALSAPFAGPTV
FT                   VITHFAPSLLSADPRYGLVPGTAGFCNSLDELFAGADLWLHGHLHCPVDYVKDGCRVMA
FT                   NPLGYARKGEQLAFKPDLLIEIGPPSFSKD"
FT   gene            167589..168011
FT                   /locus_tag="Bpro_0156"
FT   CDS_pept        167589..168011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0156"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42121"
FT                   /db_xref="GOA:Q12H71"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H71"
FT                   /protein_id="ABE42121.1"
FT                   /translation="MKPRITLITLAVDDLQASLAFYRDGLGLATQGIVGEQFEHGAVAF
FT                   FDLQSGFKLALWPRDSLAHDTGLAKSARSATEFSIGHNVATREEVDAVMDQARRAGAKI
FT                   VKPAQSAFWGGYAGYFQDPDGHLWEIAWNPQFGLAD"
FT   gene            complement(168410..169420)
FT                   /locus_tag="Bpro_0157"
FT   CDS_pept        complement(168410..169420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0157"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42122"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H70"
FT                   /protein_id="ABE42122.1"
FT                   /translation="MPCPLLPATLASSTTRLPRRTALKVLAAGAASVALPALAAWPDKP
FT                   IKIVVTFPAGGASDIVARVMAEQLGKKLGQAVVVDNRPGAGGSVGGLVVTQAPADGYTL
FT                   MLSNSTPISIGPFALEKQPYDPVAGFTHIALIGNAPCVVMANPAAPIKTITDVEAQARK
FT                   AGRLDFGSGGPASIGHIYGELMKKAMGVNLVHIPYRGGAPMTTDLLAGVIPIGIDVLTA
FT                   FVPYFKSGQLVPLAVTSANRSPLVPDVPSVVEFGYRKLVLDNFFGLSGPANLPADLVTR
FT                   LNTACNEILASSEIKKKMLDLGISTSPVSSAAFTGFVKEQVSVLAPAVKGAGVKL"
FT   sig_peptide     complement(169301..169420)
FT                   /locus_tag="Bpro_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 40"
FT   gene            complement(169670..170698)
FT                   /locus_tag="Bpro_0158"
FT   CDS_pept        complement(169670..170698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0158"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42123"
FT                   /db_xref="GOA:Q12H69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H69"
FT                   /protein_id="ABE42123.1"
FT                   /translation="MSFTMVIYKSIQTMPPGPLTKERPLNPTNFRTLDLNLLRVFDEVM
FT                   AERSLTRAARNLSLTQPAVSNALRRLRETLGDELVQRSGQGMAPTPRARAIWPAVREAL
FT                   QRLQESLIPDEFVPGQATTTFVLAMADATAAELIPGLIETLEQEAPGVSMRVIPLTTRD
FT                   PRRLLDEQACDLAVGYFPSVLADLTAHAQSGEPMPFQHRRLYDGEYVCVMRKGHPLASG
FT                   PLTLDRFCAARHMLVSFSGRPYGFIDESLASLGRERQVVLTVNQFFTAGRVVANSNLLT
FT                   VLPRHFVRVTGIAEQLVLRPLPFDVSAVHVDAVWHRRSQQRGAHVWLREAVLRAADKAF
FT                   SN"
FT   gene            170802..171311
FT                   /locus_tag="Bpro_0159"
FT   CDS_pept        170802..171311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42124"
FT                   /db_xref="GOA:Q12H68"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H68"
FT                   /protein_id="ABE42124.1"
FT                   /translation="MTSFVNIKYSNQHPGVARVESAIDAARQLRQGFSGTRGLATLLLS
FT                   AMAAAVMVVAYQVMDSVTEGHLLVMWIALWAAAFAALALFAGTARRLATQLKTGLADWS
FT                   QSLAQARADQRMWAAARNDSRVMADLQAAMSRQEAAAEAATPATAAERTVKLGSSVMRA
FT                   YQRNYI"
FT   gene            complement(171455..173323)
FT                   /locus_tag="Bpro_0160"
FT   CDS_pept        complement(171455..173323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0160"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42125"
FT                   /db_xref="GOA:Q12H67"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H67"
FT                   /protein_id="ABE42125.1"
FT                   /translation="MNHPVMQGLELGTPGYVKNAKLIAWVADMVALCKPDRVYWCDGSD
FT                   AEYQRLCQQLVDAGTFKKLNETKRPNSFLALSDPSDVARVEDRTYICSARKEDAGPTNN
FT                   WMAPAEMRATLQPLFDGCMQGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVAVNMKIMT
FT                   RMGKAVFDVLGVNGDFVPCVHTVGAPLAAGQKDVTWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASNMGRDEGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKTNF
FT                   SMLVPPAGFDGWKVTTIGDDIAWIKPAADGKLYAINPEAGYFGVAPGTNMLTNPNCMRS
FT                   LDRDTIFTNVGLTDDGDVWWEGMEQDAPGKALPAHLIDWQGNDWTPQIAKETGAKAAHP
FT                   NSRFTVAATNNPALDSAWDDPKGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMG
FT                   SETTAAATGQAGVVRRDPFAMLPFTGYNMSDYFQHWLDMGQKLAGSGAKLPKIYTTNWF
FT                   RKGADGKFVWPGYGENMRVLKWMIDRIEGSGQGNDHITGVSPSYEDLNWTGLDFSAEQF
FT                   DSVISMDKAAWLKELELHAELFKQLEHHLPKELDQTMSAIERRLAA"
FT   gene            173735..174610
FT                   /locus_tag="Bpro_0161"
FT   CDS_pept        173735..174610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0161"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42126"
FT                   /db_xref="GOA:Q12H66"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H66"
FT                   /protein_id="ABE42126.1"
FT                   /translation="MKAAFLYALVASPRSVLKAWIRRWSGGAPRRRVAAAGLLHLALAL
FT                   QLGSGLVSPASAQDAGSSRPALIAAAANLQPVLAELVPLFERGQKSRVRVNIGSSANLV
FT                   RQIQQGLPAELFLSADEDFALRLADAGLTPDRGLVYATGRLVLLVPAGSPLALDPQLRG
FT                   LRSGLSQVQKFAIANPELAPYGRAAVQVLQKLDLWPALQGKIVLGENMAQATQYVSTGA
FT                   AQAGITALSLALAPELATRVRYVLLPDDLHAPLRQRMVLLKNAGPAAHAFYEFLQSAPA
FT                   KAVLMRYGYV"
FT   sig_peptide     173735..173908
FT                   /locus_tag="Bpro_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.740) with cleavage site probability 0.422 at
FT                   residue 58"
FT   gene            174729..175397
FT                   /locus_tag="Bpro_0162"
FT   CDS_pept        174729..175397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0162"
FT                   /product="Molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42127"
FT                   /db_xref="GOA:Q12H65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H65"
FT                   /protein_id="ABE42127.1"
FT                   /translation="MDWQAARVSLTLAVCSAALLLPLGVWLARWLAVTPWRGRPVVEAL
FT                   LMLPLLLPPTVVGFYLLITLGQGSAVGGWLARALGLRLVFSFEGLLLASVLVNLPFMVQ
FT                   PLQRAFAAIPGSLREAAWVCGLSPWRAFWKIELPLAWPGLLAGVALTMAHTLGEFGVVL
FT                   MVGGSIAGETKTLSIAIYDRVQAFDMPAAHVMALVLVLASLGALALVFAAGKARPLQER
FT                   "
FT   gene            175434..176585
FT                   /locus_tag="Bpro_0163"
FT   CDS_pept        175434..176585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0163"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42128"
FT                   /db_xref="GOA:Q12H64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H64"
FT                   /protein_id="ABE42128.1"
FT                   /translation="MLQVSLQNHGPIRLNADFDCAPGELLALLGPSGSGKTSVLRAVAG
FT                   LLQSPGLQGRVSVGTDVADVWFDSAGGIRRAPQQRRVGLVFQHYALFPHLTAVENVALA
FT                   AHPAKATAYFDALFERMGLAGLQARRPHQLSGGQQQRVALARALAREPQVLLLDEPFSA
FT                   VDAPTRQALYHELAVLRQSVAIPMVLVTHDLNEARRLADRVVILDAGESLQVGPPARVF
FT                   ASPRNARVAELVGIQNHFQGRFFSNRPADAPGFGRLVWHGQAPAGATPNSLPGAADVTL
FT                   AVIDKRRLDDGAEVSWVVAGELLDLSATPSAQAVNTFACTLREVLPLGEISLCTLVPLQ
FT                   LPSQCLTLNLSTAALRQLGAAPGSMLHLHIPPQAVHIMPVRQG"
FT   gene            176956..177420
FT                   /locus_tag="Bpro_0164"
FT   CDS_pept        176956..177420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42129"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H63"
FT                   /protein_id="ABE42129.1"
FT                   /translation="MNTPARMFAVCAAWAAVALLSACAASGPGSPSARPVLYPNATLNR
FT                   VGEVQGRAEADACMARAVSAGLTPEQKSNEVGRRAGEGAATVGVASAVGALITGRGTDG
FT                   VLRAGAAGAAVGGSAGAVSGAFHSDRPNTTYRSFVQRCLSEKGFDVIGWN"
FT   sig_peptide     176956..177030
FT                   /locus_tag="Bpro_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.786 at
FT                   residue 25"
FT   gene            complement(177751..178953)
FT                   /locus_tag="Bpro_0165"
FT   CDS_pept        complement(177751..178953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0165"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42130"
FT                   /db_xref="GOA:Q12H62"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H62"
FT                   /protein_id="ABE42130.1"
FT                   /translation="MLSLTDIEQAAQRLQGHLLDTPCVESRTLSQLTGAQIYLKFENLQ
FT                   YTASFKERGACNKLAQLSGDERRRGVIAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPG
FT                   VKTERTRGFGAEVVLHGDTLEESRAHALMLAEREGLVFVHPYDDEAIVAGQGTVGLEML
FT                   HAVPGLDTLVVAVGGGGLIAGMAIAAKALKPEIEIVGVQTSRFPAMVNAIKGTHHPQGT
FT                   STIAEGIAVGTPGVIPQAIIEKLVDDLVLVDEGDIEQAMVMLLEIEKTLVEGAGAAGLA
FT                   AVLKYPARFAGKKVGLVLCGGNIDPLLLAAIIERGMVRAGRLARIKVSVRDVPGSLAKI
FT                   TATVADAGANIDEVHHQRAFTTLSVQNVEIELVIQTRGREHIAQVLAALAAAGFEASEQ
FT                   H"
FT   gene            179131..181500
FT                   /locus_tag="Bpro_0166"
FT   CDS_pept        179131..181500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0166"
FT                   /product="AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42131"
FT                   /db_xref="GOA:Q12H61"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H61"
FT                   /protein_id="ABE42131.1"
FT                   /translation="MSKRSASEQQWLLSPGLKEAPVLDLMCSHFVLTLAARQGAKFNVR
FT                   RDLNSLLSLSGRHLVWPLPAMQRLREFLGRRCKDNELWRGHETLSDAEFMARHGAWRGP
FT                   YEEGTLFFYLDEHAKDQPKDLLSVLAATGEWLTHALKKQSTLVEKNIDALANLLQLNRA
FT                   ERALLLYGTLARYQRDLRSLLVEFKVSNAPEAYAAIADVAGVKAPEVAEALRAGSRLER
FT                   IGMVENLISEHNITDLADLMKVSEKLPPVLMREYRDQNELMAVFTRPAARSSLGLADFA
FT                   FVQDDAQVLVSLLRNAVAAREQGVNVLLYGPPGTGKTELAKVVAHAAGLDLFEVEYADR
FT                   DGNSLSGRDRYRSLQIAQVFLKGSTHSALLFDEVEDVFPPISSEAAQFMARSEQLPPAS
FT                   AANGSVSGKAWVNQILESNAVPTLWVTNRIEQIDPAFRRRFAYHLELRSPPPGAREGVV
FT                   RKTLEGVQVSEAFVEKLTARKGLTPAQIRTAVRFAQLASAPADTVDAQVDAEGMKAMLA
FT                   GGRPALMESLIERQLKNADVALGNPAEAAGRRSVTTYDLAMLHVESRFEVPRIVEALKS
FT                   RGHGCLCFYGAPGTGKTALAEHIAKTLDQALIIKQASDLMSKYVGETEQNMAAMFREAE
FT                   AEKAVLLLDEADSFLQDRRGAQRTYEVTEVNEMLQGMERYAGIFICTTNLMESLDQAAL
FT                   RRFTFKIKFMPLTREQREKMFVVEALGGDAALFTAALQERLGKLSQLCPGDFAAVKRQT
FT                   DILGAVFSPDEFMSQLEAEHRIKPEVRESRNMGFLH"
FT   gene            complement(181644..182348)
FT                   /locus_tag="Bpro_0167"
FT   CDS_pept        complement(181644..182348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0167"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42132"
FT                   /db_xref="GOA:Q12H60"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H60"
FT                   /protein_id="ABE42132.1"
FT                   /translation="MNFKHRTVMVTGAAGNLGQAVAAAFSAQGAQLVLLDRQLDALHRA
FT                   YGTAGTDRLLVATDLLDAAQVAAAQAAALARFGRIDVLCNLAGGFRMGEAVHATSDSTW
FT                   DFLLDINARTLLNMARSVVPHMLAHGGGKIVNVGAFAAQKGVAHMGAYCASKSSVIRLT
FT                   EAMAAELREQHINVNCVLPTILDTPENRAAMPDADPARWVSTQDLAQVIMFLASDAARA
FT                   VHGAALPVTGLS"
FT   sig_peptide     complement(182280..182348)
FT                   /locus_tag="Bpro_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.579 at
FT                   residue 23"
FT   gene            complement(182345..183244)
FT                   /locus_tag="Bpro_0168"
FT   CDS_pept        complement(182345..183244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0168"
FT                   /product="Phenylalanine 4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42133"
FT                   /db_xref="GOA:Q12H59"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H59"
FT                   /protein_id="ABE42133.1"
FT                   /translation="MQTLPDTSSKHGLAAGDTAQPERADWTMDQGWEHYSAEEHGIWKT
FT                   LFERQRRLLPGRACDAFVEGMARLPIGADQIPDFRRLSDTLMQRTGWQVVAVPGLVPDD
FT                   VFFEHLANRRFPAGQFIRGRHQLDYLEEPDVFHDVFGHVPMLMNPAIADYIQAYGVGGL
FT                   RAQKLGVLDKLARVYWYTVEFGLVQQQDGLRIYGAGIASSAAESVFALDDASPNRLGFE
FT                   LERVMRTQYRIDDFQESYFVIDDLDELLALAKIDFAASYARVQDQPDHTPGTVLPTDRM
FT                   FTRGSGHYHHAKRQGAAA"
FT   gene            complement(183255..183566)
FT                   /locus_tag="Bpro_0169"
FT   CDS_pept        complement(183255..183566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0169"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42134"
FT                   /db_xref="GOA:Q12H58"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H58"
FT                   /protein_id="ABE42134.1"
FT                   /translation="MHKLAPPEIQQLRAALPDWQFSEARGGLISREFSFADFVQAFGFM
FT                   AQVALVAEKLNHHPEWSNVYNRVAITLTTHDVQGLSTNDVDLAQQVDAIYAPLNTPRA"
FT   gene            complement(184025..185926)
FT                   /locus_tag="Bpro_0170"
FT   CDS_pept        complement(184025..185926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0170"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42135"
FT                   /db_xref="GOA:Q12H57"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H57"
FT                   /protein_id="ABE42135.1"
FT                   /translation="MSSSPVSSSRSLSRPTPLDILGQVFGYSEFRGPQEAIVEHVVQGG
FT                   DALVLMPTGGGKSLCYQIPAIVRQNAGHGVTVVISPLIALMHDQVGALHEAGVSAAFLN
FT                   STQSFEESSQLEKQLLRNELTLLYAAPERINTPRMKGLLASLHERGLLSLFAIDEAHCV
FT                   SQWGHDFRPEYRSLSLLHETFPDVPRIALTATADALTRQDMIERLKLEDAREFVSSFDR
FT                   PNIRYTIVEKADPTRQLLRFIESEHEGEAGIVYCQSRKRVEEIAATLQDAGLKALAYHA
FT                   GLDASLRQQRQDRFLREDGVVMVATIAFGMGIDKPDVRFVAHLDMPKNIEGYYQETGRA
FT                   GRDGLPANAWMAYGLQDVVNQRRMIDTSDAASEEFKQVMRGKLDALLSLAEDTRCRRVS
FT                   LLHYFDEESQPCGNCDNCLSPPAVWDATEAARKMLSCIYRVQQASGISFGAGHIMDILR
FT                   GKATEKVAQYGHDKLSTFGIGTDLAEAQWRSVLRQLIAKNMVRVDTEAFSTLQLLPDAR
FT                   QVLKGEVSVVLREQALGGKADRRKRVTKTSVKGLAEAALNAGALERLASLKAWRAEVAR
FT                   EHNLPAFVIFHDATLRAIAERAPQRLHDLEGISGIGAKKLEAYGAEVLRVCVAPAAG"
FT   gene            complement(186019..186456)
FT                   /locus_tag="Bpro_0171"
FT   CDS_pept        complement(186019..186456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0171"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42136"
FT                   /db_xref="GOA:Q12H56"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H56"
FT                   /protein_id="ABE42136.1"
FT                   /translation="MGAPSATIAGIDPPHMKNLQPKEAWTWLQAHPDTLFVDVRMEIES
FT                   LYVGRPPGVVHVPWYEYPDLQPDPQKFAEAVVREATGKTQPVLLICRSGKRTLDAGKAL
FT                   EAAGFSDVQHVVHGFEGELDEQFRRSTLSGWRFDGLPWEQM"
FT   gene            186740..187786
FT                   /locus_tag="Bpro_0172"
FT   CDS_pept        186740..187786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0172"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42137"
FT                   /db_xref="GOA:Q12H55"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H55"
FT                   /protein_id="ABE42137.1"
FT                   /translation="MKPLNYTRGQQLPAILEQRIAILDGAMGTMIQRFKLNEAQYRGER
FT                   FKDFHKDVKGNNELLSLTRPDVIRDIHEGYLAAGADMIETNTFGATTVAQADYDMADLA
FT                   VEMNYESARIARAACDKFSTPDKPRFVVGALGPTPKTASISPDVNDPGARNTSFEELRK
FT                   AYYEQTEALVKGGSDVLLVETIFDTLNAKAALFAIDEYFDNSGECLPLIISGTVTDASG
FT                   RILSGQTVTAFWHSVRHARPLAIGLNCALGATLMRPYIQELARVAGDTFISCYPNAGLP
FT                   NPMSDTGFDETPDVTSRLLREFADEGLVNIVGGCCGTTPEHIQAIAHAVAPLPSRAVAS
FT                   RFFYREAA"
FT   gene            complement(187851..188486)
FT                   /locus_tag="Bpro_0173"
FT   CDS_pept        complement(187851..188486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0173"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42138"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H54"
FT                   /protein_id="ABE42138.1"
FT                   /translation="MLCNKSGKSMFEYLFGDKKKLAPGPPELMRPEERRRAIEGSSTAE
FT                   LAARLLIAPTALMQLTPEEALTVVSYMIPQKIAAGTTFITEGDKSDTGYMLLVVEGEVT
FT                   VESILVSRRTPVTVSVLGPGSLVGEMGLVDGRARLASCTASTDVRCAVLSRAALGTLSV
FT                   DDPRTAAKLMFAVSLRIAERLRDATEKLKKYSQLTQAMQQEIDHLLPD"
FT   gene            188631..191465
FT                   /locus_tag="Bpro_0174"
FT   CDS_pept        188631..191465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0174"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42139"
FT                   /db_xref="GOA:Q12H53"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H53"
FT                   /protein_id="ABE42139.1"
FT                   /translation="MSEIQDPIAVPPMKLSGLEPVAIGEGTLFVNIGERTNVTGSKAFA
FT                   RMILNGEYEQALAVARQQVENGAQIIDINMDEAMLDSQAAMVRFLNLIAGEPDIARVPI
FT                   MIDSSKWSVIEAGLRCIQGKGIVNSISMKEGVEPFKHQAKLLKRYGAAAVVMAFDEQGQ
FT                   ADTYQRKIEICERAYRVLVDEVGFPPEDIIFDPNIFAIATGIEEHNNYAVDFINATRWI
FT                   KANLPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGMVGVYDDL
FT                   EPTLRERVEDVVLNRQPVYKPGEPELTPSERLIEVAESAKSGARDDSKKNEWRALPVRE
FT                   RLSHALVLGMNEFITEDTEEMWQAIKAEGGRPLHVIEGPLMDGMNVVGDLFGQGKMFLP
FT                   QVVKSARVMKQAVAHLLPYIEAEKLLLEAAGGDVKTKGKIIIATVKGDVHDIGKNIVTV
FT                   VLQCNNFEVVNMGVMVPCHEILARAKVEGADIVGLSGLITPSLEEMQYVASEMQKDEHF
FT                   RIKKIPLLIGGATTSRVHTAVKISPHYEGPVVYVPDASRSVSVAQSLLSDQAARYIDEL
FT                   KADYEKVRTQHANKKQVPMWPLAKARANKTPLDWTSYTPPVPKFIGRRVFKNFDLAELA
FT                   RHIDWGPFFQTWDLAGPFPAILKDEVVGTEAVRVYADAQRLLKRLIEGRWLTASGVIGL
FT                   YPANSVGDDIEIYTDETRSEVAMTWYGLRQQAEKTAVPGDDGKNHMRPSRCLSDFVAPK
FT                   VLPAEARAVRAGHAGQEGHNTFMLPDYIGLFAVTAGIGAEKKEKYFLDDNDDYSSIMLK
FT                   ALADRLAEAFAEAMHLRVRKDLWGYAAGESLTTEELIAEKYQGIRPAPGYPACPDHSVK
FT                   KDMFALLKADEIGMALTESLAMTPAASVSGFYLSHPESTYFNVGKIGDDQLQDLARRRG
FT                   AKAEELQRLLAPNL"
FT   gene            191691..192515
FT                   /locus_tag="Bpro_0175"
FT   CDS_pept        191691..192515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0175"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42140"
FT                   /db_xref="GOA:Q12H52"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H52"
FT                   /protein_id="ABE42140.1"
FT                   /translation="MNTSVDNLQPGQQAASSGSKPLWAAIGILGVAVLAMGATMLYNQR
FT                   AQPPAASVAAVTMPQAPAAPQLAGPAPSANAVDDLIEKPVATPAKPAAAPAPAKKVVKP
FT                   QPRPVPTQAPSYSGVSPAPSAVPAPAMAAAPTVCAVCGSVESVTPVERSAKPAGPGVGA
FT                   VAGGVLGAVLGNQVGHGGGRTAATILGAVGGGFAGNAIEGQIRKETVYQVGVRMEDGSR
FT                   RTVEVARAPAVGSRVTVDGAVLRTSDGATYGPKPPPAPVAAQPAPAPEYQGR"
FT   gene            192758..193033
FT                   /locus_tag="Bpro_0176"
FT   CDS_pept        192758..193033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42141"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H51"
FT                   /protein_id="ABE42141.1"
FT                   /translation="MSGDARIDPGATEEENDIVAVWCARIRAESAFAGCLASASCMFDS
FT                   EHIESNGVGLCAIEHTEGGLAAYSPRLQKKPLPEVVFEVRPRPGVS"
FT   gene            193033..193749
FT                   /locus_tag="Bpro_0177"
FT   CDS_pept        193033..193749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0177"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42142"
FT                   /db_xref="GOA:Q12H50"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H50"
FT                   /protein_id="ABE42142.1"
FT                   /translation="MAISPDPQKNQLLAALPDAEWQRWLPQLEFVDMPLGQVLYESGGT
FT                   LSHVYFPTTAIVSLLYVMENGASAEIAVVGNEGVVGISLFMGGESTPSRAVVQSAGQGF
FT                   RLKAQLMKDEFKKTPVLHLMLRYTQALITQMAQTAVCNRHHSLDQQLCRWLLLSLDRLQ
FT                   GNELVMTQELIANMLGVRREGVTEGALKLQKAGLISYARGRISVLDRQGLEQRTCECYA
FT                   VVKKEYDRLLPQRLAA"
FT   gene            193979..194692
FT                   /locus_tag="Bpro_0178"
FT   CDS_pept        193979..194692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0178"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42143"
FT                   /db_xref="GOA:Q12H49"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H49"
FT                   /protein_id="ABE42143.1"
FT                   /translation="MATVQNHLIERLPRKDRVRLLAICEPVQLALSEVLCEPGTPTRHV
FT                   YFPTEGFISLVALLDGSPGVEVGMVGREGMLGAQVALGVVTSPLHALVQGPGAAWRVDT
FT                   GAFRKELAASAALQRGLNRYLYVLMAQQAASAACLRFHLIGPRLARWLLMTQDRAHSDS
FT                   FHVTQAFLAYMLGVRRVGVTAAAGALQRSGLIEYHRGDFRVLDRSGLEAAACGCYAAGR
FT                   QSYAELLDGPSPVAP"
FT   gene            194929..195417
FT                   /locus_tag="Bpro_0179"
FT   CDS_pept        194929..195417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42144"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H48"
FT                   /protein_id="ABE42144.1"
FT                   /translation="MIRTKPDWPDWMPGAANLASAMPIFGGLWPDSRSRYAGLAIPTNI
FT                   SFSRARRKAADTDTGDAVPVPAASASLPGRLCEIANGDWDAMFRAVESRLRQTVGERLA
FT                   VIAEPQPQDAAGRVQAVVLECVEALEQLHTALMLERDRCGQLERELAILTGSAARPLL"
FT   gene            195482..196039
FT                   /locus_tag="Bpro_0180"
FT   CDS_pept        195482..196039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42145"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H47"
FT                   /protein_id="ABE42145.1"
FT                   /translation="MGTSIEPVTPAPDEKKAGLAGDRDFAAVRAGCQATGGAVRESDLA
FT                   GWLEKRQRGDAVSLAKLIISGNIFGFEWQGNFWVPMFQFDFRDLSIRQAPRMVRAELEG
FT                   VFDGWALAVWFVQPCVWLNGRSPLHLLEADLPAVLEAARSERLVATGWTGKPGASFATA
FT                   LRGRSHHAPAASAEAAGPGTGE"
FT   gene            complement(196113..197684)
FT                   /locus_tag="Bpro_0181"
FT   CDS_pept        complement(196113..197684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0181"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42146"
FT                   /db_xref="GOA:Q12H46"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H46"
FT                   /protein_id="ABE42146.1"
FT                   /translation="MSLSLVHSRALLGLEARPVCVEVHLANGLPSFTLVGLAETEVKEA
FT                   RERVRSAIQNTGLEFPANKRITVNLAPADLPKDSGRFDLPIALGILAASGQLDARKLAG
FT                   YEFAGELSLGGDLRPVRGALAMSLALAHLANDGAMPRDKPGMPARQPKLVLPEGSAQEA
FT                   ALVPDAEIYRAHHLLDVVRQFLPGDTPPEVLDGWTRIAPIPRREQADYPDLADVKGQAA
FT                   ARRALEIAAAGGHSVLMMGAPGSGKSMLAQRFAGLLPAMTTEEALESAAVASLGGRFAL
FT                   ENWAVRPTCAPHHTASAVALVGGGSPPRPGEISLAHRGVLFLDELPEFPRAALEALREP
FT                   LESGTITISRAAQRAEFPARFQLVAAMNPCPCGYLGSSLRACRCSPDQVSRYQGKLSGP
FT                   LLDRIDLHVEVGALAADELVNTPPGEASASIRGRVVQARERAIARQGSTNQALEGQAID
FT                   AQCQLDDAAAKFLNTAATRLGWSGRSIHRCLKVARTIADLAGAATVQVTHVAEAVQYRR
FT                   ALKAAH"
FT   gene            197881..198678
FT                   /locus_tag="Bpro_0182"
FT   CDS_pept        197881..198678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42147"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H45"
FT                   /protein_id="ABE42147.1"
FT                   /translation="MKLIPVQAALAASLLVSGAVFAQTPAPAAEPSPLSFNISLTSNYK
FT                   FRGQDQDYSKTRSFKPALQGGVDYAFSNGFYVGNWNSTINWTKYLPSGDDSKIEIDVYG
FT                   GYKFKAGAVDLDVGALTYYYPGASGANTTEVYLGAAYGPVSAKYFHTVSKGYFGLGKEY
FT                   LVGEGRGTGYLNLAFAQEVMPKVTFKASLGFTDLKSAANSAGLPDYMDYSVGASYDLGS
FT                   GLALAGAVVGGNKKNSYLYPASVDTSGKSINKGTLVVTLTKTL"
FT   sig_peptide     197881..197949
FT                   /locus_tag="Bpro_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            198738..199076
FT                   /locus_tag="Bpro_0183"
FT   CDS_pept        198738..199076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0183"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42148"
FT                   /db_xref="GOA:Q12H44"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H44"
FT                   /protein_id="ABE42148.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSGIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDLVDRVIEAVEGAARTGKIGDGKVFVYNLEQVVRIRT
FT                   GETGKEAL"
FT   gene            199113..200660
FT                   /locus_tag="Bpro_0184"
FT   CDS_pept        199113..200660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0184"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42149"
FT                   /db_xref="GOA:Q12H43"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H43"
FT                   /protein_id="ABE42149.1"
FT                   /translation="MKKFLASLVLGLSLLGTGAAVMAQAPAAAPAASAAEAKPAEAAAP
FT                   AAPAAAAAPAAAAAAPAASAAAAPAPVPNKGDTAWMMVSTLLVIMMTVPGLALFYGGLV
FT                   RSKNMLSVLMQVMVTFSMIVVLWFIYGYSLAFTEGNAFFGGFDRLFMKGVWDNAAGTFA
FT                   NAATFSKGVVIPEIVFAAFQATFAGITCTLIVGAFAERIKFSAVLLFMAIWFTFSYAPI
FT                   AHMVWFWMGPDAYTGKEVVDAMTGKAGYIWQMGALDFAGGTVVHINAAVAGLVGAFVIG
FT                   KRIGYGKESMAPHSLTLTMVGSALLWVGWFGFNAGSALEANGFAALAFINTLGATAAAV
FT                   LAWCVGESLMRGKASMLGAASGAVAGLVAITPAAGNVGIGGGLVIGLAAGFACLWGVNG
FT                   LKKLLGADDSLDVFGVHGIGGILGALLTGVFNSPSLGGPGYVADWTTATMVTAADFSVV
FT                   SQLWIQAKAVLITIVWSGVVSFIAYKIVDLTIGLRVSEEDEREGLDITAHGETAYNR"
FT   sig_peptide     199113..199184
FT                   /locus_tag="Bpro_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.663 at
FT                   residue 24"
FT   gene            201021..204065
FT                   /locus_tag="Bpro_0185"
FT   CDS_pept        201021..204065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0185"
FT                   /product="glycosyl transferase, family 51"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42150"
FT                   /db_xref="GOA:Q12H42"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H42"
FT                   /protein_id="ABE42150.1"
FT                   /translation="MTRVPEKWLSFFRWFGTAWAFSLLMALVVLGLVVDRELSTSSYQA
FT                   RFFAHLASKASYALGEGPSPSIRFPRSGPYDDRLGYTELPAFLGKLTGRGFEITQQARL
FT                   SEGMVRLVDAGYFAPYPEKTQSGLSIFDCHNDSLFQERYPQRVYKSFDDIAPVLVQSLL
FT                   FIENRELLDPDNPKRNPAVEWDRLANAVLNNALTTITGNGRSPGGSTLATQIEKYRHSS
FT                   EGRTSSAREKLQQMVSASLRAYQQGEDTRAARRQIVLSYINTMPLSAKAGFGEVHGLGD
FT                   GLWVWYGREFDDVNRLLKDVDENGGDLSEPGQLYRQALSLMIAQRRPSHYFETSETELE
FT                   QLTDSHLRVLGGAGVIPPALRDAALRASLNRRADKVPAEVASFVAQKAANTVRTHLAGL
FT                   LGGSRLYDLDRLDLGVASTLDAPVQRAVTRVLRELRDPASAKAAGLQGKQLLDRGDPAK
FT                   VVYSFTLYERGRDVNYLRVQTDNFDQPLNINEGTKLDLGSTAKLRTLVTYLDIMARLHQ
FT                   RLAMLDSTQLRALEVDKKDILTRWAVDYFLTAKDKRLAPMLEAALERRYSASTGEGFFT
FT                   GGGLHYFENFKPEDNGKVMSVRDGLRNSVNLVFIRLMRDIVHHYMFLTPGSSARLLQDV
FT                   DDPRRAVYLARFADQEGQVFMRRFLVKYRRKTAQEAEDLLVGGVRPTPSRLAAIFRTIA
FT                   PDASMDQFIAFVKRHRTPAIDPADDRLIKLYQQFAPGQMSLADRGYVAGVHPLELWLVG
FT                   YLRGHPGASQSQVMQDSHAERQAVYSWLFSSRRKQAQDKRILGLLEGEGFVEIHRQWAL
FT                   TGYPFDTLVPSYATAIGASADRPAALAELMGILVNDGLRKPAMRIQSLHFAAATPYESV
FT                   LQYKPGSPERVLAPEVAQAVRGALRLVVENGTAQRVKRAFVRADGSIMPVGGKTGTGDQ
FT                   RFDVYGGGGRLITSRVVNRSATFVFNVDERFFGTIIAYVPGAQAAAYDFTSGLPVQLLK
FT                   VLAPKLMPLMSAAADDDVSPGACVH"
FT   sig_peptide     201021..201116
FT                   /locus_tag="Bpro_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.850) with cleavage site probability 0.822 at
FT                   residue 32"
FT   gene            204157..205092
FT                   /locus_tag="Bpro_0186"
FT   CDS_pept        204157..205092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0186"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42151"
FT                   /db_xref="GOA:Q12H41"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H41"
FT                   /protein_id="ABE42151.1"
FT                   /translation="MTWQTLVAPLSELGESPFWHPEEQSLYWVDIPGRQIHRCKVGDVS
FT                   NGPVQSWAMPTEPGSIAPARTGGRASGLVIALRDGIYRARQWGGELEQLVRAGHDTATT
FT                   RFNDGKADPVGRFWAGTMYEPRDARQAQLFSVDCREGRAPLVELKAGDAIIANGLAWSP
FT                   DAATVYWTDTPSHTIRAWDWDGQSNVMSRGRVFRQWPGKPEGWQPGMPGYGGRPDGAAV
FT                   DVEGNYYVAMFEGGRLLKLSPAGELLADIAVPARCPTMPCFGGADLRTLYLTTARYKRP
FT                   DEELQTWPDSGCVFSMRVDVPGLPVNFFRD"
FT   gene            205200..206306
FT                   /locus_tag="Bpro_0187"
FT   CDS_pept        205200..206306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0187"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42152"
FT                   /db_xref="GOA:Q12H40"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H40"
FT                   /protein_id="ABE42152.1"
FT                   /translation="MASDIADTEVTASLAARVRDAAASGTPLRIRGGGSKDFYGQALQG
FT                   EVLDMTVLTGVVSYEPSELVVTVRAGTPLAELEALLAAQGQCLPFEPPHFGGAGARATV
FT                   GGMVACGLNGPARSSVGAVRDYMLGVVLLNGKGERLIFGGQVMKNVAGYDVSRLMAGSL
FT                   GTLGVLLEVSLKVLPVAPQEATLVFDMDEAASLRQLNRWGGLPLPVNASCWHGGQLWVR
FT                   LRGAKAAVAAAQKTMGGDLVDEPSLKLWAALREQTLPFFELQDGESLWRLSVPDTAAPL
FT                   PLGATLLEWGGAQRWVKRSGGHPAGDVQAIRDAALAACGHATLFRSANKTVPVFSPLKA
FT                   PLDRIHRDLKKQFDPAGIFNPGRMFADW"
FT   gene            206519..207751
FT                   /locus_tag="Bpro_0188"
FT   CDS_pept        206519..207751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0188"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42153"
FT                   /db_xref="GOA:Q12H39"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H39"
FT                   /protein_id="ABE42153.1"
FT                   /translation="MQTNLAPEFKNTAEGQQAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGEVPTRKTQLHLDRCLTCRNCETTCPSGVQYGHLVDIGRKLVDE
FT                   RVPRPAAEGAMRWALKEGLPSPLFAPAMKLGQAVRGLLPASLKNKVPARQAAGVWPQRE
FT                   LARKVLMLEGCVQPAMMPNINAATARVLDAAGIQAVVARNAGCCGAVKFHLNDQEGGKA
FT                   EMRRNIDAWWPHVQADEGQGVEAIVMNASGCGVTVKEYGHHLQDDPAYAAKAARISELT
FT                   RDLSELLPELADRLRGRVSAPAAPMVFHPPCTLQHGQQLRGGVEKYLGELGFNVTVARN
FT                   EAHLCCGSAGTYSVLNPGIAFQLRDRKLENLNEMAPEVIVSANIGCITHLQSGTATPVR
FT                   HWVEVLDDALA"
FT   gene            complement(207800..208306)
FT                   /locus_tag="Bpro_0189"
FT   CDS_pept        complement(207800..208306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0189"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42154"
FT                   /db_xref="GOA:Q12H38"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H38"
FT                   /protein_id="ABE42154.1"
FT                   /translation="MSTEATHLEGGCTCRFVRYRMTTPPLFVHCCHCRWCQRETGASFA
FT                   LNAMIEADRVQLLQGEVEIIHTPSQSGKGQKISRCPRCHIAVWSNYAGAGDAVRFVRVG
FT                   TLDEPDRLPPDIHIYTTTKQPWVVLPPNTPAVPEYYKASQLWPQESLERRAVLLARSQQ
FT                   QQQQQ"
FT   gene            complement(208345..208830)
FT                   /locus_tag="Bpro_0190"
FT   CDS_pept        complement(208345..208830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0190"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42155"
FT                   /db_xref="GOA:Q12H37"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H37"
FT                   /protein_id="ABE42155.1"
FT                   /translation="MNTVYAFEARQINGQNIPLSEFSGKVMLIVNTASQCGFTPQFGGL
FT                   EELHKTYAGKGLAVLGFPCNQFGSQDPGSDGEIAEFCQVNYGVSFPMMSKIDVNGPAAH
FT                   PLYKWLTAEAPGLLGSKSIKWNFTKFLVGKNGQVIKRYAPTDKPAELARDIEAALAA"
FT   gene            complement(208867..209796)
FT                   /locus_tag="Bpro_0191"
FT   CDS_pept        complement(208867..209796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0191"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42156"
FT                   /db_xref="GOA:Q12H36"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H36"
FT                   /protein_id="ABE42156.1"
FT                   /translation="MPADASLGGKVPAVNDRGALLPAGALVLNAFVWGVSWWPFRELLA
FT                   YGLHPLWATVLIYGVATLSVLAWRPQAWRGLLKYPALLLLLAAAGLTNVGFNWAVTVGD
FT                   VVRVVLLFYLMPAWSVLIAWAVLGEKPTPASLFRLALALTGVVIVLKSPGAPWPVPQSA
FT                   ADWLSLMGGLCFAVTNVLLRKLGSTPSESRMLAMFGGGAVMACTAALAGMAWQIVPAPA
FT                   FQAGGVGVAVGLCVAFLASNTALQYGAARLAASTTAIVMLTEILFASGSAALLGAADFS
FT                   TRTLAGGGLIVLAALLAALAPPPQTGAK"
FT   gene            complement(209796..211076)
FT                   /locus_tag="Bpro_0192"
FT   CDS_pept        complement(209796..211076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0192"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42157"
FT                   /db_xref="GOA:Q12H35"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H35"
FT                   /protein_id="ABE42157.1"
FT                   /translation="MKRGFYTIMAAQFFSSLADNALFVAAVELLKTSGAPKWQPAALVP
FT                   MFALFYVVLAPFVGAFADARPKGQVMFVSNGIKVVGCLMMLFGSHPLLAYAIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTISSIILGVLLGGQLVGHSVSSLLLSIDLPV
FT                   INTGVDTAPEAAIAVLILLYSIAAWFNTRIPDTGVEMRPMPRNKLELLPDFWNCNAALW
FT                   RDKLGQISLATTTLFWGVSGNLRYIVLAWSAAALGYSTTQASSLVGVVAIGTAVGAILA
FT                   SMRMRLDQAATVMPLGIAMGLLVILMNFIGNVWIAAPFLILLGGLGGFLVVPMNALLQH
FT                   RGHNLMGAGRSIAVQNFNEQACILSLGAFYSLSTGMGLSAFGAITAFGMVVASFMWLIQ
FT                   RWHKSNCIKYKEQVDHLLSIARSDKFH"
FT   sig_peptide     complement(211020..211076)
FT                   /locus_tag="Bpro_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.799) with cleavage site probability 0.750 at
FT                   residue 19"
FT   gene            211279..212373
FT                   /locus_tag="Bpro_0193"
FT   CDS_pept        211279..212373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0193"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42158"
FT                   /db_xref="GOA:Q12H34"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12H34"
FT                   /protein_id="ABE42158.1"
FT                   /translation="MPRPILATIHRPALAHNLARARSAAPDARVWAVVKANAYGHGIEH
FT                   VFDGLRSADGFALLDLAEARRLRALDWRGPILLLEGCFEARDLELCSRLSLWHVIHCNE
FT                   QIDMLAAHKTQVPHRVFLKMNSGMNRLGLRPERFRAAWTRLNALPQVDEISLMTHFSDA
FT                   DGPKGIAAQLRAFDAVTHDLPGERSLSNSAGVLRHGDELAARSDWVRPGIVVYGSAPDF
FT                   PEHSAADWGLQPTMTLSSRIIGVQELAAGDTVGYGSSFTADGPLRIGVVACGYADGYPR
FT                   HCSTGTPVLVNGVRTRMVGRVSMDMITVDLTPVPDAGMGAEVTLWGRSSGGAVLPIDEV
FT                   AQTAGTVGYELMCAVAPRVPVMTE"
FT   gene            212658..213119
FT                   /locus_tag="Bpro_0194"
FT   CDS_pept        212658..213119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0194"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42159"
FT                   /db_xref="GOA:Q12H33"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H33"
FT                   /protein_id="ABE42159.1"
FT                   /translation="MPSQVTVRPIAASDFEAWLPLWAGYNKFYGRSGSTALADDITRMT
FT                   WSRFFDAYEPVHALVAESEGGLLGLVHYLFHRSTTRIAPTCYLQDLFTTESARGRGVGR
FT                   ALVEAVYEKARAAGSSRVYWQTHETNTTAMKLYDKVGERSGFLVYGKAL"
FT   gene            complement(213137..214030)
FT                   /locus_tag="Bpro_0195"
FT   CDS_pept        complement(213137..214030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0195"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42160"
FT                   /db_xref="GOA:Q12H32"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H32"
FT                   /protein_id="ABE42160.1"
FT                   /translation="MKHIGMIGASGLMGHGIARNLQAKGFDLSLTVHRNTERVADLLAA
FT                   GAKQVASPAGLGDCDAVIICVTGSPQVEQTLSGPDGVLSRALAGLIVIDTSTSEPESTR
FT                   RLAALCAERGVTLVDAPLARTPVEAELGRLNTMVGAEQAVFDKIRPVLAAYCENIFHVG
FT                   GPGAGHVIKLLNNFIGQAICTATAEAFAVGALAGINPQKLVEVISAGAVNSGLFQAMAK
FT                   TLNGDFTGLKFELDNARKDLRYYTHLAEMVNVPSLVGEAVHQSLATASALGQGKKFVPA
FT                   LVTAQEKLTGAKIAPQ"
FT   sig_peptide     complement(213959..214030)
FT                   /locus_tag="Bpro_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.847 at
FT                   residue 24"
FT   gene            complement(214125..215036)
FT                   /locus_tag="Bpro_0196"
FT   CDS_pept        complement(214125..215036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0196"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42161"
FT                   /db_xref="GOA:Q12H31"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H31"
FT                   /protein_id="ABE42161.1"
FT                   /translation="MMSGPARRAISGTAFATLLLIALMMGANHVAARIAFNDGVDVATA
FT                   VVFRSVITACVIAVILMAQRVPVNFSARHKRMLPLIGLLIGIQSLFLYSSVARLPVALA
FT                   LLAFNTYPIWTALWAWLVYRQAPERALLMAMPVILLGLALALDVFGAASGLDAAGQWAR
FT                   IGAGVAFALGAAGTFGLALVITQHEAADVDGRVRTATTMSIAGLVALSAVASQGGFHLP
FT                   QQAAGWWGLTALTLLYGTAFTIMFTVLPRLGVVGNSAIMNVEPVCALVLAWLILGQAIA
FT                   PVQVAGALLVVGAVMVLGLRKR"
FT   sig_peptide     complement(214944..215036)
FT                   /locus_tag="Bpro_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.555 at
FT                   residue 31"
FT   gene            complement(215033..216007)
FT                   /locus_tag="Bpro_0197"
FT   CDS_pept        complement(215033..216007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0197"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42162"
FT                   /db_xref="GOA:Q12H30"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H30"
FT                   /protein_id="ABE42162.1"
FT                   /translation="MKVCIYGAGAIGGWIGSGLARAGCSVSVVARGATLDALQLHGLRL
FT                   HQGGRVSSQAVASSALPADLGVQDLVVLAVKAPSLPEVVRQIAPLIGPQTTVLTAMNGV
FT                   PWWFLQGFGGALADTRLTSIDPEGALAEGIPAQHIVGCVVHASCSLDEPGQVHHHFGNK
FT                   LILGEPSGEKTARVRQLAALLEKAGFEAPVSDQIQKDIWFKLWGNMTVNPISALTGATT
FT                   DRIMDDDLVRGFISSVMLEAKEIGARIGIPIDQRPEDRHAVTLKLGAFKTSMLQDVEAG
FT                   KAVELDALVSAVRELGMLTKVPTPFTDALLGLARLHARVHGLY"
FT   gene            complement(216307..217293)
FT                   /locus_tag="Bpro_0198"
FT   CDS_pept        complement(216307..217293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0198"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42163"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H29"
FT                   /protein_id="ABE42163.1"
FT                   /translation="MNISRRQLIQSSSAAALLAGIGQQAWAQALDSTKVIAGFAPGGTA
FT                   DIVSRRVADKLHPGYAKSAVVENKTGAGGQIAVQFVKNAAPDGATMLLTPMSMLGIYPH
FT                   TYKKLPYDPVADLTPVSAAAVFDYGFAVGPMVPASVKTVPEFLAWCKANPTLANFGSPA
FT                   AGSSPHFIGALLGRAANVDLRHVAFRGTQPAVLDMIGGQIAAVSGPTGEFTQHVAAGKC
FT                   RLLSTSGPRRGKFTPNTPTLLEQGFKDMAFTEWFGFFLPAKAPQDVVQRLNSAIRAALA
FT                   SQDVIDGLAVSYLEVMPTSPAQLAAMLKADTELWGPLVKAIGFTPEG"
FT   sig_peptide     complement(217210..217293)
FT                   /locus_tag="Bpro_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(217378..217791)
FT                   /locus_tag="Bpro_0199"
FT   CDS_pept        complement(217378..217791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0199"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42164"
FT                   /db_xref="GOA:Q12H28"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H28"
FT                   /protein_id="ABE42164.1"
FT                   /translation="MPHLNIQYTANLDRAIDMNALCKTLAATLVALRGEDGVAPLFPVA
FT                   GTRVMAWPAPYFAVADGQPDRAFIYLNLRITPGRSEALKKRAGDAVLASASAHLETVFA
FT                   QHALGLTLQIDEGMPVYEGKRNNLAAHLKPAQG"
FT   gene            217927..219324
FT                   /locus_tag="Bpro_0200"
FT   CDS_pept        217927..219324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0200"
FT                   /product="DNA replication and repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42165"
FT                   /db_xref="GOA:Q12H27"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H27"
FT                   /protein_id="ABE42165.1"
FT                   /translation="MAKEKTIYTCTECGGTSPKWLGKCPHCTAWNTLIESVAENSSPVK
FT                   NRFASLAKASEVTTLSDIEATDMARTPTGHEELDRVLGGGIVDGGVVLIGGDPGIGKST
FT                   LLLQALDSLQRAGLNTLYVTGEESGAQVALRSRRLGLDGSQVKVLAEIQLEKILATLEA
FT                   TRPAIAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRYAKASGQSDGVARGRATCIVL
FT                   VGHVTKEGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTEKG
FT                   LKGVTNPSAIFLSQHSEPVPGSCVLVTLEGTRPMLVEIQALVDNGGPSPRRLSVGLDRD
FT                   RLAMLLAVLHRHAGVACMDQDVFVNAVGGVRISEPAADLSVMLAITSSLRGKPLPKGFI
FT                   AFGEVGLAGEVRPAPRGQERLKEAAKLGFSVAVVPKANAPRKPIEGLIIHAVERVEQAM
FT                   EVVRSLN"
FT   gene            219398..220192
FT                   /locus_tag="Bpro_0201"
FT   CDS_pept        219398..220192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0201"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42166"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H26"
FT                   /protein_id="ABE42166.1"
FT                   /translation="MRIAVISDIHGNLLALQAVLADIARAGVDQTVNLGDILSGPLQVA
FT                   ETADLLMASNFPTIRGNHERQLLAVLGQPAGQIDPLDSDGYAATQVSPAHVAWINALPV
FT                   SMALDSDVWLCHGTPGSDLQYWLETVVPGFEQGLGPGVRAATLDEVAERLGSVTSAVVL
FT                   CGHTHVPRLAQCGGTLVVNPGSVGLPAYDDNHPYPHVVENGAPHARYAVLEKFRQGWQV
FT                   ELRAVPYDHMAQARLAAHHQRPDWAHALATGFMPRPARPVSP"
FT   gene            220330..220764
FT                   /locus_tag="Bpro_0202"
FT   CDS_pept        220330..220764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42167"
FT                   /db_xref="GOA:Q12H25"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H25"
FT                   /protein_id="ABE42167.1"
FT                   /translation="MNFQKILVPVAGVAVVVLAYRFYGWAGVAAAATAQVMWVLLHFTR
FT                   MMQVLKRAANRPIGHVESAVMLNAKLRPGMTLMHVIAMTRSLGELKSVKDEQPEVFRWT
FT                   DGSESYVTTTFVGGKLAHHELFRPEVPDSPPVQDAPPAAP"
FT   sig_peptide     220330..220425
FT                   /locus_tag="Bpro_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.779 at
FT                   residue 32"
FT   gene            220867..221805
FT                   /locus_tag="Bpro_0203"
FT   CDS_pept        220867..221805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0203"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42168"
FT                   /db_xref="GOA:Q12H24"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H24"
FT                   /protein_id="ABE42168.1"
FT                   /translation="MSPVAPSMADRDGKIWMDGQMVDWRDAKIHVLSHTLHYGCGAFEG
FT                   VRAYNTASGTAIFRLEEHTERLFNSAKILRMKIPFSKEEVNEAQKAVVRENKLESCYLR
FT                   PLTWIGSQKLGVSPKGNQIHLMVAAWAWGAYLGEEGMKRGIRVKTSSYTRHHVNITMTQ
FT                   AKAVSNYTNSILANMEALDDGYDEALLLDASGFVSEGAGENVFVIKGGVVYTPDLSAGA
FT                   LNGITRNTVLHICKDLGLELVQKRITRDEVYISDEAFFTGTAAEVTPIRELDRIEIGAG
FT                   SRGPITEKIQSAFFDIVNGRNPKYAHWLAKV"
FT   gene            221946..222155
FT                   /locus_tag="Bpro_0204"
FT   CDS_pept        221946..222155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42169"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H23"
FT                   /protein_id="ABE42169.1"
FT                   /translation="MTTSATVELLASDLNAQGGVYCPSPKADMKIWNSHPKVYLDVGRT
FT                   GQAKCPYCGTVYKLKEGEHFGASH"
FT   gene            222249..223244
FT                   /locus_tag="Bpro_0205"
FT   CDS_pept        222249..223244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0205"
FT                   /product="Lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42170"
FT                   /db_xref="GOA:Q12H22"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H22"
FT                   /protein_id="ABE42170.1"
FT                   /translation="MSKSLIIAPQWIGDAVMTEPLLRRLHARGERITVGALPWVAPVYR
FT                   AMPQVAEVIEFPFAHGGLQFKARRALAKRIEGQFDAAYVLPNSLKSALLPFLASIPKRV
FT                   GYLGEARVGLLTHRLKNPKNKPPMVAFYSALSGEQDVAGDRPQLQMDAADVDRALAELG
FT                   LARGAYYVFAPGAEYGPAKRWPARHFSELAAKLDRPVVLLGSGKEASLCDEIAAPVNAA
FT                   EAGKCLNFAGRTSLLQALCLIAASKSTISNDSGLMHVAAALGVPQVAIFGSSSPLHTPP
FT                   LSEKAAVLWLKTDPAYQPPLDCAPCFARDCPLGHTRCLNDITADQVRQKL"
FT   gene            complement(223261..224307)
FT                   /locus_tag="Bpro_0206"
FT   CDS_pept        complement(223261..224307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0206"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42171"
FT                   /db_xref="GOA:Q12H21"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H21"
FT                   /protein_id="ABE42171.1"
FT                   /translation="MNTATSDYPRLQTRLTRQFGLQTPLVLAPMALASGGALAAACARA
FT                   GTLGLVGGGYGDLAWTQAQYTLALEGTSATGDRARLGCGFITWKLDEDASALDWVLAHP
FT                   AADKPHAIMLSFGDPRPYAARIAATGAALICQVQRMDQVPQALEAGARIIVAQGGEAGG
FT                   HGMNALNGRATMTFVPELADWLTVHAPDTLLLAAGGIADGRTLAAALVLGADGALVGSR
FT                   LWATAESLAAQVAKDLALATTGDGTARSSVFDILRRKNWPEPYDFRAIRNDLHRQWETR
FT                   VDALRADPAAARADYDEGVRSGDFSRAHATVGEAVGLIGNLAPAAEVIARMSADAVEVF
FT                   EQKQLLAQ"
FT   sig_peptide     complement(224188..224307)
FT                   /locus_tag="Bpro_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.718 at
FT                   residue 40"
FT   gene            complement(224585..225907)
FT                   /locus_tag="Bpro_0207"
FT   CDS_pept        complement(224585..225907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0207"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42172"
FT                   /db_xref="GOA:Q12H20"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H20"
FT                   /protein_id="ABE42172.1"
FT                   /translation="MWIRFTSHLYVRIWLAVVATVVVLTFLVGAAWRLSADPPQLPIRE
FT                   VLVHNAAGEVIGTAQTRPDRKLGDDLEFDVLTKDGQSLNLLLPRPKRPPGNPPWMRPPF
FT                   GFGFGWMLVLVGLAVALGAYPVMRRLTLRLEALQRGVERWGAGDLSARVNADGRDEVAF
FT                   LAERFNHAAERIETLMESHKSLLANASHELRSPLARIRMGLELMAPTLVASRASGVALP
FT                   LSSEVGANFPGGGPSENSGAPKYSPALVEEIYRSINELDQLIDEILLASRLDAKQADAE
FT                   PFETVDLTGLAAEECSRVNAELQAELGTGLGIAPSGHSLTVQGSPRLLRRLIRNLLENA
FT                   RRYSNGDISLELAQIRVGIRQLAVVRVHDRGPGVPAGQRERIFEPFYRLPGASEREGGV
FT                   GLGLALVKSISLRHGGSVRCEARPGGGASFIVELPAASQRA"
FT   sig_peptide     complement(225815..225907)
FT                   /locus_tag="Bpro_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.660 at
FT                   residue 31"
FT   gene            complement(225919..226641)
FT                   /locus_tag="Bpro_0208"
FT   CDS_pept        complement(225919..226641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0208"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42173"
FT                   /db_xref="GOA:Q12H19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H19"
FT                   /protein_id="ABE42173.1"
FT                   /translation="MTQQLLMIEDDSRLAAMVGEYLRQSGYGFTHAADGASGLAALQAS
FT                   PPDLVILDLMLPDMDGLEVCRRIKSQGSESAHTAVLMLTAKGDPMDRIIGLEIGADDYL
FT                   PKPFEPRELLARIRAVLRRGGEANGAGGAAAGGHKVMRFGSLEIDRDARTVSISGNLCE
FT                   LTSYQFDLLVALAERAGRVLSRDQIMEAVRGRELEAFDRSIDVHMGRIRSAIEADPKDP
FT                   KRILTVRGVGYVFAKQQD"
FT   gene            complement(226839..228239)
FT                   /locus_tag="Bpro_0209"
FT   CDS_pept        complement(226839..228239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42174"
FT                   /db_xref="GOA:Q12H18"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H18"
FT                   /protein_id="ABE42174.1"
FT                   /translation="MPMSDKTPTSRLPLAPAVLASSAPTAQPKKIAWRDVWRVYTEAAT
FT                   LRMLLLGFSAGLPLLLVFGTLSFWLREAGIDRTTIGYLSWVGLAYGFKWVWAPLVDRLP
FT                   IPLLTRLLGRRRSWLLLAQATIITALVGMALTDPRLALEPVVWCALAVAFGSATQDIAL
FT                   DAYRIESADTPRQAALAAAYQTGYRIAMIWAGAGALWIAARAEVTGGAVYQQGAWQAAY
FT                   LAMAASMLLGVATVLLSPEPVALVLKPSRNAAEWLKGALIEPFADFLRRYGKHALLILA
FT                   LIAVYRISDVVMGIMANPFYVDMGYTKDEVAAVTKIYGVIMTLAGAFVGGALAMRFGVM
FT                   RVLMLGAILSAGSNLMFAWLGTRGHDVNALIFVISADNLSSGIASAAFIAYLSSLTNIN
FT                   YSATQYALFSSMMLLLPKFLAGYSGKYVDTFGYGHFFTASALLGVPVLLLITLASRLQA
FT                   PPAPSATP"
FT   sig_peptide     complement(228159..228239)
FT                   /locus_tag="Bpro_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.969 at
FT                   residue 27"
FT   gene            228265..229107
FT                   /locus_tag="Bpro_0210"
FT   CDS_pept        228265..229107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0210"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42175"
FT                   /db_xref="GOA:Q12H17"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H17"
FT                   /protein_id="ABE42175.1"
FT                   /translation="MCFLCDAEHGAWPGRRAFLLAAAGAAAAAVAAPSAAQVDVGASSG
FT                   LRKLVAADELEGAATQEYAKLIAEARSKGALAPADHPQLRRLRAIAARLVPHTAQWNDR
FT                   AREWRWEVNLIGSKQINAFCMPGGKIAFYTGILDQLKLTDDEAAMVMGHEMAHALREHA
FT                   RARIAKSQGTGTLLSLGAQLLGLGQIGDMAASIGTQLLTLRFSREDETDADLVGLEVAA
FT                   RGGYNPQAAVSLWEKMGQAGGGASGPSFLSTHPSGPARIQQLQANVPKVQGLYQRARS"
FT   sig_peptide     228265..228375
FT                   /locus_tag="Bpro_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.422 at
FT                   residue 37"
FT   gene            229234..230439
FT                   /locus_tag="Bpro_0211"
FT   CDS_pept        229234..230439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0211"
FT                   /product="CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42176"
FT                   /db_xref="GOA:Q12H16"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H16"
FT                   /protein_id="ABE42176.1"
FT                   /translation="MSSSSPLPLRPEARPAKEGVPTVFGRTWLALRPARPGISLRECLR
FT                   LVIGALVGIFLTALLCRLAGATSALPWLVAPLGASAVLVFAMPAGPMAQPWAVVGGNTL
FT                   SALVGIAGVHGVHLLGSPELAAALAVATAIAAMLALRCLHPPGGATALMMVLGGIGDPS
FT                   FALYPVLLNSLLLVLAGMAYNHATGKPYPHRQLPPAGASGAARAVDSDLDADLDAVLAR
FT                   YNQVLDVSRDDLKSLLAETQLRAYDRKLAELRCADVMSRELVTVQFGTPLQEAWALLRS
FT                   RRIKALPVVDRAFRIAGIITVADFMRAAELDVYEGFEDKLRTLVRTTRSVYASKPEVVG
FT                   QIMTRNVRVAGMQRRLLDLIPLFGSTGHHHIPILGEGERLVGMITQSDLVAALGRAADP
FT                   TV"
FT   gene            230725..233586
FT                   /locus_tag="Bpro_0212"
FT   CDS_pept        230725..233586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0212"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42177"
FT                   /db_xref="GOA:Q12H15"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H15"
FT                   /protein_id="ABE42177.1"
FT                   /translation="MRSTPFLVKIKLALGIGLILVAAVGMASYLTINRLIESAQARVRT
FT                   EDTLVLLGRIASSLKSAESLGRQYLLSGSAADLQNLEAARAALREAIGRVRSANLLPDQ
FT                   PELDELIGQRRTVTNQVVAARQTEGQAAAVAILNSDANRQLRQRTDSLLETARNRENLA
FT                   WQRAQADAERSAQRVQHFIIAAGLLFLAMLAWMVYVVTHYEEVRKRAEAKLRDSETMTR
FT                   MITESMADAVITTTDDDIVLQANAAALQLFGYEKSELIGRDVSELVPERLRGQYKSFTA
FT                   ALRARPEPFRMADHDVRSMRKDGTEFPASVSFSDVHVGGQRLFTALISDNTERRRITEA
FT                   LRASESQLRQITDTVPALIAYLDLEQRFRFHNRAYEEVLGLEFERIDGHTLAEVLGPQL
FT                   YEGVQDKVDEALRGYAVQYERVQVTPQGDRKNYAMQYFPRYGEGADEGKVVGFFSLGTD
FT                   ITELKRIDRMKTEFVSTVSHELRTPLTSIRGSLGLISGGVAGELPEAVKSLVAIATSNC
FT                   ERLIRLINDMLDSEKIESGKLRLNLQAAELKPLLRQALAANEGFAAQHGVKLRLRAPDA
FT                   ALQARIDGDRLMQVMTNLLSNAVKFSPAGSTVEVMLSRTARQVRVEVSDQGPGIPEAFR
FT                   NRIFQKFSQADSSDTRQKGGSGLGLNISRGLIESMGGRIGFNSNGGAGTTFFFELPEWR
FT                   DPAQLLQLVKARSASSRPRILICEDDPDVAQLISLMLGKAGFDADLARKDYDAMTVDLK
FT                   LPGQNGLAFIGALRREERTRHLPVVVISAMAGEGKLQLKRKPLAVSDWLEKPIDENQLT
FT                   LSVRRAVAGLKNRKPRILHVEDDLDIQHIAAAIAENFATFEFAATLDEARARLREQRFD
FT                   LVLLDLTLGSDSGWDLFEDIDALDPRPPVILFSSSDVDPEDSQMAEAVLVKAHTSNTEL
FT                   LNTIQRILQIPGDPGPTRPQPLI"
FT   sig_peptide     230725..230808
FT                   /locus_tag="Bpro_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.951 at
FT                   residue 28"
FT   gene            233589..233975
FT                   /locus_tag="Bpro_0213"
FT   CDS_pept        233589..233975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0213"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42178"
FT                   /db_xref="GOA:Q12H14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H14"
FT                   /protein_id="ABE42178.1"
FT                   /translation="MPAPLQRILYVEDEPDIRVVAKMALEAVGKFTVIPCASGQEALSV
FT                   APGAAADLLLLDVMMPGMDGPSTLKALRAMPATAGTPVIFMTAKVQASEIAAYKALGAL
FT                   DVIPKPFDPMELSAQIQQIWAARG"
FT   gene            complement(234130..234804)
FT                   /locus_tag="Bpro_0214"
FT   CDS_pept        complement(234130..234804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0214"
FT                   /product="TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42179"
FT                   /db_xref="GOA:Q12H13"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H13"
FT                   /protein_id="ABE42179.1"
FT                   /translation="MLDKTFPPKSDSVMVIGLGRFGTGVAQALVTLGHDVLAIDSSAET
FT                   VQRLASTLPHVVQADATHTETLKQLGAQDFAHAVVSIGSDLESSVLTVLNLSQIGIKDI
FT                   WAKANSQQHGRIAERVGAHHVVYPEADMGARVAHLVTGKMIDFIEFDDGFAIAKTHAPR
FT                   ETHDKPLSQSQVRSRHGVTIVGIKRRHQDFIYARPETEIQPGDLLIVAGSTDMVERFAG
FT                   RF"
FT   gene            complement(234794..236125)
FT                   /locus_tag="Bpro_0215"
FT   CDS_pept        complement(234794..236125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0215"
FT                   /product="cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42180"
FT                   /db_xref="GOA:Q12H12"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H12"
FT                   /protein_id="ABE42180.1"
FT                   /translation="MNRHFFQPASVLVLSFLAVISIGTLLLMLPLAHAEGAGASALTAL
FT                   FTATSAVCVTGLVVVDTGTYWSGFGQGVILALFQLGGFGMMTSATLLGLLVNRQLRLRS
FT                   RLLLQAETHSLGLGDVKSIARLVLIVTVVVELGTALLLTLRFALGHAMPWGEAAWHGLF
FT                   HAVSAYNNAGFSTWSDSVMGFAGDAWVLGPLMMGIVIGGLGFPVLHELMLERGRRRHRS
FT                   MHTVLTLWGSAALVLAGSLVIYLAEMNNPRTLGPLGWTDQALRALFSAVSARTAGFNAV
FT                   DVGQLSPESLMLHYALMFIGGGSAGTAGGVKITTFFVLLLVVWNEVRGHQDVEFRGRRI
FT                   ATAVQRQALTILVLSVAVIVLAMLVLLPMTNLPLDKVLFEVISAFATVGLSTGITAELP
FT                   PAGQLVLVVLMFTGRVGVVTLAASMAMNHARRDFRYPEEKPIVG"
FT   sig_peptide     complement(236021..236125)
FT                   /locus_tag="Bpro_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            complement(236221..237270)
FT                   /locus_tag="Bpro_0216"
FT   CDS_pept        complement(236221..237270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0216"
FT                   /product="exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42181"
FT                   /db_xref="GOA:Q12H11"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H11"
FT                   /protein_id="ABE42181.1"
FT                   /translation="MSLFKLTSLNLNGIRSATSKGLEDWIAQSLPDCICVQELKAQATD
FT                   VSGRFEALAGLKGYFHFAEKKGYSGVAVYTRHEPSDVIVGYGSSEFDAEGRYVELRFDR
FT                   PGRKHAPKLSIISCYFPSGSSGEERQAAKFRFLAEFYPRLLALKETRDFVLCGDVNIAH
FT                   QEIDLKNFKGNRKNSGFLPEERAWMTELLKDAELANEAADELNAPTLGTGVSSLPPKGA
FT                   ELARGGPSLHSAPTLGTGVSSLPPEGAELARGGPSLRSSVPTAGTGAAPPLGGGMVDVY
FT                   RKLQPTTTDAAYTWWSNRGQAYAKNVGWRLDYHLATPAFAALARSEHIYRAERFSDHAP
FT                   ITVDYDWSV"
FT   gene            237276..238031
FT                   /locus_tag="Bpro_0217"
FT   CDS_pept        237276..238031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0217"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42182"
FT                   /db_xref="GOA:Q12H10"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H10"
FT                   /protein_id="ABE42182.1"
FT                   /translation="MSTAGQTDKADKAQATPADTTLAQEFVQFALESGVLRFGEFKTKA
FT                   GRLSPYFFNAGLFDDGAKLGRLAQFYARHLLAEAQRSGLEFDMIFGPAYKGIPLAAAVA
FT                   VELARQGRNVPFAYNRKEAKDHGEGGTLVGAPVKGRVLIIDDVMSAGTAARESIAIIQA
FT                   AGATPHAMVLALDRQEKATENGVDVNHSAVQYVTNQLGLQVCAIARLTDLLQYLSRQGD
FT                   VSTPGASGALSLKAHYQAVLAYRERYGVE"
FT   gene            238041..238733
FT                   /locus_tag="Bpro_0218"
FT   CDS_pept        238041..238733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42183"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H09"
FT                   /protein_id="ABE42183.1"
FT                   /translation="MLLQTALTAGLVLATCLCGEAAAQSIYTCVDAKGRKITADRPIAE
FT                   CMDRTQQELTRSGRLRREVGPSLTAQERAAQEEKEKLAAEARAREVEDKRRDRALLLRY
FT                   PARSVHDQERITALAQIDEVIKAASKRTVELAGQRKAINDEFEFYVKDPAKAPPELKRR
FT                   LEENDSSAAVQKKFIADQEQEKKRVNLRFDEELVKLKQLWTLAGAAPASPASGAVGKAG
FT                   PAKAAAKN"
FT   sig_peptide     238041..238112
FT                   /locus_tag="Bpro_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.863 at
FT                   residue 24"
FT   gene            complement(238785..240287)
FT                   /locus_tag="Bpro_0219"
FT   CDS_pept        complement(238785..240287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0219"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42184"
FT                   /db_xref="GOA:Q12H08"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H08"
FT                   /protein_id="ABE42184.1"
FT                   /translation="MSNIASTPTSPLVQGYEVVIGFETHTQLTTQSKIFSRASTAFGAE
FT                   PNTQASAVDFALPGALPVMNKGAVQRAIEFGLAVNAHIAEQSVFARKNYFYPDLPKGYQ
FT                   ISQFEIPVVQGGVVEFFLDGEKKSVRLVRAHLEEDAGKSLHEDFIGMSGIDLNRAGTPL
FT                   LEIVTEPDMRSSAEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGAALGTR
FT                   REIKNLNSFKFMQQAIDYEVRWQIGQLEDGHAIQQATVLFDPDTGETRAMRTKEDAADY
FT                   RYFPDPDLPPLVIARDWVERTRAEMSELPRVMAARFVKDYGLPEYDAAQLTSSKDTAEY
FT                   FDRAMLELISEEGSEGARHGKTIANWINGEIAARMNRAGLNSIRESPITAWHIVTLVRR
FT                   IADGTISGKIAKDEIIPALWDGNLGSHDAVNTFIESKKQMSDTGELEKIIDDVLAANAK
FT                   NVEEVKAGNAKAFNALVGQAMKATKGKANPAQVNELLRKKLA"
FT   gene            complement(240284..241819)
FT                   /locus_tag="Bpro_0220"
FT   CDS_pept        complement(240284..241819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0220"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42185"
FT                   /db_xref="GOA:Q12H07"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H07"
FT                   /protein_id="ABE42185.1"
FT                   /translation="MSAPDRSTDLHDLGVAELAARLAAREVSSVEVTRHFLARIQQHEG
FT                   LGAFLATNPDVSLAQARAADARLAAGERTPLLGVPLAHKDVFVTRDFPTTAGSKMLAGY
FT                   RSPFDATVVSRLGVAPGGAGMVTLGKLNCDEFAMGSGNDNSAYQPVHNPWDTTRVPGGS
FT                   SGGSAAAVAARLVPAATGTDTGGSIRQPASLTGITGIKPTYGRCSRYGMVAFASSLDQA
FT                   GPMARSALDCALLLSAMAGPDPDRDSTSLDLPVTNYAAELAAIGSQETRSMPLKGLRIG
FT                   LPTQFFGAGCSADVLKAVRAALAEFEKLGATLVDVSLPLTELSIPVYYVIAPAEASSNL
FT                   SRFDGVRYGHRAASYSDLTDMYKKSRSEGFGDEVTRRIMIGTYVLSHGYYDAYYLKAQK
FT                   IRRLIAQDFQKAFAQCDVIAGPVSPTVAWKIGEKEDDPVANYLADIYTLSSSLAGLPGM
FT                   SIPAGLGAHGMPVGLQLIGNYFQETQLLGAAHHFQLATDWHQMKPEDKAGLPA"
FT   gene            complement(241816..242115)
FT                   /locus_tag="Bpro_0221"
FT   CDS_pept        complement(241816..242115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0221"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42186"
FT                   /db_xref="GOA:Q12H06"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12H06"
FT                   /protein_id="ABE42186.1"
FT                   /translation="MALTSQDIARVANLARLELRPEETEHTLSQLNGFFALVEQMAAVN
FT                   TDGVEPLAHPAAVIGEVALRLRDDIASEPNQREASQVSAPAVERGLFLVPKVIE"
FT   gene            242403..243446
FT                   /locus_tag="Bpro_0222"
FT   CDS_pept        242403..243446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0222"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42187"
FT                   /db_xref="GOA:Q12H05"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H05"
FT                   /protein_id="ABE42187.1"
FT                   /translation="MFEAFRRYFSTDLAIDLGTANTLIFVRDRGIVLDEPSVVAIRHEG
FT                   GPQGKKTIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIKMVHPRSL
FT                   LKPSPRIIICVPCGSTQVERRAIRESALGAGASDVYLIEEPMAAAIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNYGMLIGEPTAEAIKKS
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEILEALTDPLNNIVSAVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRL
FT                   GSIFTSE"
FT   gene            243530..244453
FT                   /locus_tag="Bpro_0223"
FT   CDS_pept        243530..244453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0223"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42188"
FT                   /db_xref="GOA:Q12H04"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H04"
FT                   /protein_id="ABE42188.1"
FT                   /translation="MPLGTLDRSPPPFFKQGPSALSKLMFFSALSLFLMVADTRFRITQ
FT                   PVRAALATALYPVQWLALQPVRAVKGGSDYFISLNQAQSSSEEARKKLALQSLRASQVE
FT                   QLSQENSRLRKLLGLREQLATPVLAAEVLYDAADPYTRKVIIDKGMAQGVDLGSPVVDE
FT                   SGVLGQVTRVHPLVSEVTLVVDRDLAIPVLNVRTGARSVAYGDPGAPGSGLELRFMGSN
FT                   SDVQQGDMLTTSGVDGVYPPGLPVATITRIERRAESAFAKIYCAPQALVTGARHVMVVK
FT                   PLSSQIPPQPEAEAPSVPAKKKGAAK"
FT   gene            244450..244968
FT                   /locus_tag="Bpro_0224"
FT   CDS_pept        244450..244968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0224"
FT                   /product="putative rod shape-determining MreD transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42189"
FT                   /db_xref="GOA:Q12H03"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H03"
FT                   /protein_id="ABE42189.1"
FT                   /translation="MIMRSGQQLLLPANPVFIWCSLIAALLLDMLPLGRVPWMPDFLAL
FT                   VLVFWNVHQPLRVGIGVAFMFGLAMDVHQSSLLGQHALSYTALSFFAAMIHRRLLWFSV
FT                   PSQAVQVLPLFAVAHGVELIIRMIGGGIFPGWIMLLAPLAEALLWPVASILLLVPQRRA
FT                   PDPDQNRPL"
FT   gene            245135..247210
FT                   /locus_tag="Bpro_0225"
FT   CDS_pept        245135..247210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0225"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42190"
FT                   /db_xref="GOA:Q12H02"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H02"
FT                   /protein_id="ABE42190.1"
FT                   /translation="MTELRNVEADLSRFRARVLVASLAVLCAFGLLAARLVYLQVFRHT
FT                   DLSEQAESNRTAIVPIVPNRGLILDRNGVVLASNYSAYTLEITPSKVANLEETIAALEK
FT                   VVDIQLRDKRRFKRLREEAKNFESLPIRTRLTDVEVARFAAQRFRFPGVDIKARLFRSY
FT                   PYGELGSHVVGYIGRINQSEKERIDEGDDQGNYRGTDYIGKLGVEQSFEKQLHGITGVE
FT                   QVETSAGGRAVRRLASNPAIPGDTVMLSIDIKLQKLVEDMFGDRRGALVALDPKTGDVL
FT                   AFVSKPTFDPNLFVDGIDAESWEALNESIDKPLLNRALRGTYPPGSTYKPFMALAALQL
FT                   GARAPGTLINDPGFYMFGGRRFGSPENEKGGIMDMHRAIVESSNVYFYSLANEIGVDAM
FT                   HDFMKPLGFGQITGIDINGEVRGVLPSQAWKRSYFKRPEQQKWFAGETISLGIGQGYNS
FT                   FTMLQLAQATAVLANNGIKYKPRLIIGTQDPVTRAMHPLPVAPPEDLGYKPENVAVIRK
FT                   GLAGVVQGGTSARVFAGAGYLSGGKTGTAQAVGAPKGSKYNSAKMEEHQRDHALYIAVA
FT                   PAEDPRIALAVIVENAGWGAGAAAPIARRAFDYLLLGQYPSEEDMAAVQKGLAAAPIGK
FT                   PRRAADIAALPVAGVPAMEAPRVEGPAAATAARTEGVVPVAGKPAASAPVAATLPR"
FT   sig_peptide     245135..245236
FT                   /locus_tag="Bpro_0225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.864) with cleavage site probability 0.829 at
FT                   residue 34"
FT   gene            complement(247236..247994)
FT                   /locus_tag="Bpro_0226"
FT   CDS_pept        complement(247236..247994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0226"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42191"
FT                   /db_xref="GOA:Q12H01"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H01"
FT                   /protein_id="ABE42191.1"
FT                   /translation="MDLLIVTFASLLAGFVDAIVGGGGLILVPALFAIFPTAHPATLFG
FT                   VNKGASVWGTAVATAQFARRVDMRWSALLPAAGAGFAASLAGAWLVTVISAGFLRKALP
FT                   LVLLGVLIYTLARKDLGRHHTPRFAGRAETAAACCIGLVLGFYDGFFGPGTGSFLVFLF
FT                   VRWLGYDFLNAAASAKLLNIATNLAALTLFAWKGHIWWHIALTMAVANVAGSLLGTRLA
FT                   LRRGADFVRSVFIVVVSALILKTAFDAFLK"
FT   gene            complement(248062..248469)
FT                   /locus_tag="Bpro_0227"
FT   CDS_pept        complement(248062..248469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42192"
FT                   /db_xref="UniProtKB/TrEMBL:Q12H00"
FT                   /protein_id="ABE42192.1"
FT                   /translation="MHLAVGFGMRCQARGAPCGQPTQASRNNAARPKLASQMCKLFPNE
FT                   PLMPCRREKADAAQNVRETPNALSQCAGYIKGLADELLLATRGAEETRRAITTQTNIPQ
FT                   RYFFVKALATPALFLWPFGPSPALLQSHEGP"
FT   gene            complement(248490..250115)
FT                   /locus_tag="Bpro_0228"
FT   CDS_pept        complement(248490..250115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0228"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42193"
FT                   /db_xref="GOA:Q12GZ9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ9"
FT                   /protein_id="ABE42193.1"
FT                   /translation="MAGDTDFQSRLRAIRAGGVGYFPAPLDVRSLLGFLGRITSDEPSR
FT                   PYRVLIIEDDESLAGFYAEVLQSAGMETAIVTDPTTVTGLLTAFRPDLITCDLYMPDCN
FT                   GMELAALIRQQEEFVRIPIVFLSTETSLDKQSQALKQGGDDFIIKPVEPANLISAVQSR
FT                   ARRYRSLLAAEDTLRISEERFRLVFESSLDGFIQTLADGTIVSANQAACHMFDMTEQDL
FT                   RRAGLAGLVDGADPRLQDMRGSPEKYRGELLCVRRGGVKFPVEISASQHLSSNGDVQGS
FT                   IIVRDITERKSAEESILRLNAELEQRVERRTAALTAANQELQAFSHSLAHDLRQPYIAI
FT                   NGLASLLEREMAAHLTARGKDYLNRIRAGVSQMNDRTDSLLSLAQLSQATTRPEKVDLA
FT                   AICTAVLATLQAKEPGRQVQTEVEAPLEADGDASLLQHLLGHLLGNAWKFTSRQASAVI
FT                   RVSSQTDVGGKTVYCVADNGAGFEMAYVDKLFGAFQRLHSPSEFSGAGIGLAMAHRIVT
FT                   RHGGRIWAESAPGQGARFYFTLGG"
FT   gene            complement(250832..252574)
FT                   /locus_tag="Bpro_0229"
FT   CDS_pept        complement(250832..252574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0229"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42194"
FT                   /db_xref="GOA:Q12GZ8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ8"
FT                   /protein_id="ABE42194.1"
FT                   /translation="MQDENQVFDYIIIGAGTAGCLLANRLSADASKRVLLIEAGRKDDY
FT                   HWIHIPVGYLHCIGNPRTDWLYNTEPDAGLNGRALRYPRGKTLGGCSSINGMIYMRGQA
FT                   RDYDRWAELTGDSAWRWDNALPHFKLHEDYYKGADAMHGARGTAPELMQDKLNPYQKLL
FT                   RHRNAGGEWRIEKQRLRWDILDAFAEAATQAGIPATPDFNRGDNEGVGYFEVNQKSGWR
FT                   WNTAKAFLRPACYGRPNFELWTNAQVCKLLIEPQPDGSQRCTGAEVWTGQGRITALATR
FT                   DSEHMGEVILCAGSIGSPQILQLSGIGPAALLQQHGIPVVQDLPGVGANLQDHLQIRSV
FT                   YKVQALEGGKRWGLSLNTMANSLWGKARIGLEYAFRQTGPMSMAPSQLGAFTRSSPAQP
FT                   YPNIEYHVQPLSLDAFGEPLHNFNAFTASVCNLNPTSRGTVHIKSGHFEDAPAIAPNYL
FT                   STAEDRQVAADSLRVTRRIVSQSALAKYRPEEFKPGVQFQTDEELTRLAGDIATTIFHP
FT                   VGTTKMGRHDDPLAVVDSHLRVRGVRGLRVVDAGVMPLITSGNTNSPTLMIAEKAAQWI
FT                   RDGE"
FT   gene            252876..254027
FT                   /locus_tag="Bpro_0230"
FT   CDS_pept        252876..254027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0230"
FT                   /product="protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42195"
FT                   /db_xref="GOA:Q12GZ7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ7"
FT                   /protein_id="ABE42195.1"
FT                   /translation="MLMEESTPRIEQQDTAEGRRFVVRGAWTASDLTGRLVWDTLTAQL
FT                   EILRRHAAPAGEASTVRWDLSGLEKLDHLGAQVLWNHWGRDWPAQLQVEPSQRAVLETV
FT                   AKFAVVPPKPRGSDWKDLLVLLGNRALDLVDHSKGLVRLVGQLLLDIIRLVRHPKEGPW
FT                   RDLSGHLYHIGATALPITALVGFLIGVVLAYLISQQLRQFGADAYIVNILGISLIRELG
FT                   PVLAAILIAGRSGSAITAQIGVMRVTEELDAMRVMGIARGFRLVMPRALALAVVMPLIS
FT                   VWTTIAALLGGMLAADISMGVTPSYFINSLPRAVDAANLTLATGKSVVFGVLIAMVGCH
FT                   YGLRVKPNTESLGQGTTASVVTSITVVILVDALFAVVFKSVGI"
FT   gene            254166..254954
FT                   /locus_tag="Bpro_0231"
FT   CDS_pept        254166..254954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0231"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42196"
FT                   /db_xref="GOA:Q12GZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ6"
FT                   /protein_id="ABE42196.1"
FT                   /translation="MTDAVVEIKKLWTVFENGDRKAVVHKDLDLTVERGEVLSLVGGSG
FT                   TGKTVLLRQMLGLETPTRGEITVLGKPAAELGKRGAARRVGMLFQQGALFSAFTVLENI
FT                   AFPLRELKTLPLDLIREAAMVKLQMVGLSPDAADKMPSDLSGGMVKRVALARALIMDPP
FT                   LLLLDEPTAGLDPDSSDSFCSLLRALHRDMELTVVMVTHDLDTLFELSSRIAVLAEQRV
FT                   IVNDVPREVVAFPHPFIHEFFLGERGQRAMELLREYPFTV"
FT   gene            254978..255910
FT                   /locus_tag="Bpro_0232"
FT   CDS_pept        254978..255910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0232"
FT                   /product="Mammalian cell entry related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42197"
FT                   /db_xref="GOA:Q12GZ5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ5"
FT                   /protein_id="ABE42197.1"
FT                   /translation="MENKAHAMAAGAFVLVVTALLVMLAVWLTRDNTQRNLYEMSTGES
FT                   VSGLQPQAAVRFRGVPVGKVELIGFDTKVKGNVLIRVSIDRSAPVTKSTFATVASQGVT
FT                   GLGFIQLDDDGSSPERLVPNDEDPPRIPLKPGGLDKLLKQSDVIFDQVEQASTRLNKLL
FT                   SDENQAAVTSAITQLGEAAGSINRVARGLEPTVATLPGLSRDATVTLKSVKTAADDVST
FT                   TATRLNAKGGTLDKLSDGGTALAAGVETFSAGTLPKLGEVADETARTMRQLRRTVNAVD
FT                   DNPQSLIFGNGPPVPGPGEAGFSANGGKK"
FT   sig_peptide     254978..255052
FT                   /locus_tag="Bpro_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.774) with cleavage site probability 0.601 at
FT                   residue 25"
FT   gene            255907..256620
FT                   /locus_tag="Bpro_0233"
FT   CDS_pept        255907..256620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0233"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42198"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ4"
FT                   /protein_id="ABE42198.1"
FT                   /translation="MRLILFKPHQDAANPTADAWRFYWVKYLFCSVAATLVLGGCSSLP
FT                   DKPTRATMYDFGPGALSLRPGTREAPLPPLAIDDIGTSGGALDNMAVLYRLGYADAQQL
FT                   RPYSQARWSMPPAQLIRQRLREQLSQRRAVFNAGESAALNRTQNAVLPQLLRLHLEEFS
FT                   HLFTAPDASVGLIRLRATLVEVTPAGEKLVAQRHVIVQRPAPSADAPGGVRALTAATDA
FT                   AIEELEQWLQQAPAH"
FT   gene            256634..257194
FT                   /locus_tag="Bpro_0234"
FT   CDS_pept        256634..257194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0234"
FT                   /product="cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42199"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ3"
FT                   /protein_id="ABE42199.1"
FT                   /translation="MKTLQEQLDAAGLHVFGCCERLSAYGPGLLQNSPLLQDFTPAEAD
FT                   ILGASMLLVRAEPGQVMIREGESGDWMMLILKGTVDVTKRVEPQGDAAAADADAPAPVS
FT                   RVAVVRSGAAVGDMSMLDSEPRYASCTAIEAVEAGVWGRHEIARLIRDHPGVGAKLLVK
FT                   ITQIMAQRLRNTSNQLVKLLQKK"
FT   gene            257516..258895
FT                   /locus_tag="Bpro_0235"
FT   CDS_pept        257516..258895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0235"
FT                   /product="Inner membrane CreD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42200"
FT                   /db_xref="GOA:Q12GZ2"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ2"
FT                   /protein_id="ABE42200.1"
FT                   /translation="MKQKFAALALVLILLVLALLKISDVVQDRQNHRQIAIQSVAQSLA
FT                   GPQTLTGPLIHMACTEEWEVRNSDRQVHSERREFLLVAAPASLTLKGSSKLEPRARGLH
FT                   ATQVFSLKADLVAEWTDTEALKPVAEHAGSRMNCGQPLLMLAVSDSRGIRHASVKVGDQ
FT                   VLALKPGTFYGSYPRGVHAPLPPAMVRFLPLQVQLGLELVGTESISVVPLGGDTRMQLT
FT                   SNWPHPSFGGQFLPVDRKITPQGFEANWRVSSLASTAQQDVAQKDAARRKGACPSYGDG
FT                   SAHGSCVEAFSVTFVDPSNTYALSDRATKYGLLFIGLTFLAVGLFEFMKSLRVHPIQYL
FT                   LVGAAMSMFFLLLVSLSEHMPFESAYVVASAACVLLLTYYASHMLGRWSRGLPFGLGIA
FT                   MLYGMLFVLLRMEQTALVLGAVALFAVLAAIMMLTRRVDWYARFTQAGHVGQAEAAKVA
FT                   G"
FT   sig_peptide     257516..257578
FT                   /locus_tag="Bpro_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.428 at
FT                   residue 21"
FT   gene            complement(258922..260319)
FT                   /locus_tag="Bpro_0236"
FT   CDS_pept        complement(258922..260319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0236"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42201"
FT                   /db_xref="GOA:Q12GZ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ1"
FT                   /protein_id="ABE42201.1"
FT                   /translation="MRLGIRLLFGFFLVTGLAAFFVLRVFMAEVKPSVREVMEDMMVDT
FT                   ANILAELASDDLSAGAIADGRFAGHVRSYARRPIDAQIWGMTKQSLDFRVYVTDINGKV
FT                   VFDSENVATGQDYSRWRDVARTLRGEYGARATREVQRDDRTSVMYVAAPVQHDGKTIGV
FT                   LTVAKPMSTIQAFIDRAERKILLSGLLLLVLSLAIGVAVTLWVVWSIRKLRHYANAVGQ
FT                   GAKPAVPQIPGELGELAMAVDAMRLKLEGHEYIEGYVRALTHELKSPLAAIRGAGELLQ
FT                   DELPENARREFAGQVLDQSARLQALVDRMLELTKLEQRHAQVQRESLLWCGFLKPFEAA
FT                   PLAGRAQHAVKLMVSPEHAGVHAEPGLLALALSNLLENARSFAPQASTITVEAGQGHVA
FT                   VQDQGPGVADYALPRLGERFFSTVRPDGHTKGSGLGLAIVRQIMLLHGGRMVVRNTHPG
FT                   LRVELHF"
FT   gene            complement(260435..261115)
FT                   /locus_tag="Bpro_0237"
FT   CDS_pept        complement(260435..261115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0237"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42202"
FT                   /db_xref="GOA:Q12GZ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GZ0"
FT                   /protein_id="ABE42202.1"
FT                   /translation="MTGARVLLVEDDPAIARSIVFALERDGINLTHSLLLSDARRQLLV
FT                   RTPDVVILDIGLPDGSGLDLCKELRAAGSMPVLILSAHGEEIDRVLGLELGADDYLSKP
FT                   FSPRELLARVRSLLRRARMPPAAPVPANGPFEIDAAGQRMRLHGRPLNLTRREFGLLAD
FT                   LLHHRGRIRSRDELLGAVWGADSDSTDRTVDTHIKTLRAKLQEAAPERDYIVTHRGMGY
FT                   CLEI"
FT   gene            complement(261474..262106)
FT                   /locus_tag="Bpro_0238"
FT   CDS_pept        complement(261474..262106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0238"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42203"
FT                   /db_xref="GOA:Q12GY9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY9"
FT                   /protein_id="ABE42203.1"
FT                   /translation="MDFKPLVTLLAIVNPLAIVPFFIHYTQDFSKPQRRRTIATASFSA
FT                   FVVIAISALAGLQILEFFSISLASFQVGGGMLLLISSMNMLNAQPAEAKPNTHEMEDGA
FT                   EKAARGASIAVVPLTIPLLTGPATMSTVVIYAEKAKTFFQLGTLVGYGVVIGLATALCF
FT                   SLAEPIARVLGKTGINVMTRLMGLILAALAVEVMADGLGKLFPVLRG"
FT   gene            complement(262271..263017)
FT                   /locus_tag="Bpro_0239"
FT   CDS_pept        complement(262271..263017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0239"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42204"
FT                   /db_xref="GOA:Q12GY8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4IQG"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY8"
FT                   /protein_id="ABE42204.1"
FT                   /translation="MSKVVLITGGSRGIGAASALLAARQGYAVAVNYASNSAAADEVVR
FT                   QIREAGGQALAVQADVAKEREVLAMFETVDAQLGRLSALVNNAGVVDQTTRVDGITLER
FT                   LQRMFEINVFGSFLCAREAVKRMSTRYGGSGGSIVNVSSAAARLGSPGQYVDYAAAKGA
FT                   IDTFTLGLAKEVATEGIRVNAVRPGIIETDIHASGGLPNRARDVAPQVPMQRAGTAREV
FT                   AEAIVWLLGDQASYTTGALLDVTGGR"
FT   sig_peptide     complement(262931..263017)
FT                   /locus_tag="Bpro_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.934) with cleavage site probability 0.382 at
FT                   residue 29"
FT   gene            263126..263731
FT                   /locus_tag="Bpro_0240"
FT   CDS_pept        263126..263731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0240"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42205"
FT                   /db_xref="GOA:Q12GY7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY7"
FT                   /protein_id="ABE42205.1"
FT                   /translation="MSISVDYYFSVQSPWTYLGHERFAQLARASGAALRVMPVDLGGKV
FT                   FPVSGGLPLGQRAPQRQAYRLLELRRFSDHLGMPLNLKPRYFPVAGDDASRLIIAVDLH
FT                   DGSDAAMKIGGAIFTAVWVRERNIADAQVLAELLAECGLSAGRLEQSRDPAVQAHYEAN
FT                   TRRAIDAGVFGAPSYVVDGELFWGQDRLDFVERKLRAG"
FT   gene            263826..264515
FT                   /locus_tag="Bpro_0241"
FT   CDS_pept        263826..264515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0241"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42206"
FT                   /db_xref="GOA:Q12GY6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY6"
FT                   /protein_id="ABE42206.1"
FT                   /translation="MGQFIELKSADGFAVPAYVAQPDGKPRAAVVVLQEIFGVNSHIRA
FT                   VADRFAAEGYLAVAPATFARVKPGVDLGYTEADMAAGFELKTAVAALPGAGVLPDIQAA
FT                   IDHAAQASGGKVGIVGFCWGGLLTWHAACMLKGLSAAVAYYGGGITAEDEIARQPLCPV
FT                   MAHFGDQDHWIPMEGIAAFTKAHPEVEVHVYAANHGFNCDQRGSYNEAAAKLARERSLA
FT                   FFAARLA"
FT   gene            264550..265542
FT                   /locus_tag="Bpro_0242"
FT   CDS_pept        264550..265542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0242"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42207"
FT                   /db_xref="GOA:Q12GY5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY5"
FT                   /protein_id="ABE42207.1"
FT                   /translation="MWLAAHVGRVCAAIALMALGAPGQAADYAGPLFDAHLHYNEEAWN
FT                   CRERSAGPPQASSAPSGGSAVREATSVGASCSGPHGPADVLARMQRNGVKAIVANSRPN
FT                   DGTKSLAAMAETRKAGVTVVPFIRLYRSRADYDNWFRDESIYEMVQAEFARGVTGDQAG
FT                   PYKGIGEFHLYDSANAKEANGPVAKKLMQFAEKNKLAVLSHVDDVAIDLLMAHAPEVRL
FT                   IWAHTGIGGPPVARVDELLARYPQLMGELSYRPGLVCDGGKLCAEWRALLLKYPGRFMI
FT                   GSDTWVNQRWLYYDDTMKGYRTWLGDLPPEVARRIAWGNAADIFGVIEK"
FT   sig_peptide     264550..264627
FT                   /locus_tag="Bpro_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.991 at
FT                   residue 26"
FT   gene            265699..266361
FT                   /locus_tag="Bpro_0243"
FT   CDS_pept        265699..266361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0243"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42208"
FT                   /db_xref="GOA:Q12GY4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY4"
FT                   /protein_id="ABE42208.1"
FT                   /translation="MIQLYYSPSSAAMAPHILLEELGVPFEKILVDTATGAHRSEAYRR
FT                   INPNGLVPALADGDLVLYESAAICLHLCDTHPQAGLVPALGTTERAHFYKWLIWLTNTL
FT                   QSTLIVYFYPERWMNEGNSAGVAELKSRAQARVGPLLDQLDAELARQQAMHSQPWLLGA
FT                   AFSAVDIYAMMLCRWTRNFASSPARERAHLGPYLQRVLARPAVIRAFAAEGLALPWV"
FT   gene            complement(266564..267679)
FT                   /locus_tag="Bpro_0244"
FT   CDS_pept        complement(266564..267679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0244"
FT                   /product="Mg2+ transporter protein, CorA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42209"
FT                   /db_xref="GOA:Q12GY3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY3"
FT                   /protein_id="ABE42209.1"
FT                   /translation="MRVFNISSGSQGIVETDALPAQLPAQGFVWIACARREFEVLQAQI
FT                   QTCLQTLCGTQLVDLHVSDLLNNQLPSHYDYTSQYDILVFRRLATGQTETDLAQPGQPL
FT                   HQSRKRGGPPILQRIDTSPVGFAVFDRVLLTVHPTDCAVREAYAQKLLNATSSESRDAG
FT                   VRLPASPADLMLRIVNHIVDGYLALRRELTRQLDHWQNELLNPHTRFNNWSALMEARLA
FT                   MHQLDEICEDQRAATQDWIDSVETWPEGSTPAAQRERELLKVRSRDVLEHIERVVHHVR
FT                   RMEQSAETAVQMHFNAQSHRTNDIMRTLTALTAIFLPLNLITGFFGMNFEFLPIIHSST
FT                   GFWWTFAVMVVIVAVVVAVFWRKRYLARTSH"
FT   gene            complement(267796..268845)
FT                   /locus_tag="Bpro_0245"
FT   CDS_pept        complement(267796..268845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0245"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42210"
FT                   /db_xref="GOA:Q12GY2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY2"
FT                   /protein_id="ABE42210.1"
FT                   /translation="MAAAKVWHNLAMTLHASNFAPFPLGRPRRLRRDSFTRNLVRENVL
FT                   SAHDLIYPVFVTDGSQRREAVASMPGVERLSLDLLLPVAEECVKLGIPVMALFPVIDGS
FT                   LKTPDGREALNPEGLVPRVVRELKKRFPELGVMTDVALDPFTSHGQDGLPDPTGYILND
FT                   ETIEVLVGQALTQAEAGVDIVAPSDMMDGRIGAIRQALEGKKLIHTRIMAYSAKYASAF
FT                   YGPFRDAVGSAGNLGKADKKVYQMDPGNSDEALREVAMDIAEGADMVMVKPGMPYLDVV
FT                   RRVKDEFQVPTFAYQVSGEYAMLKAAAQNGWLDHDAVMMESLLAFKRAGADGVLTYFAI
FT                   DAARQLRQA"
FT   gene            269262..269696
FT                   /locus_tag="Bpro_0246"
FT   CDS_pept        269262..269696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0246"
FT                   /product="conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42211"
FT                   /db_xref="GOA:Q12GY1"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY1"
FT                   /protein_id="ABE42211.1"
FT                   /translation="MLWVKSLHIVFVASWFAGLFYLPRIFVNLALVPPESVAERERLIL
FT                   MARKLMRFTTILAVPALGFGLWLYLGYGIGRGPGNAWMHAKLGVVVLALGYHHACGRLL
FT                   GKFVSNRSTRSHVWFRWFNEVPVLLLAAAVILVVVKPWQG"
FT   gene            269911..271065
FT                   /locus_tag="Bpro_0247"
FT   CDS_pept        269911..271065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0247"
FT                   /product="VanZ like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42212"
FT                   /db_xref="GOA:Q12GY0"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GY0"
FT                   /protein_id="ABE42212.1"
FT                   /translation="MARHPSSATAASAGQRTAGWPLAVVAVCLIVYASLYPFADWRDQG
FT                   ISPLRFLTAPLPRYWTGFDVGANLLGYAPLGFLLTLSVLSTLRSRRAGWAVCAAVLMAA
FT                   LLSLAMETLQSYLPSRIASNVDLALNTLGALLGACCAWVLEKTGLVNRWSRFRGRWFAQ
FT                   DASGALVLLLLWPPALLFPAAVPLGLGQVFERLESALAEALMDSPFLEWMPVRDVELQP
FT                   LVPLAELVCVALGALIPCLLGYSAIRTLWQRAAFAAAMLVIGMAASALSAALSYGPEHA
FT                   WAWLDVPVQAGVALAALLAVVLLAVPRRGAAAFALLALAIQLGLLNQAPADPYFAQTLQ
FT                   TWEQGRFIRFHGLVQWLGWLWPYATMLHVLVRLSSRERTQPAEK"
FT   sig_peptide     269911..269967
FT                   /locus_tag="Bpro_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.600) with cleavage site probability 0.518 at
FT                   residue 19"
FT   gene            271075..271449
FT                   /locus_tag="Bpro_0248"
FT   CDS_pept        271075..271449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0248"
FT                   /product="Ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42213"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GX9"
FT                   /protein_id="ABE42213.1"
FT                   /translation="MTAPISQDAVPAPAKAASYYERHIFFCLNQRPPGEDSCANHQAQE
FT                   GFDRCKSQVKAAGLAGPGKVRVNKAGCLDRCAGGPVAVVYPEAVWYSYVDAHDIDEIVE
FT                   SHLKNGQVVERLLMPAHLGR"
FT   gene            271596..272255
FT                   /locus_tag="Bpro_0249"
FT   CDS_pept        271596..272255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0249"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42214"
FT                   /db_xref="GOA:Q12GX8"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GX8"
FT                   /protein_id="ABE42214.1"
FT                   /translation="MNSHTRKSSIEGPAGALEIALDAPAGISRGMAIIAHPHPLFGGTM
FT                   DNKVVQTLARAFLHCGWTAVRFNFRGVGGSAGSHDEGRGELDDLLAVVQHVSPVAEGDA
FT                   GASAGALALAGFSFGAFVTTHAFARLNPVRPVEKLVLVGTSVSRAPAAPIDAAAHLKTL
FT                   VVHGEQDDTVLLPAVLDWARPQALPVTVVPGGGHFFHGQLPLLKNLVIRHLSSPPI"
FT   gene            272345..273547
FT                   /locus_tag="Bpro_0250"
FT   CDS_pept        272345..273547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0250"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42215"
FT                   /db_xref="GOA:Q12GX7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GX7"
FT                   /protein_id="ABE42215.1"
FT                   /translation="MYCSLKVPRGLRAAALLLLVSAFLPVAHAQAPQAPEIAARSYLLL
FT                   DVTANQILAAKDIDSPVEPASLTKLMTEYLVFDALKSKKIDLKQTFGVSERAWKMPGSR
FT                   MFIDPKMQVPVEDLIKGMVVQSGNDATMALAEGVGGTAEHFVRLMNEQAKALGMKSTAY
FT                   KNPEGLTEPGHTTTARDLSILATRLMRDFPDYIGYSAIKKYRYPGTPAANDTNRNTLLF
FT                   RDPTVDGLKTGHTEAAGYCMIATARRDFPNLGVGGAPGGRRLLAIVLGTSSDSARANES
FT                   QKLLNWGYTAFEAVKLFDAGQPVVAPSVWKGAASTVKLGRPEAIVVAVAAGSAPKVKTQ
FT                   VARPDPLVAPFVKGQQLGTLKVMLGENPTPVAEVQLVALEAVEEAGILGRAWDSIRLWI
FT                   K"
FT   sig_peptide     272345..272434
FT                   /locus_tag="Bpro_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            273858..274235
FT                   /locus_tag="Bpro_0251"
FT   CDS_pept        273858..274235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0251"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42216"
FT                   /db_xref="GOA:Q12GX6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GX6"
FT                   /protein_id="ABE42216.1"
FT                   /translation="MPTINQLVRQGREVEKIKSKSPAMENSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEIISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQSRSKYGAKRPKKA"
FT   gene            274456..274929
FT                   /locus_tag="Bpro_0252"
FT   CDS_pept        274456..274929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0252"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42217"
FT                   /db_xref="GOA:Q12GX5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GX5"
FT                   /protein_id="ABE42217.1"
FT                   /translation="MPRRREVPKREILPDPKFGDVDLAKFMNVIMQGGKKAVAERIIYG
FT                   ALDFIEKKNPGKDPLEAFHMAIGNIKPMVEVKSRRVGGANYQVPVEVRPVRRMALAMRW
FT                   LKEAAKKRGEKSMSLRLANELMEATEGRGGAMKKRDEVHRMAEANKAFSHFRF"
FT   gene            275130..277232
FT                   /locus_tag="Bpro_0253"
FT   CDS_pept        275130..277232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0253"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42218"
FT                   /db_xref="GOA:Q12GX4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GX4"
FT                   /protein_id="ABE42218.1"
FT                   /translation="MSRATPIQNYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDTSLPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVVEQMKLRLK
FT                   ASPVPMVIPIGAEENFTGVVDLLKMKAIIWDEASQGMKFTYSEIPAELVELAKEWREKM
FT                   VEAAAESSEELMNKYLEEGDLTEAEIKLGIRTRTIASEIQPMYCGSAFKNKGVQRMLDA
FT                   VIEFMPSPIDIPPVKGMDEDEAPVTRKADDEEKFSALAFKLMTDPFVGQLTFVRVYSGV
FT                   LKKGDSVYNPIKGKKERIGRIVQMHANNREEVSEIRAGDIAACVGLKDVTTGETLCDPD
FT                   AIVMLERMVFPEPVITQAVEPKTKADQEKMGIALQRLAQEDPSFRVKTDEESGQTLIAG
FT                   MGELHLEIIVDRMKREFGVEANVGKPQVAYRETIRKTVEDAEGKFVRQSGGKGQYGHVV
FT                   LKIEPNEAGKGIEFVDAIKGGVVPREYIPAVEKGINEAVTSGVLAGYPVVDVKVTLHFG
FT                   SYHDVDSNELAFKMAAIFGFKEGCRKASPVILEPMMAVEVETPEDYAGNVMGDLSSRRG
FT                   MVQGMEDMVGGGKAIKAEVPLSEMFGYSTTLRSMSQGRATYSMEFKHYSEAPRNVSEAI
FT                   MASRAK"
FT   gene            277381..278571
FT                   /locus_tag="Bpro_0254"
FT   CDS_pept        277381..278571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0254"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42219"
FT                   /db_xref="GOA:Q123F6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q123F6"
FT                   /protein_id="ABE42219.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLASKFGGEAK
FT                   GYDQIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYDF
FT                   PGDKTPIIHGSAKLAMEGDKGPLGEQAIMKLADALDTYIPLPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGVIKVGEEIEIVGIADTQKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVQRGQVLCKPGSIKPHTHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGAIELPEGKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGKTVGAGVVAKIIA"
FT   gene            278597..278911
FT                   /locus_tag="Bpro_0255"
FT   CDS_pept        278597..278911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0255"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42220"
FT                   /db_xref="GOA:Q12GX2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GX2"
FT                   /protein_id="ABE42220.1"
FT                   /translation="MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPT
FT                   RMKRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ
FT                   "
FT   gene            279128..279811
FT                   /locus_tag="Bpro_0256"
FT   CDS_pept        279128..279811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0256"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42221"
FT                   /db_xref="GOA:Q12GX1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GX1"
FT                   /protein_id="ABE42221.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDTVPVTVVDVSNNRVTQVKTE
FT                   ANDGYDALQVAFGARKASRVTKPAAGHLAKAGVEAGEILKEFRVTADVAGKYAAGTVVP
FT                   AADVFAVGQLVDVQGTSIGKGYAGTIKRHNMSSQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKRMTGHLGDVTVTTQNLNIVRIDEARQLLMIRGAVPGSKGGFVTVRAAIKAKPTTA
FT                   AKGAN"
FT   gene            279811..280431
FT                   /locus_tag="Bpro_0257"
FT   CDS_pept        279811..280431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0257"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42222"
FT                   /db_xref="GOA:Q12GX0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GX0"
FT                   /protein_id="ABE42222.1"
FT                   /translation="MQVELLNDQGLASSKVDVPDTVFGREYNESLIHQVVVAFQANARQ
FT                   GTRAQKDREQVRHSTKKPFKQKGTGRARAGMTSSPLWRGGGRIFPNMPDENFTQKINKK
FT                   MYRAGMASIFSQLAREGRLAVVDSLAVDSPKTKVLADKFKAMNLNSVLVIADVVDENLY
FT                   LASRNLVNILVVEPRYADPVSLVHYKKVLVTKAAMDQLKEMFA"
FT   gene            280428..280754
FT                   /locus_tag="Bpro_0258"
FT   CDS_pept        280428..280754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0258"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42223"
FT                   /db_xref="GOA:Q12GW9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW9"
FT                   /protein_id="ABE42223.1"
FT                   /translation="MSAVNSKTKFDEGRLMQVLVAPIVSEKATMIADKTNAVTFKVLQD
FT                   ATKFEIKAAVQLMFKVDVQSVAVLNIKGKTKRFGKSVGRRDNIRKAYVTLKPGQELNLG
FT                   GESA"
FT   gene            280754..281578
FT                   /locus_tag="Bpro_0259"
FT   CDS_pept        280754..281578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0259"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42224"
FT                   /db_xref="GOA:Q12GW8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW8"
FT                   /protein_id="ABE42224.1"
FT                   /translation="MAVIKMKPTSPGMRGMVKISRDHLHKGEPYAPLLEPQFQKSGRNN
FT                   NGHITVRHKGGGHKHHYRVVDFKRNKDAIPAKVERIEYDPNRTAHIALLCYADGERTYI
FT                   IAPRGLEVGATLISGSEAPIRVGNTLPIRNIPVGSTIHCIEMQIGKGAQIARSAGTSAT
FT                   LLAREGTYAQVRMRSGEVRKIHIECRATIGEVANEEHSLRRLGKAGVKRWMGIRPTVRG
FT                   VVMNPVDHPHGGGEGKTGEGRHPVDPWGNLTKGYRTRNNKRTQVMIVSRRKK"
FT   gene            281588..281866
FT                   /locus_tag="Bpro_0260"
FT   CDS_pept        281588..281866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0260"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42225"
FT                   /db_xref="GOA:Q12GW7"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW7"
FT                   /protein_id="ABE42225.1"
FT                   /translation="MTRSLKKGPFVDHHLVAKADKAVTNKDKKPIKTWSRRSMILPEFI
FT                   GLTIAVHNGKQHVPVYITDQMVGHKLGEFALTRTFKGHPADKKVVKK"
FT   gene            281876..282205
FT                   /locus_tag="Bpro_0261"
FT   CDS_pept        281876..282205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0261"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42226"
FT                   /db_xref="GOA:Q12GW6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW6"
FT                   /protein_id="ABE42226.1"
FT                   /translation="METRATLRGVRLSVDKGRLVADLIRGKKVDQALNILNFTQKKAAG
FT                   IIKKVVESAIANAEHNDGADIDELKVKTIYVEQGATLKRFSARAKGRGNSISKPTCHVY
FT                   VVVGN"
FT   gene            282218..283123
FT                   /locus_tag="Bpro_0262"
FT   CDS_pept        282218..283123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0262"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42227"
FT                   /db_xref="GOA:Q12GW5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW5"
FT                   /protein_id="ABE42227.1"
FT                   /translation="MGQKINPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKA
FT                   KLKNAAVSRVLIERPAKNARITIFSARPGVVIGKKGEDIENLKKELSRQLGVPVAVNIE
FT                   EVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIA
FT                   RCEWYREGRVPLHTLRADIDYGTSEAKTTYGVIGVKVWVYKGDTLGRGESPGAKLDAAP
FT                   SDEERKPRGPRRDARPGSDRPAPRGARAPRAPAGGTNTAPADGSDKPAEATPGSDAPKT
FT                   TVKRVRKAAPAAAADGTKTE"
FT   gene            283149..283565
FT                   /locus_tag="Bpro_0263"
FT   CDS_pept        283149..283565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0263"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42228"
FT                   /db_xref="GOA:Q12GW4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW4"
FT                   /protein_id="ABE42228.1"
FT                   /translation="MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTAR
FT                   QIEAARRAISRHVKRGGRIWIRVFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKIVF
FT                   EIVGVPEELAREAFRLASAKLPLRTTFVSRMIGQ"
FT   gene            283578..283787
FT                   /locus_tag="Bpro_0264"
FT   CDS_pept        283578..283787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0264"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42229"
FT                   /db_xref="GOA:Q12GW3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW3"
FT                   /protein_id="ABE42229.1"
FT                   /translation="MTKSTELRQKDVAGLKTEVKELQKAHFGLRMQKATQQLTNTSTLR
FT                   STRRSIARAKTILAETIVKQGAKK"
FT   gene            283784..284053
FT                   /locus_tag="Bpro_0265"
FT   CDS_pept        283784..284053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0265"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42230"
FT                   /db_xref="GOA:Q12GW2"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GW2"
FT                   /protein_id="ABE42230.1"
FT                   /translation="MTEAKKSLKRTLIGKVVSDKRAKTVTVLVERRVKHELYGKIVSLS
FT                   SKYHAHDEKGEYHTGDVIEITESRPISKTKNWVVTRLVEKAAAV"
FT   gene            284167..284673
FT                   /locus_tag="Bpro_0266"
FT   CDS_pept        284167..284673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0266"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42231"
FT                   /db_xref="GOA:Q12GW1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GW1"
FT                   /protein_id="ABE42231.1"
FT                   /translation="MIKVGDTLPAATLMEFSEVEGNGCSIGPNPVDVAKVTAGKTIALF
FT                   ALPGAFTPTCSAKHVPGYVEKAAEFKAAGVDEIWCVSVNDAFVMGAWARDQKTDGKVRM
FT                   LADGSADFAKATGLTLDLTARGMGLRSNRYSMLVKDGKVMSLNVEGPGKFEVSDAATLL
FT                   AQAKA"
FT   gene            complement(284843..285331)
FT                   /locus_tag="Bpro_0267"
FT   CDS_pept        complement(284843..285331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0267"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42232"
FT                   /db_xref="GOA:Q12GW0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GW0"
FT                   /protein_id="ABE42232.1"
FT                   /translation="MQPPSIQFVTPATPDQLTATRLIFTEYAEQLGIDLCFQGFEAELA
FT                   DLPGAYDAPQGALLLAMVDGEVVGCCALRALDAVDYPNAAEMKRLYVRKAFRRFGLGRQ
FT                   LAEAVLDMARAAGYHSVLLDTLDDMESARALYAEVGFVEIPPYYHNPIAGAHYLKVDL"
FT   gene            complement(285426..286109)
FT                   /locus_tag="Bpro_0268"
FT   CDS_pept        complement(285426..286109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0268"
FT                   /product="cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42233"
FT                   /db_xref="GOA:Q12GV9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV9"
FT                   /protein_id="ABE42233.1"
FT                   /translation="MYDKSLSRVRVWDLPTRLFHWALVTCVTGLAITGSAGGNTMVWHF
FT                   RFGYAVLALLLFRLIWGLVGGHWSRFTAFIYAPQSVINYLKGQGKPEHSVGHSPVGAGS
FT                   VFAMLVLLLAQLVTGLISDDEIAFAGPLTRFVSSATVNLATNYHANIGKWVLLALVLLH
FT                   LAAITFYLSRQHKLVGAMLHGDKELPVAAPSSRDDTASRLAALLILGLCTALVYWISGL
FT                   SAPAF"
FT   gene            286311..286766
FT                   /locus_tag="Bpro_0269"
FT   CDS_pept        286311..286766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0269"
FT                   /product="cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42234"
FT                   /db_xref="GOA:Q12GV8"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV8"
FT                   /protein_id="ABE42234.1"
FT                   /translation="MRLFASIAAAATLIAIAAPASAQFAKPEDAIKYRQGALFVMGQHF
FT                   SRLGAMANGRVPFDAKVAADNAEIVADMAKIPWAGFAHTTDKGGNTKAKPEIWTEQAKF
FT                   KESSDKLVADTAKLVVAAKTGNLDALKTAFAATAGNCKSCHDAFRNQ"
FT   sig_peptide     286311..286379
FT                   /locus_tag="Bpro_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.672 at
FT                   residue 23"
FT   gene            complement(286956..287480)
FT                   /locus_tag="Bpro_0270"
FT   CDS_pept        complement(286956..287480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0270"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42235"
FT                   /db_xref="GOA:Q12GV7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV7"
FT                   /protein_id="ABE42235.1"
FT                   /translation="MVRTFLMKRISVLAVCRMALAGAAVVAALAGCSGTQTAPESTFVL
FT                   LDGSKKTTADLKGRVTLVNFWATSCVTCVAEMPKVISTYNKYKNQGYDTLAVAMSYDPP
FT                   SYVVNYTQTRQLPFQVAIDNTGAVAKAWGDVQLTPTTYLVNKRGEIVKRYVGEPDFAAL
FT                   HQLIEKLLAET"
FT   sig_peptide     complement(287397..287480)
FT                   /locus_tag="Bpro_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.391 at
FT                   residue 28"
FT   gene            287479..288183
FT                   /locus_tag="Bpro_0271"
FT   CDS_pept        287479..288183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42236"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV6"
FT                   /protein_id="ABE42236.1"
FT                   /translation="MLRRNFNQAGVSALGALILATYQQAHALSLGDLSNAEASSGLKTA
FT                   LERGALAAVALLGKTDGFLGNPKVRIPLPGYLEDASKLLKTFGQGKRIDELVVSINRAA
FT                   EAAVPMGTDLLVGAVKAMSVNDAKNILQGGETSVTNFFAEKTRVPLGAKFLPVVTKATE
FT                   KVGLANKYNEVAGKAAGFGLVKKEDANIQQYVTGKSLDGLYLIIGEEEKKIRQDPLGTG
FT                   SDILKKVFGALK"
FT   sig_peptide     287479..287562
FT                   /locus_tag="Bpro_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.729 at
FT                   residue 28"
FT   gene            complement(288236..288706)
FT                   /locus_tag="Bpro_0272"
FT   CDS_pept        complement(288236..288706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0272"
FT                   /product="cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42237"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV5"
FT                   /protein_id="ABE42237.1"
FT                   /translation="MRNTFAALSATLVLAGLAAPPVWAQSGGHMMMMPDEMKWADIPSL
FT                   PAGAKISVLEGPLSEAVPFTFRLKFPANYQIAAHWHPAIEHVTVISGTFNMGAGDKLDT
FT                   TKTMALSAGAVAIMQPKTAHFAWTRDETIVQVHGVGPWGVTYVNPADDPRKK"
FT   sig_peptide     complement(288632..288706)
FT                   /locus_tag="Bpro_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            288986..290251
FT                   /locus_tag="Bpro_0273"
FT   CDS_pept        288986..290251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0273"
FT                   /product="branched-chain alpha-keto acid dehydrogenase E1
FT                   component"
FT                   /EC_number="1.2.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42238"
FT                   /db_xref="GOA:Q12GV4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR022593"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV4"
FT                   /protein_id="ABE42238.1"
FT                   /translation="MNKNQVLRLHVPEPSGRPGHETDFSYLHLSPAGAVRRPPVEASPA
FT                   DTSDLAYSLVRVLDDDNRAVGPWVPPVEPQRLRQGLRAMMKTRIYDARMLIAQRQKKIS
FT                   FYMQCLGEEAIATAHALALQPGDMCFPTYRQQGLLLARDDVDMVEMICQLMSNERDPLK
FT                   GRQLPVMYSYKRAGFFTISGNLATQFIQAVGWGMASAIKGDSKIASAWIGDGATAEADF
FT                   HTALTFAHVYRAPVILNVVNNQWAISTCQAIAGGEATTFAARGVGCGIASLRVDGNDFL
FT                   AVYAASLWAAERARSNLGPTLIEWVTYRGGAHSTSDDPSRYRPVDDWAHFPLGDPIARL
FT                   KAHLMQTGAWTEQEHEATQKELEAQVSAALKEAERYGSLADGHLAGAAAMFEDVYKDMP
FT                   EHLRRQREQLLRGEMDTPRREA"
FT   gene            290254..291264
FT                   /locus_tag="Bpro_0274"
FT   CDS_pept        290254..291264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0274"
FT                   /product="branched-chain alpha-keto acid dehydrogenase E1
FT                   component"
FT                   /EC_number="1.2.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42239"
FT                   /db_xref="GOA:Q12GV3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV3"
FT                   /protein_id="ABE42239.1"
FT                   /translation="MQMTMIQALRSAMDVMLERDSNVVVFGQDVGYFGGVFRCTDGLQA
FT                   KYGRSRVFDAPISEGGIVGAAVGMAAYGLRPVVEIQFADYFYPASDQIVSEAARLRYRS
FT                   AADFTAPMTIRMPCGGGIYGGQTHSQSPEALFTHVCGLRTVMPSNPYDAKGLLIACIEN
FT                   DDPVIFLEPKRLYNGPFDGHHDRPAVPWTGHPLGEVPEGYYTVPLESATVFRPGADLTV
FT                   LTYGTMVFVSQAAAQESGIDAEIIDLRSLWPMDLQTVVDSVKKTGRCVVVHEATRTSGF
FT                   GAELAALVQEHCFYHLEAPIERVTGWDTPYPHAQEWAYFPGPARVGAAFKRAMEA"
FT   gene            291421..292698
FT                   /locus_tag="Bpro_0275"
FT   CDS_pept        291421..292698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0275"
FT                   /product="branched-chain alpha-keto acid dehydrogenase E2
FT                   component"
FT                   /EC_number="2.3.1.168"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42240"
FT                   /db_xref="GOA:Q12GV2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV2"
FT                   /protein_id="ABE42240.1"
FT                   /translation="MSIHIIKMPDLGEGITEVELVAWRVKPGDRVTEDQVLADVMTDKA
FT                   TVEIPSPVVGQVLALGGEVGQVLAVGAELIRIEVEGAGAASEAAPSVLTVPQDATASMP
FT                   VVPAPAPASTLTSIPTSIPDAIAPPSPSADKPIASPAVRRRAWELGIDLQQVAASGAGG
FT                   RIMQADLDAHVAAHGTAPPAVAGSTGLAQRNDEEKVPVIGLRRRIAQKMQESKRRIPHF
FT                   TYVEEVDVTELEALRARLNAKWGAQRGHLTLLPLLVRAVVLAVREFPQVNARFDDEAGV
FT                   VTRHGAVHIGIATQTGAGLMVPVLRHAEARDLWSSAAEVVRLAEAARAGKATRDELTGA
FT                   TLTLTSLGALGGIVSTPVINHPEVAIVGVNRIVERPVMRDGAVVARQMMNLSSSFDHRV
FT                   VDGVDAAGFVQAVRGYLESPVTLFVE"
FT   gene            complement(292872..293495)
FT                   /locus_tag="Bpro_0276"
FT   CDS_pept        complement(292872..293495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0276"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42241"
FT                   /db_xref="GOA:Q12GV1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV1"
FT                   /protein_id="ABE42241.1"
FT                   /translation="MADDPMSMYHEGMRRLQDVRETRPLADRLEQVTVRAAFTGEDRAF
FT                   IERCPMFFIATADASGHPDCSYKGGLPGFVHVLDDHTLAIPDYDGNGMYRSWGNALLNP
FT                   HVGLLFLDFENPKRLRVNGTAQVSENDPLRAEYPGSVFIVRVTATRIFPNCPRYIHKMQ
FT                   LVDYSAYAPKSGYTPPVPAWKTFDAFRDALPARDRPDGKKEGGP"
FT   gene            complement(294013..294516)
FT                   /locus_tag="Bpro_0277"
FT   CDS_pept        complement(294013..294516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42242"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041737"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GV0"
FT                   /protein_id="ABE42242.1"
FT                   /translation="MTPPRQAQRRQFCAALASSVALPALLPLRALAADTALPVPASLPR
FT                   IAMAAAAKDQPVVLLVSLPGCPYCELVRRNYLLPARQDIGLHAWQLSIADQTTPLIGFD
FT                   GKASTAAAQIKAWKATFTPTVLFLGDSGQELAERLVGVGVPDFYGAYLEQRLAAARKTL
FT                   AARG"
FT   sig_peptide     complement(294418..294516)
FT                   /locus_tag="Bpro_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(294513..295247)
FT                   /locus_tag="Bpro_0278"
FT   CDS_pept        complement(294513..295247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0278"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42243"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU9"
FT                   /protein_id="ABE42243.1"
FT                   /translation="MSHNFVFVHGAWHGGWCWRRVTQALQLDHHKVYPVTLTGLGERAH
FT                   LLSPSINLDTHIDDVISAIEVEELSEVILAVHSYAGMIGTAVADRVPKRIKHLVYVDAV
FT                   LPKPGESWSSTQSAATQQQRLTAAQASTRFSFPPPDPEVFGLHDADREWVKRRQTPHPG
FT                   NTYQAPLNFDMQRVAAVPRTYVSCTQPALATIDPSRLRARDPKFWDGAWLPNSKFVEIQ
FT                   TGHDPMISDPHALTKILLDCAA"
FT   gene            complement(295247..295510)
FT                   /locus_tag="Bpro_0279"
FT   CDS_pept        complement(295247..295510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42244"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU8"
FT                   /protein_id="ABE42244.1"
FT                   /translation="MPLSNDSTLISNRRQCLFHVSQQVDMALLDTQVAMLANDPRYAKN
FT                   QDRVRNRAVLVPLLGQHTEDVLSGMLNYSDEKLSELGRSEVI"
FT   gene            295589..296272
FT                   /locus_tag="Bpro_0280"
FT   CDS_pept        295589..296272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0280"
FT                   /product="OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42245"
FT                   /db_xref="GOA:Q12GU7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU7"
FT                   /protein_id="ABE42245.1"
FT                   /translation="MSHISLLSRVKAFNKSQGMFPALHSLLIMKKQLVAAAVLSTLLSG
FT                   AALAQQATEGPWMVRARAVHLDSSNGDSTGLGLSVNNKWMPEVDVSYFFNKNVAVELVV
FT                   TVPQKHTLRSSALGVDVGTLKHLPPTLLGQYHFPMNGFKPYVGAGINYTRFSSVNLLPG
FT                   VDIDRNSWGPALQVGVDIPLSGNMYLNFDVKKVYIRTDVSLNGRNVGEFKVDPLLVGVG
FT                   LGWRF"
FT   sig_peptide     295589..295738
FT                   /locus_tag="Bpro_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 50"
FT   gene            complement(296375..297649)
FT                   /locus_tag="Bpro_0281"
FT   CDS_pept        complement(296375..297649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0281"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42246"
FT                   /db_xref="GOA:Q12GU6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU6"
FT                   /protein_id="ABE42246.1"
FT                   /translation="MWARQPSSRQNSRMNSLDGIRILDLSRVLAGPWCTQTLADLGADV
FT                   IKIERPGTGDDTRTWGPPFLKDDQGTETQEAAYYLGTNRNKRSVTCDIARPAGQALIRE
FT                   LAAHCDVFVENFKVGDMARYGLDYASLKAINPRLVYCSVTGFGQTGPYAERAGYDYAIQ
FT                   GMGGLMSVTGERDDIGGGPQKVGVAVADLMTGMYATVAILAALRHAERTGEGQQVDMAL
FT                   LDTQVAMLANLSANYLVSGKAPGRAGNAHQNIVPYQVFEVAPAADGHKDHLILAVGNDG
FT                   QYAKFCAVAGHPELASDPRYAKNQDRVRNRAVLVPLLEAILKTRTKADWLAALEAAKVP
FT                   CGAINNLAEVFADPQIEARQMVTHWQHPVKQDLRLVSSPIKLSATPVRCDLPPPLLGQH
FT                   TEDVLRGMLNYSDAQLSDLKNKQVI"
FT   gene            297820..298701
FT                   /locus_tag="Bpro_0282"
FT   CDS_pept        297820..298701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0282"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42247"
FT                   /db_xref="GOA:Q12GU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU5"
FT                   /protein_id="ABE42247.1"
FT                   /translation="MRFDLTTLRLFVSAIEHGSIARAAECEHIVASAASKRIGDLETGL
FT                   GVALLVRQHAGVVPTVAGEALARHAREVIKTLDRIPGAVSTLAADDQPDIRVLANQTGV
FT                   VVVAADLASHLARRPGVKIRLGEGQSLPIIESVAQGSADIGIIGHFQPTDRLHVVPYRS
FT                   IPLMLVMPAAHPLAGRGALSFADALEFDLITLMQGTAIRGWALAAAARIARKPKFTMQV
FT                   QSYEAIRAMVQAGLGIAVMPAANILPYEDLLQVRALPLTDDWARMQLYLVCDRGAAGIP
FT                   AIEELLAHLAAA"
FT   gene            299001..299783
FT                   /locus_tag="Bpro_0283"
FT   CDS_pept        299001..299783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0283"
FT                   /product="class II aldolase/adducin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42248"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU4"
FT                   /protein_id="ABE42248.1"
FT                   /translation="MNEIVARPKSEYDAKFRADLDKFVQVSGWTLQQKVALACRILDRD
FT                   GHESALAGQVSTRGEKPGTYWTLRFGLGFDEARESNILLIDDDLNVLAGEGMANPANRF
FT                   HLWIYRARPETHAIVHTHPPYASALSMIAEELIVSHMDTCVLYENCAYLPEWPGVPIGD
FT                   EEGEIISAALGDKQAVLLAHHGLLTAAKTIEEAAVLAFYVERAAKLQLMARAVGPIRRV
FT                   KPELAREARSYRGSPKYIAATFNYLARRVLREAPDCLT"
FT   gene            299902..300873
FT                   /locus_tag="Bpro_0284"
FT   CDS_pept        299902..300873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0284"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42249"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU3"
FT                   /protein_id="ABE42249.1"
FT                   /translation="MKPLTTHRICAALLALAAATALAQSYPNRAIRIVVPYPPGGGADI
FT                   TARPIAQMLSERWGQPVVIENHGGASGMIGADIVAKAPPDGYTIMVSASAEVALNVALF
FT                   PKMAYDPVRDFAPITLATVTPMALVVHPSVPITSLKEYIALAKAKPGSMKFGSVGAGTP
FT                   HHFAGEWLKMLTQTDIVHVPYKGSGPLIIDLLGGHSPSGFATLLPAMQHVKSGKLRALA
FT                   VTTQKRVPQLPDVPALAETLPGFDITQWNAVWAPAATPKDVLDKLSAEIARIVQSPDYK
FT                   ARMAEQGSEAIGNSPSELAAFQKAEIDKYRKIAQQANMKADQ"
FT   sig_peptide     299902..299973
FT                   /locus_tag="Bpro_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            301134..301934
FT                   /locus_tag="Bpro_0285"
FT   CDS_pept        301134..301934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0285"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42250"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU2"
FT                   /protein_id="ABE42250.1"
FT                   /translation="MRTIHWLMTGILGLVLAGCAGISTAPTAQARQALAPTGKLRVGLL
FT                   LGSPTHVIKDAVSGEMKGVGFDLGKELARRMGVPFDPIIYPSIPALLDSGKAGHWDVTF
FT                   IGVTPGRAKDFDFAPTHLEVEFGYLVPGGSSISTMADVDRPGVRVALQERSGPDVFFSP
FT                   LLKNTVLVRASSNPGTLDLLKSGRADVMGSIKPILFELSKELPGSRVLDGRPGIDPHAM
FT                   AMPKGRDPGVTYARKFIENAKSEGLVKAAIERVGMRGALVSTTQ"
FT   sig_peptide     301134..301226
FT                   /locus_tag="Bpro_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.923 at
FT                   residue 31"
FT   gene            302148..302684
FT                   /locus_tag="Bpro_0286"
FT   CDS_pept        302148..302684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0286"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42251"
FT                   /db_xref="GOA:Q12GU1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU1"
FT                   /protein_id="ABE42251.1"
FT                   /translation="MITTHVFIAISLDGFIARPDGDIGWLLQRDDPTEDHGYSDFIADK
FT                   DMIVMGRGSYEKVVTFDKWPYDRPILVLSKQLAGTLVPEALKGKVRFSNLAPKDALEEL
FT                   TRQNVHRVYVDGGRLVQSFLRDGLINDMVITTVPVLIGSGRPLFGPLPQDIDLALVSSR
FT                   SFPSGLVQSTYRLVP"
FT   gene            302789..303241
FT                   /locus_tag="Bpro_0287"
FT   CDS_pept        302789..303241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42252"
FT                   /db_xref="GOA:Q12GU0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GU0"
FT                   /protein_id="ABE42252.1"
FT                   /translation="MRALATRLGVTPMSLYHHVEDRTGLLRALSDRVYAEVLETTGRPA
FT                   DHRAEIRAILTRYHNAVGRHPQLTLAIFAEPEAFAGVSRQITDRLTSLLAEITAEHILW
FT                   RDVLVDHAHGSGLALTTARGDQKQAESVREQYQHALDRLLDQLVEP"
FT   gene            complement(303538..303613)
FT                   /locus_tag="Bpro_R0001"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(303538..303613)
FT                   /locus_tag="Bpro_R0001"
FT                   /product="tRNA-Ala"
FT   gene            303749..304132
FT                   /locus_tag="Bpro_0288"
FT   CDS_pept        303749..304132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42253"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT9"
FT                   /protein_id="ABE42253.1"
FT                   /translation="MMKKTIPATSPDAYVAALSGWQRATVEQLRAAVLGSGTLAEVIKW
FT                   SHLVYLSNGPVLLIRAEESRVLFGFWRGKRLAGMDLLLKPGGKYEMATRELREGDEVNA
FT                   ALSRRLAKEAVRLNKTLGDPTKL"
FT   gene            complement(304250..304693)
FT                   /locus_tag="Bpro_0289"
FT   CDS_pept        complement(304250..304693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0289"
FT                   /product="cyanate lyase"
FT                   /EC_number="4.2.1.104"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42254"
FT                   /db_xref="GOA:Q12GT8"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GT8"
FT                   /protein_id="ABE42254.1"
FT                   /translation="MNRNDITEKIITTKVAKGITWESVAKKVGLSKEWVTAGCLGQMTF
FT                   DEKQAKVVGKIFGLTAEEQKWLQVVPYKGSLPTPVPTDPLIYRWYEIVSVYGTTIKELI
FT                   HEEFGDGIMSAIDFSMDIVRQPDPKGDRVNVVLSGKFLPYKTY"
FT   gene            complement(304759..305634)
FT                   /locus_tag="Bpro_0290"
FT   CDS_pept        complement(304759..305634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0290"
FT                   /product="nitrate transport ATP-binding subunits C and D"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42255"
FT                   /db_xref="GOA:Q12GT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT7"
FT                   /protein_id="ABE42255.1"
FT                   /translation="MRPALHTDTTGLQGPHAAPSLSRKEHSMQGFLKIEALSKAFVPAK
FT                   PVFANVSFTIDKGEFVCIIGHSGCGKTTILNVLAGLDSATAGHVFMDNREIAGPSLERG
FT                   VVFQSHALMPWLTVRKNIAFAVVSRWPDWSKAEVNAHVEKFVAMVGLSAAIDKKPSQLS
FT                   GGMKQRVGIARAFAIQPKMLLLDEPFGALDALTRGTIQDELMTIVRETHQTVFMITHDV
FT                   DEAILLADRILLMSNGTENAEGYAPGRIAEEVQNPLPRERTRAGLHHLPGYYELRNHIV
FT                   DFLVMRAKAH"
FT   gene            complement(305642..306505)
FT                   /locus_tag="Bpro_0291"
FT   CDS_pept        complement(305642..306505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0291"
FT                   /product="nitrate transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42256"
FT                   /db_xref="GOA:Q12GT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT6"
FT                   /protein_id="ABE42256.1"
FT                   /translation="MKSLNLKAGLVSLLIFLAFLGIWYTATLPSPGTPVASTAGLSAEQ
FT                   IEYQKMMGKDPGSTKTTGFPTLGQMGAAIWKQVSNPLYDNGPNDKGILIQLGHSLARVG
FT                   LGFLLACAVAVPLGFVIGMSPLLRRAFDPFIQVLKPISPLAWMPLALYTIKDSSISGIF
FT                   VIFICSVWPMLINTAFGVSAVKREWLNVASTLEVSPLRKAFLVILPAAAPTIFTGMRIS
FT                   MGIAWLVIVAAEMLVGGTGIGYFVWNEWNNLSLTNVIFAILVIGIVGMLLDLSFAQLQK
FT                   MVTYVE"
FT   sig_peptide     complement(306395..306505)
FT                   /locus_tag="Bpro_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.602 at
FT                   residue 37"
FT   gene            complement(306642..307997)
FT                   /locus_tag="Bpro_0292"
FT   CDS_pept        complement(306642..307997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0292"
FT                   /product="ABC transporter nitrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42257"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT5"
FT                   /protein_id="ABE42257.1"
FT                   /translation="MSNRFDAYDADRPLMLRCACGQDHAPGEHDAAAASAQELSHSFME
FT                   ASLVKALFPVDSVRRSFLRAVGANTARAAIASVFPMGALQAMAQDRGPLEKKDLKIGFI
FT                   AITCASPLIMADPLGFYKKEGLHVQLNKTAGWALIRDKMINKEHDASHFLSPMPLAMTM
FT                   GLGSNQVNMNVASIQNTNGQAITLHVKHKNNRDPKNWKGFKFAIPFEYSMHNFLLRYYL
FT                   AENGLNPDTDVQLRVVPPPEMVANLRAGNIDGFLGPDPFNQRAVYDEVGFIHILSKDIW
FT                   DGHPCCAFGVSDEFIQKNPNTFAALYRAVLGASFMASQPKDRDLIAKVIAPTQYLNQPE
FT                   AVLQQVLTGKFADGLGNIKNVPDRANFDPVPWQSMAVWMLTQMKRWGYVKGDVNYRQIA
FT                   EKVFLLTEAKKQMSLAGFKPPEGAYKKFKVMGKEFDPAKPEDYVKSFAINKL"
FT   gene            complement(308115..308783)
FT                   /locus_tag="Bpro_0293"
FT   CDS_pept        complement(308115..308783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0293"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42258"
FT                   /db_xref="GOA:Q12GT4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT4"
FT                   /protein_id="ABE42258.1"
FT                   /translation="MNTVKILIGDDHRIVREGLKQVLADAPEIEVVAEAETGPDILQRV
FT                   DALGGDSGLDAVLLDIALPERDGLDVLQALKKSWPRLAVLMLSTYPEKQYAVRCIKLGA
FT                   AGYLNKSAHPDDMIAAVRKVATGGVYVSAIAAEALASAVGNSATKTGGGGGTESLSHRE
FT                   HQVFRLLTAGKSVGEIGAQLNLAPNTVSTYRARILEKTGTRNDVELALYAERHAKTAHL
FT                   "
FT   gene            complement(308808..310040)
FT                   /locus_tag="Bpro_0294"
FT   CDS_pept        complement(308808..310040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0294"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42259"
FT                   /db_xref="GOA:Q12GT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT3"
FT                   /protein_id="ABE42259.1"
FT                   /translation="MVEDTLLPDMRGLALGQAVPAHLPAAGQVVWRDKLSQLLESTGEG
FT                   IFGIDMDGRCTFINRAGAEQLGWLPAEVLGHNMHELAHHSHAGGAHYPEHLCPIFNAFR
FT                   KALPCRIDTELFWRKNGSAFAVEYSSYPIVEGGVVQGAVVTFVDISARRQAEDALRQAH
FT                   AVLEQRVSERTQALSEALEQLRELTAYTHSVREDERTRIAREVHDELGSLLVALKMDVG
FT                   WLDKRLGEQQQRSLDEAQSMRERMRSKCQNMGRLIEAAVDNVGRIITDLRPSILDHQGL
FT                   WAALDWQAHEFVLSAELALDWQMDVAGAAPLPEQAAIGIFRIFQEMLSNVGRHAQASRV
FT                   AITIQATPRDISIAVRDNGKGAEAAAFEAANAYGVMGMRERARHLGGTLDISSQIGHGA
FT                   LFNLRIPLSNQ"
FT   gene            310241..310825
FT                   /locus_tag="Bpro_0295"
FT   CDS_pept        310241..310825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42260"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT2"
FT                   /protein_id="ABE42260.1"
FT                   /translation="MPRQTRTFSIVAMTALLALALTACSPAFNWREVRPDNTRLSLLLP
FT                   CKPDKAQKTVPLGGQPTVLAMLGCDAGGATFAVAVADLGDAAKVGPVLAQWQSLTLANM
FT                   KAGPRAAGPGPGGTQVVPLKLPGASAEPAPLLVSAQGQRADGTAVMGRAAYFAQGSQVF
FT                   QVVMYAGATKRDAAPQAVEVAETFFASLKFE"
FT   sig_peptide     310241..310330
FT                   /locus_tag="Bpro_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.670 at
FT                   residue 30"
FT   gene            310924..312219
FT                   /locus_tag="Bpro_0296"
FT   CDS_pept        310924..312219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0296"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42261"
FT                   /db_xref="GOA:Q12GT1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT1"
FT                   /protein_id="ABE42261.1"
FT                   /translation="MTKAQNASPAMPVATACPASSLPLDRKTAAIVFLAFAAAYFCSAL
FT                   VRAITATLSPVLSQDFALQARDLGLLGAGYFLGFASTQLPLGAWLDRHGPKRVILCFLS
FT                   LAVLGCLAFSLAGTFAWLLAARVLVGMGVSACLMAPLTGYRRWFDGPAVLRANSWMLMT
FT                   GSLGMLASTLPVQWLMPLTGWRPLFWILAAMILLSMGVIAWVVPAWQKNADATPGAPGT
FT                   AGAEASYAMVWRSRYFQKMSPLAFFNYGGLVAVQTLWAGPWMVKVAGYTPLEAATGLFY
FT                   INAAMLVTFWAWGMVNPWLVGRGWSANRLIGWGVPVSLLVLAANIFAGSATGWLGWALF
FT                   CMSSSALGLAQPAVGMAFSPSLAGRAMSAYNLMIFGGVFVVQWGIGLAVDAFRAAGLTE
FT                   VASFQAAMGVFLCCCIASYGYFLSVNADNSPQ"
FT   sig_peptide     310924..310989
FT                   /locus_tag="Bpro_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.720) with cleavage site probability 0.633 at
FT                   residue 22"
FT   gene            312216..312659
FT                   /locus_tag="Bpro_0297"
FT   CDS_pept        312216..312659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0297"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42262"
FT                   /db_xref="GOA:Q12GT0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GT0"
FT                   /protein_id="ABE42262.1"
FT                   /translation="MNGIFIIAHAPLASALRHCMLHVFPDNAAGVAALDVQPNMPPEET
FT                   LAQARVMLEQLGTSHVLVLVDVFGATPCNVAQKLVDGVHSKLITGVNLPMLLRTVSYRH
FT                   ESLDALVARALVGATQGVMQVAITAPQNQVRRTHDQDQHEHQQ"
FT   gene            312628..312897
FT                   /locus_tag="Bpro_0298"
FT   CDS_pept        312628..312897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0298"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42263"
FT                   /db_xref="GOA:Q12GS9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS9"
FT                   /protein_id="ABE42263.1"
FT                   /translation="MIKTSTNINNKLGLHARASAKLTKLAGSFPCEVWMSRGERRVNAK
FT                   SIMGVMMLAAGLGSVVEVETNGDQEQAAMDAILALIADKFGEGE"
FT   gene            313062..314864
FT                   /locus_tag="Bpro_0299"
FT   CDS_pept        313062..314864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0299"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42264"
FT                   /db_xref="GOA:Q12GS8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS8"
FT                   /protein_id="ABE42264.1"
FT                   /translation="MTFSVHGLAVSRGIAIGRAVLVASSRADVAHYFVDPARVVEEITR
FT                   ARVARNAVAEEITRLQQELPPDAPHELAALLDVHLMLLQDEQLISGVKHWITERHYNAE
FT                   WALATQYEIIARQFDDMEDEYLRERKADLEQVVERILRYMKGVASPVQPVGPAGAGRKL
FT                   SQGLLLDDTMDVPLVLIAHDISPADMLQFKKSLFAGFATDVGGKTSHTAIVARSMDIPA
FT                   VVGARSASQLIEQDDWVIIDGDAGVLIVDPSPIILAEYGFKQRQGELERERLNRLKHTP
FT                   AVTIDGQRVELLANIEMPEDTVGAVNAGAVGVGLFRSEFLFMGRSGDLPDEEEQYQAYR
FT                   KAVEGMHGLPVTIRTVDVGSDKPLDRIDKAQDSHLNPALGLRAIRWSLADPPMFLTQLR
FT                   AILRAAAHGQVNLLVPMLAHGTEIRQTMAMIDHARATLDNKGTPYGPVRLGAMIEIPAA
FT                   ALSLKLFLKYFDFLSIGTNDLIQYTLAIDRADESVAHLYDPCHPAVLRLVADTIAECNA
FT                   QGKGVSVCGEMAGDVSMTRLLLGLGLRSFSMHPSRILAVKQQILRADAGKLSVWAAQVL
FT                   DAEDPAALINPASAPMPSPVPANA"
FT   gene            315132..317297
FT                   /locus_tag="Bpro_0300"
FT   CDS_pept        315132..317297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0300"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42265"
FT                   /db_xref="GOA:Q12GS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS7"
FT                   /protein_id="ABE42265.1"
FT                   /translation="MSIGQISGDGKSAAVLSAHDELLACLLIVARAHGEVLTRDAIMAG
FT                   LPAEHQRLTPSLFVRAARRARLSSQLVRKNLDRLKDALLPAIVLLHGQKACVLLGFNED
FT                   RSAARMVYPELGDAPVMVPLANLQADYTGVSIYVRPSLRFDARAPEVRAGRHGHWFWSV
FT                   MAESRPLYRDVLLAALLANLFALGLPLFVMNVYDRVVPNHAFETLWVLAIGLMLMLVSD
FT                   LVLRTLRSRFVDLASSRADVKLSAFIMERVLGMRMEQRPVSAGSFASNLRAFESVRDFI
FT                   GSATVVAFIDLPFALIFMIVIGWISWPMLIPLGVGALIMLLYALAVQGRMHELAETTYR
FT                   AAAQRNATLIEGLVGFETLKALGAESAIQHKWEKSAALLARVGAQLRLLSSTSSNTSAF
FT                   VQQLISLVIVIIGVYVIAERELTVGGLIACTMLASRAMAPVGQVAGLLVQYHTAATALT
FT                   SLNEMMARDVERPDDTTFISRGHLKGAIDFRDVSFNYPGQDTPSLRNLTFSIKPGEKVA
FT                   ILGRIGSGKTTLEKLILGLYRPTAGAVLVDGVDLRQLDPAELRRQIGYVQQDVMLFYGS
FT                   LRDNITLGSPLAEDADIVKAAEIGGIIGLVNQHPQGFDMLVGERGESLSGGQRQGVAIA
FT                   RAVINDPPILLLDEPTSSMDYSSEEDIKRRLKEFSVGKTVLLISHRTSVLELADRIIVM
FT                   DGGRIVADGPKDQVVTALRQGRIGKAA"
FT   gene            317297..318712
FT                   /locus_tag="Bpro_0301"
FT   CDS_pept        317297..318712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0301"
FT                   /product="Type I secretion membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42266"
FT                   /db_xref="GOA:Q12GS6"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS6"
FT                   /protein_id="ABE42266.1"
FT                   /translation="MAWLSEKAFERLGSWVNRSAESSPRAFDPLVKRLTPVEEQDSLDW
FT                   AGDADWARLQQEPLRARRLLRLAAGVLVLLVIWAYFAELDEVTRGEARVVPTSQVQIIQ
FT                   SVDGGVVEALLVREGQIVDAGQLLMRVDPTRFVSTMQESRAAQLSYQAKALRLEALTRG
FT                   TPFNPPADLVREAPDVVAQELRLYESRRAEIGAQLYISQAQLSQRQQELNEVLARRDQA
FT                   ERSLELMNRELNATRPMIATGAVSEVEVLRLERDVARLRGDREQATAQISRVQSSILEA
FT                   TRKIEEVQLTSRNQMSGELSETMNKLATLSQGGRALEDKVKHADIKSPVRGTVKRLLVN
FT                   TMGAVVQPGKEVVEVVPLDDALILEVQITPKDIAFLRPGQQAMVKFSAYDFSIYGGLEA
FT                   DVINIGADSVIDEKGNAFYHVRVRTHKPSLGPNLPIIPGMVAQVDILTGKKSVLAYLLK
FT                   PVLRARANALTER"
FT   gene            318731..319414
FT                   /locus_tag="Bpro_0302"
FT   CDS_pept        318731..319414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0302"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42267"
FT                   /db_xref="GOA:Q12GS5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS5"
FT                   /protein_id="ABE42267.1"
FT                   /translation="MSIEHLFLTTPAAPVPERWCEAFPAGRVHEAPAMLAHLRGRPANA
FT                   SLIWLSTADAQWAVQLRQVLQALPGVPVVVVSGRPHPLEGLDALDKGARGYTHAYAVPA
FT                   LLQEVALVVEHGGLWVGPDLMRRLVASTHAALARLPAAPAAAVAPDQNAWAQLSAREAE
FT                   VAHAVSAGRSNKEVATLMHISERTVKAHLGAVFEKLGVRDRLQLVLRLAASADTAQTPE
FT                   RELLS"
FT   gene            319411..319791
FT                   /locus_tag="Bpro_0303"
FT   CDS_pept        319411..319791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42268"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS4"
FT                   /protein_id="ABE42268.1"
FT                   /translation="MTDTPPPSSALLCRRDAAGRIVAVTRQALSAQDALAAGWEAVHAA
FT                   DPGVEQFLREVSSQTNPLSQTDAGLARVLEDLIDVLINRGLIQFTDLPAAAQAKLLERR
FT                   QTRASLANRLELLPDDGDSFPL"
FT   gene            320128..325548
FT                   /locus_tag="Bpro_0304"
FT   CDS_pept        320128..325548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42269"
FT                   /db_xref="GOA:Q12GS3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS3"
FT                   /protein_id="ABE42269.1"
FT                   /translation="MAQFATVAAITGNGSVLAVDVQGRTRVLKVGDTLQKGETVRTVGD
FT                   VRVELLMEDGSLLAVAPAQSIRLDENVVQSDQRPTAQDSAVTTPATADAVIQALERGTD
FT                   LNQSLEATAAGLVPGGGVDGGSSFVQLLRIAEGVSPLAYEYNFVPPELQPDIESIPEPV
FT                   PPTVSVGVTVGVQVGVGEGGPGLITGEMIQGTVSTADVIEGSGGGSKAVTFLITLNQVS
FT                   TTDVTVTYTIVPGTASNPADYFDGAVTGTVTIPAGYIGFFVTENIVGDILVEGNETFTI
FT                   VLSNPIGATLINDTATVTIIDDDHAPVAVDDSNSLTEDQISVSGNVIPNDTDADGQTLS
FT                   VVGPSITATNAYGTLVIDSATGGYTFTLNEATQAAAQALDDGESINMVFADVYQVTDGA
FT                   NLSNLADVSITITGTNDGPIITADPGNEGGNDVVYESGLAIGSDAAAGTEFAFGTFTVS
FT                   DADGLDDIQSVTINGVTVAIGSLVGQSFAGTNGTLTVTAYDAGTGVASYTYELTSPTTD
FT                   VDGTETDVFTLTTSDGTATSAPAAITIEIIDDVPTARADTDSVAEGADTTGNVLTGAGT
FT                   TSGGAGADTAGADGFGAGAVVGVAAGSNTAVPVSGGVGGGIAGTYGTLTLNADGSYTYE
FT                   ANPDAVTSNQTDTFVYTIVDGDGDLSTTTLTISVNNVTVTASDTDALVNEAGLPVVGSD
FT                   AASNSEIFNGAITPSGGTGPYTYTLTSTANGAYGNLVLNADGTYTYTLDTTFDGATLNN
FT                   GVTTEQDKDSFSYTVTDANGNTTTGTILVDIIDDVPTARADTDSVNEGADTTGNVLTGA
FT                   GTTSGGAGADTAGADGFGAGAVVGVAAGSNTAVPVSGGVGGGIAGTYGTLTLNADGSYT
FT                   YEANPDAVTSNQTDTFVYTIVDGDGDLSTTTLTISVNNVTVTASDTDALVNEAGLPVVG
FT                   SDAASNSEIFNGAITPSGGTGPYTYTLTSTANGAYGNLVLNADGTYTYTLDTTFDGATL
FT                   NNGVTTEQDKDSFSYTVTDANGNSTTGTILVDIIDDVPTARADTDSVNEGADTTGNVLT
FT                   GAGTTSGGAGADTAGADGFGAGAVVGVAAGSNTAVPVSGGVGGGIAGTYGTLTLNADGS
FT                   YTYEANPDAVTSNQTDTFVYTIVDGDGDLSTTTLTISVNNVTVTASDTDALVNEAGLPV
FT                   VGSDAASNSEIFNGAITPSGGTGPYTYTLTSTANGAYGNLVLNADGTYTYTLDTTFDGA
FT                   TLNNGVTTEQDKDSFSYTVTDANGNTTTGTILVDIIDDVPVVLDKTDLIYSNSSNPSPG
FT                   GTGVFDYIIGADSRTTFSSSDSDFSAITLAGMVGATAISTPSVTWASEDSNEAVFDVQF
FT                   SYAANPLTPGVLTEANGTLTFDKVSGTYELTLDEPIESFSILTTSGTLSKESYNLVGPS
FT                   EAQPEIVVSKLAEEFFVRFTGGEEQGGGPVDFKSSDGNTAFTNGETFVGAQAWVSISGS
FT                   SNGVSSDTLQAGEVLNMDFYNSSPGSNGTPGPGTATANGIYLKLDQLGAGEDFVVILKL
FT                   VDASDPTITTTRAIVIDYADIYLSSESNPYGITFVDDSDGVVIIESNDYNSGGSNWVIN
FT                   GVQLLVSTETVTGSGIDLNRATGDAGGSSGTDVFGSDTVDNDVIKISDIGIISTTSDTQ
FT                   DASLDFSFTLVDADGDNTASQTLSVTIEGSSTFEGTASAESITGDGSANVLIGGAGNDI
FT                   LEGGGGADVFKWSLTDQGTVGTPAADVVTDFAAGDTLNLLDLLPGAPGTDLTQYLDVTQ
FT                   EAGGIMIHVTDGTGAASTNDVQTILLASYTTTDTVTDILNELKATQQYTG"
FT   sig_peptide     320128..320184
FT                   /locus_tag="Bpro_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.952 at
FT                   residue 19"
FT   gene            325614..326018
FT                   /locus_tag="Bpro_0305"
FT   CDS_pept        325614..326018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42270"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS2"
FT                   /protein_id="ABE42270.1"
FT                   /translation="MRPAWRARQPASTPLRLQPGRDIGDVLVKLVASAPIEALGGVGNY
FT                   PALAAGLQKAVDRRGGARRHVELQAKLLERRQTRARLANRLNCCPATATMSGFEGGVRG
FT                   VELPPKQPKNSPKVASNMDQSPIDRPVAQP"
FT   gene            326088..330140
FT                   /locus_tag="Bpro_0306"
FT   CDS_pept        326088..330140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42271"
FT                   /db_xref="GOA:Q12GS1"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS1"
FT                   /protein_id="ABE42271.1"
FT                   /translation="MAQFATVAAITGNGSVLAVDVQGRTRVLKVGDTLQKGETVRTVGD
FT                   VRVELLMEDGSLLAVAPAQSIRLDENVVQSDQRPTAQDSAVTTPATADAVIQALERGTD
FT                   LNQSLEATAAGLVPGGGVDGGSSFVQLLRIAEGVSPLAYEYNFVPPELQPDIESIPEPV
FT                   PPTVSVGVTVGVQVGVGEGGPGLITGEMIQGTVSTADVIEGSGGGSKAVTFLITLNQVS
FT                   TTDVTVTYTIVPGTASNPADYFDGAVTGTVTIPAGYIGFFVTENIVGDILVEGNETFTI
FT                   VLSNPIGATLINDTATVTIIDDDHAPVAVDDSNSLTEDQISVSGNVIPNDTDADGQTLS
FT                   VVGPSITATNAYGTLVIDSATGGYTFTLNEATQAAAQALDDGESINMVFADVYQVTDGA
FT                   NLSNLADVSITITGTNDGPIITADPGNEGGNDVVYESGLAIGSDAAAGTEFAFGTFTVS
FT                   DADGLDDIQSVTINGVTVAIGSLVGQSFAGTNGTLTVTAYDAGTGVASYTYELTSPTTD
FT                   VDGTETDVFTLTTSDGTATSAPAAITIEIIDDVPTARADTDSVAEGADTTGNVLTGAGT
FT                   TSGGAGADTAGADGFGAGAVVGVAAGSNTAVPVSGGVGGGIAGTYGTLTLNADGSYTYE
FT                   ANPDAVTSNQTDTFVYTIVDGDGDLSTTTLTISVNNVTVTASDTDALVNEAGLPVVGSD
FT                   AASNSEIFNGAITPSGGTGPYTYTLTSTANGAYGNLVLNADGTYTYTLDTTFDGATLNN
FT                   GVTTEQDKDSFSYTVTDANGNTTTGTILVDIIDDVPVVLDKTDLIYSNSSNPSPGGTGV
FT                   FDYIIGADSRTTFSSSDSDFSAITLAGMVGATAISTPSVTWASEDSNEAVFDVQFSYAA
FT                   NPLTPGVLTEANGTLTFDKVSGTYELTLDEPIESFSILTTSGTLSKESYNLVGPSEAQP
FT                   EIVVSKLAEEFFVRFTGGEEQGGGPVDFKSSDGNTAFTNGETFVGAQAWVSISGSSNGV
FT                   SSDTLQAGEVLNMDFYNSSPGSNGTPGPGTATANGIYLKLDQLGVGEDFVVILKLINPD
FT                   TLETTTRAIVIDYSDIYLSSESNPYGITFVDDSDGVVIIESNDYNTGSSNWVINGAQLL
FT                   VSTETVTGEGIDLNRDTGDTGGSSGTDAFGGDTVDNDVIKISDIGIISTTSDTQDASLD
FT                   FSFTLVDADGDNTASQTLSVTIEGSSTFEGTASAESITGDGSANVLIGGAGNDILEGGG
FT                   GADVFKWSLTDQGTVGTPAADVIKDFTLGGGGDVLDLRDLLQGELAGTDAASATSLSQY
FT                   LHFSEVGGKAVLSVDHDGGSFAATQTITFDNMSLDGLKSGLGLAPSATDTNIIQKLLDN
FT                   GNLNNTP"
FT   sig_peptide     326088..326144
FT                   /locus_tag="Bpro_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.952 at
FT                   residue 19"
FT   gene            complement(330259..331257)
FT                   /locus_tag="Bpro_0307"
FT   CDS_pept        complement(330259..331257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0307"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42272"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GS0"
FT                   /protein_id="ABE42272.1"
FT                   /translation="MKSVPAGWPLGSMGVIGAIGLVWAAGSALAQAPRALEAAALQTPA
FT                   AVLADEPPALRRLMQQAGELESAVDTNDNAWRAAVLYCEASRSGSIEGQYRLGVLYAFG
FT                   KGVPESRPLAAALFSQAASQGHAQAGQMLDSIQLSSAELPACVTQAQLPEKAPTRVFQD
FT                   LQLDMASGNMPSIEHFLQALPARKRWVIPLATTLSAWYSLDPRLVLSVIAVESNFESGA
FT                   QSPKAAMGLMQLIPGTAERFNVRNAYNATQNMRGGMAYLRWLLAYYRGNIAYTLAAYNA
FT                   GEGRVDRYKGIPPYPETRAYVRRVMGLYGRSSHEFDENITDASPWLRPKVP"
FT   sig_peptide     complement(331165..331257)
FT                   /locus_tag="Bpro_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.899 at
FT                   residue 31"
FT   gene            complement(331329..333242)
FT                   /locus_tag="Bpro_0308"
FT   CDS_pept        complement(331329..333242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0308"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42273"
FT                   /db_xref="GOA:Q12GR9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR9"
FT                   /protein_id="ABE42273.1"
FT                   /translation="MSLIKQLWIAIIVVMTIAFGGSMVVSVLSARHYLEQQLQVKNIDN
FT                   ATALALSLSQLPKDPVTVELQVATQFDAGHYRFIRIVSPTGQTVVERVFTGQLQGAPAW
FT                   FARLIPIRAVPGQALIQDGWKQYGTLTLASHEQYVYKSLWDGTLELLLWFVLGSVITGI
FT                   AGTLAIRFITRPLGDVVGQAEAIAERRFLRIAEPRTPELRSVVRAMNSMVERLKALFSE
FT                   EAARLEALRQKVNLDALTGLSGREHFLSQLRELLVGEDSGAEGVLVMLRVNDLNMLNAR
FT                   LGHQRADTLLQQLGGVLKDSMREHSGQQAGRLKGGDFALACPGITSPAQAASELHQRLN
FT                   QAWLPNWVAEVPDLFHLAAVPYQRAESIGDLLSRADEALARAEAEGPNSWHASEADSGS
FT                   TARPAEQWRSLLTEAVASGKLRLAFYRVVGSGSQNAIHQEGVIRLQIDDTGTLLPARDF
FT                   MPMAAHLNLSAPIDLEVVRLAIAHLRTTPGDIAVNLSAETIADFSFRYELRMLLEFHPE
FT                   ICKRLLFEVPEQGVFKQFNAFRDLVLTLKPLGCRVGIEYFGQRFAEGDKLADLGLDYIK
FT                   VHPSYVRDIAHNPGNQEFLKGLCKVARNFGIVVIALGVESDSDLPLLASLGFDGVTGPG
FT                   VK"
FT   sig_peptide     complement(333153..333242)
FT                   /locus_tag="Bpro_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.882) with cleavage site probability 0.210 at
FT                   residue 30"
FT   gene            complement(333319..334014)
FT                   /locus_tag="Bpro_0309"
FT   CDS_pept        complement(333319..334014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42274"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR8"
FT                   /protein_id="ABE42274.1"
FT                   /translation="MWTAAMTRQALRARLVPWGRGCLLALLVALGASIAAPDLDKTQAL
FT                   ALQRYGSRASETVVAWRRLIEESRALPDADKLDKVNTFFNRRVLFESDIAIWQQEDYWA
FT                   TPLEFMGRGAGDCEDFSIAKYLTLQMLGIGNDRLRLIYVRARIGSTTTVAHMVLGFYPQ
FT                   PTDEPLILDNLISSVRPASMRSDLAPVFSFNSAGLWVGGGTSSLADPTTRLSRWRDVLD
FT                   RMRQEGLSP"
FT   sig_peptide     complement(333907..334014)
FT                   /locus_tag="Bpro_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.971 at
FT                   residue 36"
FT   gene            334155..335978
FT                   /locus_tag="Bpro_0310"
FT   CDS_pept        334155..335978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0310"
FT                   /product="Type I secretion outer membrane protein, TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42275"
FT                   /db_xref="GOA:Q12GR7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR7"
FT                   /protein_id="ABE42275.1"
FT                   /translation="MKANFSIIAAAVLTSLAAQAQTLPEPMIDAARKAVVSNPEVQARW
FT                   HGFQAAGNERDVARGGYFPQIDLRAGTGRESRETPLTDYGRYNFRGTTLTLNQMLFDGL
FT                   FTPNEVKRLGYAKLTRYYELQEVSETAALEAVRAYADVVRYRELVDTATQNYVVHKQTT
FT                   GQVEERSSAGVGRRVDVEQATGRLALAEANLLTELTNLHDVSARYLRIVGEKPPEALPK
FT                   LPAKFQIGPMPASTEMLMKDGLPNSPTINAALENVRSMKTAIASRKAAYMPRVDLRLYD
FT                   SRDRNLQGVTGTTRVNGIELVLNYNLFRGGADKARERQAVDLHEQARDLKEKACRDVRQ
FT                   TLSIAFSDVRTLNEQLAYRDQHRLSTEKSREAYLQQFELGQRTLLDLLDSQNEYFQANR
FT                   SYVNASYDQIIAQARTLAGMGQLVTALNVKRGDVPSAQDAGQDRTGIDPAELCPQDETV
FT                   VDTMEKIKAGTVIPPRARATVAPAPGQALPAKISLSADTLFDFDKSTIKAGGTGKLDAL
FT                   VDRLKGVNVDVVIAVGHTDSVGTDAYNQRLSLARADSVKAYLVSKGVDRQRIRTEGRGE
FT                   SQPVADNATAEGRAKNRRVDIEVVEARPAAK"
FT   sig_peptide     334155..334217
FT                   /locus_tag="Bpro_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(336104..337048)
FT                   /locus_tag="Bpro_0311"
FT   CDS_pept        complement(336104..337048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0311"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42276"
FT                   /db_xref="GOA:Q12GR6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR6"
FT                   /protein_id="ABE42276.1"
FT                   /translation="MTECRRPGRRCALARPCLRDDRTTQTPYACAMPANLYALGAIALW
FT                   ISLASLGVSLKHIPPFLLTGMALLMGSLLALPLVLKDRQLWKVPARTFVMGIYGLFGYH
FT                   FLLFIALRHAPPVEANLVNYLWPLLMVVLAPLFLPGVRLRVLHVIAALLGFAGAAIAIL
FT                   GADQGLAGGSGAHGWSWGYLPALGAALIWASYSLLTRRVPAFPTAAIGLFGMVSGLLSL
FT                   LCHFLLEPQVALSGQDWLLLAVTGLGPLGAAFFLWDKALKSGDVRQIGILSYLTPLGST
FT                   ALLLVVSGRALTTSIAVAALLILGAAVLGTRSR"
FT   gene            complement(337118..337855)
FT                   /locus_tag="Bpro_0312"
FT   CDS_pept        complement(337118..337855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0312"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42277"
FT                   /db_xref="GOA:Q12GR5"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR5"
FT                   /protein_id="ABE42277.1"
FT                   /translation="MDRPQGSLSLRRYGASHGSHAHAHFQVLLGLEGVLELEVQGRGRR
FT                   IAAGEGCVIIPGERHDFESKQGSRCLVLDTHHAGWSYCDPSPAQSTEAIALAHYLEQAL
FT                   QQQGSLAHHCGPLLLLQAWQRPAALAEKTARPARHQRAIDWHQLAGWTQLRLHEPLSVA
FT                   QLAAQAFLSPTQFAARCRRETGQSVMQWLRSQRLALALQLQGRGVTVADTALRCGYQSP
FT                   SALTAALRRQKLTESNQADKADQ"
FT   gene            complement(337859..338932)
FT                   /locus_tag="Bpro_0313"
FT   CDS_pept        complement(337859..338932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0313"
FT                   /product="lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42278"
FT                   /db_xref="GOA:Q12GR4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR4"
FT                   /protein_id="ABE42278.1"
FT                   /translation="MSGLPSPSTGSGQTAPDMSTSEATNPVVRDVQALETYNPLAKQKA
FT                   AAKLSRIPVKVERAEVLKKPDWIRVKAGSPTTRFYEIKQILRENKLNTVCEEASCPNIG
FT                   ECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPENLAKTIAALRLKYVVITSV
FT                   DRDDLRDGGSGHFVECIQKIRELSPGTTIEILVPDFRGRDDRALEILKAAPPDVMNHNL
FT                   ETAPRLYKEARPGSDYQFSLNLLKKFKALHPNVPTKSGIMVGLGETDEEILQVMRDMRT
FT                   HNIDMLTIGQYLAPSTSHLPVRRYVHPDTFRMFEEEAYKMGFTHAAVGAMVRSSYHADQ
FT                   QAHAAGVADKADAASAP"
FT   gene            complement(338980..339735)
FT                   /locus_tag="Bpro_0314"
FT   CDS_pept        complement(338980..339735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0314"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42279"
FT                   /db_xref="GOA:Q12GR3"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GR3"
FT                   /protein_id="ABE42279.1"
FT                   /translation="MNMEIRHLGRVDYLPTYEAMQAFTLERTAATPNSLWICEHPPVYT
FT                   QGLAGKIEHVLNPGDIPVVQTNRGGQVTYHGPGQVVAYPLIDLKQAGYYVKEYVYRIEE
FT                   AVIRTLSHFGVTGHRVPGAPGIYVRLDDPFSHARLRPSPQPSPKGRGSSTPVLLPPLPG
FT                   EGGGGGGPDPDPFHSLGKIAALGIKVSRHCTYHGVALNVAMDLEPFSRINPCGYAGLKT
FT                   VDLRTIGVSVTWQEAADVLGQKLSSYLAP"
FT   gene            complement(339926..341122)
FT                   /locus_tag="Bpro_0315"
FT   CDS_pept        complement(339926..341122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0315"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42280"
FT                   /db_xref="GOA:Q12GR2"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR2"
FT                   /protein_id="ABE42280.1"
FT                   /translation="MAEQTQRAGRYIQQLTGYRAFVPEGLPPNPDIEFDGELRTLLSAA
FT                   DRDIARLDAIATLLPNPDLFVAMYVRHEAVLSSQIEGTQSTLEDVLAFEAQGTSNDTPK
FT                   DVEEVINYVRAMNHGLRRLNELPLSLRLLKEIHGELMQNVRGGEKTPGEFRTSQNWIGS
FT                   AGSTLANASFVPPPPHELMNALGMLEKFLHEGKSTVPLLIRCGLAHAQFETIHPFLDGN
FT                   GRVGRLLITLILCEEQALSRPLLYLSVFLKAHRSEYYDRLTAIRDHGHWEQWLKFFLRG
FT                   VSQTARAATQTATDIVKMREAHRNALMKSPKALKLLDSLFQQPLVSPNRIAEIVGCTHP
FT                   TAVKLARDLEERGWLREVTGFERNRLYRYQPYMELFHRETVEATFAAQSPIQTSVGVS"
FT   gene            complement(341239..341562)
FT                   /locus_tag="Bpro_0316"
FT   CDS_pept        complement(341239..341562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0316"
FT                   /product="protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42281"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR1"
FT                   /protein_id="ABE42281.1"
FT                   /translation="MTTSPKNPPTTPPNAAPEPAPRQESLIDYPSLFPIKVMGEKVDGL
FT                   VAAITSVAHQFDPVFDATTIELRESKGGKYLGVTITVTATSREQLDELYRTLSTHPMVK
FT                   VVL"
FT   gene            complement(341559..342461)
FT                   /locus_tag="Bpro_0317"
FT   CDS_pept        complement(341559..342461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0317"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42282"
FT                   /db_xref="GOA:Q12GR0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GR0"
FT                   /protein_id="ABE42282.1"
FT                   /translation="MTSSSPSTLPDTPCYLNGEFTSLKDAKISVLDRGFIFGDGVYEVV
FT                   PAYAGKLFRFEQHMARLSRSLAELRIANPMTHAEWRELTLKLIASYDQSMPADMEKGNQ
FT                   LIYIQVTRGVAMRDHPMPPGLTPTVFVMTNALKLPGAQQREQGVACVTADDFRWEKAHI
FT                   KSVSLLGAVFSRQISVDAGAVETVMFRDNYLSEAASSNVWVVKNGTVMGPPKDQLVLEG
FT                   IRYGLMEEMCRALGLGFELRRITRAEVLAADELLLSSATKEVLPVTLLDGQPVGNGKPG
FT                   PIYASLYAAYQQAKREQST"
FT   gene            complement(342554..343084)
FT                   /locus_tag="Bpro_0318"
FT   CDS_pept        complement(342554..343084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42283"
FT                   /db_xref="GOA:Q12GQ9"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GQ9"
FT                   /protein_id="ABE42283.1"
FT                   /translation="MRAQKSTAPRRTGWTGRLKALLPTRETLSAHPWLKPVAHRLLDPQ
FT                   LWRPHHESVARGVAIGIFWAFAIPFAQFLVAAAHSVWWRANIPVAAGVTLITNPFTIGF
FT                   WLWLAYQVGRPLLDAPPPPTVAEGAGVVAWLTSFGAPAILGMGIFAVGGSITSYMLVKL
FT                   VWRLRIWFKRRHR"
FT   gene            complement(343122..343604)
FT                   /locus_tag="Bpro_0319"
FT   CDS_pept        complement(343122..343604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42284"
FT                   /db_xref="GOA:Q12GQ8"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GQ8"
FT                   /protein_id="ABE42284.1"
FT                   /translation="MAVPLIRERISAMHALMKFLHVVAAIAWLGGVSFMLFALRPAAAE
FT                   LLAPPQRLPLIAQVLRRFFWLVWPAIGILLLSGLAMLLGIGMKNAPLGWHLMLGIGLVM
FT                   FALFGHLYFGPFRRMKQALGNSNWPEGGRRAGQIATLAITNLALGALAIAAVIFLV"
FT   sig_peptide     complement(343473..343604)
FT                   /locus_tag="Bpro_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.727) with cleavage site probability 0.417 at
FT                   residue 44"
FT   gene            343774..344295
FT                   /locus_tag="Bpro_0320"
FT   CDS_pept        343774..344295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0320"
FT                   /product="putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42285"
FT                   /db_xref="GOA:Q12GQ7"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GQ7"
FT                   /protein_id="ABE42285.1"
FT                   /translation="MSKIASSAENSRARHSAQDAWERDEDGALDEGFKPLTREEAQKLR
FT                   EAKPSISPWAVLAGQLVVGVLVACAAWLLTGRPSVGWSAMYGVLAVVVPGALFARGLTS
FT                   KVSAMNPGAAVAGFFLWEMVKIGLTVAMLFAAPRMVSDLSWPALLVGLVVTMKVVWLVL
FT                   WFQSRSNRLA"
FT   gene            344319..345197
FT                   /locus_tag="Bpro_0321"
FT   CDS_pept        344319..345197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0321"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42286"
FT                   /db_xref="GOA:Q12GQ6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GQ6"
FT                   /protein_id="ABE42286.1"
FT                   /translation="MSSEATLATTAQGPTAGEYIGHHLTHWQNKPMSGVIDFSVYNLDS
FT                   IFWALLLGITGSFFMWWAARSATAGAPGRFQAAVEILVEMVDTQARGIIKNTHSRKLVA
FT                   PLALSVFVWIFLMNAMDLLPVDLLPRIWAAIYGAAGHDPHHAYMRVVPTADLSTTLGLS
FT                   TSVLLVCIAYNIKIKGAGGWLHELFTAPFGSHPVLWPVNFLMQMIEFAAKTVSHGMRLF
FT                   GNMYAGELVFMLIALMGGAAAASLSGVLLPVGQILTGAVWAIFHILIITLQAFIFMMLA
FT                   LVYVGQAHDHH"
FT   gene            345269..345517
FT                   /locus_tag="Bpro_0322"
FT   CDS_pept        345269..345517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0322"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42287"
FT                   /db_xref="GOA:Q12GQ5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GQ5"
FT                   /protein_id="ABE42287.1"
FT                   /translation="MEHVLGFVALAAGLIIGLGAVGACIGIGIMGSKYLEAAARQPELM
FT                   NELQTKMFLLAGLIDAAFLIGVGIAMMFAFANPFVLK"
FT   sig_peptide     345269..345340
FT                   /locus_tag="Bpro_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.826) with cleavage site probability 0.734 at
FT                   residue 24"
FT   gene            345549..346019
FT                   /locus_tag="Bpro_0323"
FT   CDS_pept        345549..346019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0323"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42288"
FT                   /db_xref="GOA:Q12GQ4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GQ4"
FT                   /protein_id="ABE42288.1"
FT                   /translation="MSINATLFVQAIVFAILVWFTMKFVWPPIMKALDERAQKIADGLA
FT                   AADKAKSELSVANKRVEEELAKSRGESAVRLAEAERRAQALIEEAKAKATEEGSKIIAA
FT                   AKVEAEQQTVKARETLREQVAALAVKGAEQILRKEVNAGVHADLLGRLKTEL"
FT   gene            346032..346562
FT                   /locus_tag="Bpro_0324"
FT   CDS_pept        346032..346562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0324"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42289"
FT                   /db_xref="GOA:Q12GQ3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GQ3"
FT                   /protein_id="ABE42289.1"
FT                   /translation="MAELATIARPYAEALFKASGSDLGAAAAWLDELAAIAANVQLQQF
FT                   AGNPGVTVTQTFDVISGVAKSQLPDAAKNFLRTVIENGRISVLPEIAAQFRVLKNAQSG
FT                   SSDATVYSAFPLEGPALADLAATLEKRFGRKLNFAVELEPALIGGVRVVVGDEVLDTSV
FT                   KARLEQMKVALIS"
FT   gene            346624..348177
FT                   /locus_tag="Bpro_0325"
FT   CDS_pept        346624..348177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0325"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42290"
FT                   /db_xref="GOA:Q12GQ2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GQ2"
FT                   /protein_id="ABE42290.1"
FT                   /translation="MQLNPAEISELIKSRIEGLTVSADIRNQGTVVSVTDGIVRIHGLS
FT                   DVMQGEMLEFPATADGTPTYGLALNLERDSVGSVILGEYEHIAEGDTVKCTGRILEVPV
FT                   GPELLGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARKSVDQPLQTGLKSIDSMVP
FT                   VGRGQRELIIGDRQTGKTAVAIDAIINQKGKGVSCVYVAIGQKASSIKNVVRSLEQAGA
FT                   MEYTIVVAASASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAYPGDVFYLHSRLLERAARVNEKYVEDFTKGAVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLIKNLSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQAQYSPLSISNMAATLFAVNK
FT                   GFMDDVEVKKVLAFEHGLHAWLKDKNAALMAKLEANKAMDKDAEAELNTAVAAFKKAFA
FT                   "
FT   gene            348231..349097
FT                   /locus_tag="Bpro_0326"
FT   CDS_pept        348231..349097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0326"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42291"
FT                   /db_xref="GOA:Q12GQ1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GQ1"
FT                   /protein_id="ABE42291.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPY
FT                   SDKIRNVAANLSQANPEYTHAFMESNDAKATGFIVVTTDKGLCGGLNTNVLRAVTSKLK
FT                   DLQAAGHDALAVAIGNKGLGFLNRVGAKVVSHATQLGDKPHLEKLIGPVKVLLDAYSEG
FT                   KINAVYLCYTKFINTMRQEPVVEQLLPLTAAHLQADKDQHGWDYIYEPDAQTVIDDLLL
FT                   RYVEALIYQAVAENMASEQSARMVAMKAATDNAGSVIGELKLIYNKTRQAAITKELSEI
FT                   VAGAAAV"
FT   gene            349148..350551
FT                   /locus_tag="Bpro_0327"
FT   CDS_pept        349148..350551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0327"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42292"
FT                   /db_xref="GOA:Q12GQ0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GQ0"
FT                   /protein_id="ABE42292.1"
FT                   /translation="MAQAQGKIVQCIGAVVDVEFARDQMPKIYDALKMEGSALTLEVQQ
FT                   QLGDGIVRTIALGTSDGLRRGNTVYNTGANITVPVGKATLGRIMDVLGAPIDERGPVDQ
FT                   TLTAPIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   INNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLENLGESKVAMVYGQMNEPPG
FT                   NRLRVALTGLTIAESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAE
FT                   EMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLGIYP
FT                   AVDPLDSTSRQLDPNVVGEDHYATARAVQGTLQRYKELRDIIAILGMDELAPEDKLAVA
FT                   RARKIQRFLSQPFHVAEVFTGSPGKYVSLAETIRGFKMIVAGECDHLPEQAFYMVGTID
FT                   EAFEKAKKV"
FT   gene            350564..350980
FT                   /locus_tag="Bpro_0328"
FT   CDS_pept        350564..350980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0328"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42293"
FT                   /db_xref="GOA:Q12GP9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GP9"
FT                   /protein_id="ABE42293.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRI
FT                   KPGAVRIEKEDGTEEFVFVAGGLLEVQPNCVTVLSDTAIRGKDLDETKASEAKAAAEEA
FT                   LKNARSDIDIAMAQSELTVMAAQIAALRKYRQKK"
FT   gene            complement(351506..352048)
FT                   /locus_tag="Bpro_0329"
FT   CDS_pept        complement(351506..352048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0329"
FT                   /product="protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42294"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP8"
FT                   /protein_id="ABE42294.1"
FT                   /translation="MANKLKTFIKHLWMDASDARRAIPPDMLQRVTQRVAASERRHSGE
FT                   IRICVEASLPASYLWRLSQQQPISALTRQRALSLFGKLRVWDTEHNNGVLIYVLLAEHA
FT                   IEIVADRGVARHVSPAQWQAMVARMASAFREKRYEDGLTQALEETSAVLMTHFAVNATQ
FT                   NGSPGQSNELPDTPLLQ"
FT   gene            complement(352055..352984)
FT                   /locus_tag="Bpro_0330"
FT   CDS_pept        complement(352055..352984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0330"
FT                   /product="protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42295"
FT                   /db_xref="GOA:Q12GP7"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP7"
FT                   /protein_id="ABE42295.1"
FT                   /translation="MRRFAGFPIRGGVLLMLAMLLAGWLSLAWAQGVQAVPALTAHVMD
FT                   STGTLDAAQRAALEAKLTAFEQARGAQVVMLIVATTQPEDIAAYAQRVGDTWKIGRKDI
FT                   GDGLLLVVAKNDRKVRIETTKALEGAIPDLAARQIIESAITPRFRQGDFAGGLNAAADQ
FT                   IMARISGENLPTPESKSASRQQDSGFDWMDLAVFLFFAVPIGARIISGVLGRKAGSVAT
FT                   GGAVGVLAWIFTSSLVVAGIAALVGLVFALFASLGSLGRGSRSSGWGGPGTMGGFGSGG
FT                   GSWGGSSGGGFSSGGGGDFGGGGASGDW"
FT   sig_peptide     complement(352892..352984)
FT                   /locus_tag="Bpro_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.853 at
FT                   residue 31"
FT   gene            complement(353005..353610)
FT                   /locus_tag="Bpro_0331"
FT   CDS_pept        complement(353005..353610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0331"
FT                   /product="LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42296"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP6"
FT                   /protein_id="ABE42296.1"
FT                   /translation="MKSRSFSFAGWMMAAALSALLTGCGYNDFQRLDEQTKSAWSEVLN
FT                   QYQRRADLVPNIVATVKGEAAFEQDTLTKVIEARAKATSIQVTPETLNDPAAFNKFQQA
FT                   QGELGSALSRLMVVSERYPELKANQGFRDLRVQLEGTENRITVARNRYIQAVQEYNVLT
FT                   RSFPSNLTAMVFSYSVKPNFNVQNEAQISTPPVVDFKK"
FT   sig_peptide     complement(353539..353610)
FT                   /locus_tag="Bpro_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.468 at
FT                   residue 24"
FT   gene            353693..354544
FT                   /locus_tag="Bpro_0332"
FT   CDS_pept        353693..354544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42297"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP5"
FT                   /protein_id="ABE42297.1"
FT                   /translation="MGNPLQALQASLHPPAFAQPARPRLLVAGVAGVLGSEVLRRLVGS
FT                   GRFAHTEVLVSEPMATGLPAVGIALAAPLPIEQWPARPQPVHTGLVMFEPPRLYNGRER
FT                   TLWTPAPEQLPALARWLKRCGVQTLVIVVPHASGRLPDALKRGLANLDEQAVVALGFER
FT                   VLLVRSARKAEAPAVSGLLEKTAGWMLSTLKYMVPASEQPVRPAKLAEFVDAALRVLPP
FT                   GTHVAAPELLWQAGQSTTTGQSAGQARSMQGVVQAWLAAGHNPKKNSAPDSTPALHRPS
FT                   PD"
FT   gene            354549..354995
FT                   /locus_tag="Bpro_0333"
FT   CDS_pept        354549..354995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42298"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP4"
FT                   /protein_id="ABE42298.1"
FT                   /translation="MSKPKVPPATTGNADDIEAAFYEALQSGDIEKLMACWGDEDEIIC
FT                   VHPGGARLVGAAAIRATFDAMFSNGSIQAHAIKVRKLETMSASVHSVLERIDVLTNEGP
FT                   RHAYVIATNVYHKTAQGWRLVAHHASPGTPREMQEVSDIPPVLH"
FT   gene            355009..356172
FT                   /locus_tag="Bpro_0334"
FT   CDS_pept        355009..356172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0334"
FT                   /product="hydrolase of the alpha/beta-hydrolase fold-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42299"
FT                   /db_xref="GOA:Q12GP3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP3"
FT                   /protein_id="ABE42299.1"
FT                   /translation="MNYSAPWWLPGGNLQTIWAALHSRRFLGPPPQFRRERWTTPDSDF
FT                   VDVDWLVSNAPTLPALGGLLLSEGAGPAGGGPALWPSPPIPASASIPMQEAVSAGATQF
FT                   SAEPRPARPRELHAVKSVEAPLLVVFHGLEGSSASHYAEAFADVARSHGWACAVPHFRG
FT                   CSGELNLAPRAYHSGDFAEIDWILRRFAQRHAGPVVAVGISLGGNALMRWAGEWGADAR
FT                   QVVAGIASVCSPLDLAASGWAIGRGFNRQVYARMFLKTMVPKALKKLEQHPGLFDREKL
FT                   LAARDLYAFDNVFTAPLHGFSNTEDYWARASAKPHLYKIGVPALVLNALNDPFIPVSSL
FT                   PQAADVSGHITLWQPAEGGHVGFPSTPFPGHVRVMPEAVAAFLAAQL"
FT   gene            356230..356802
FT                   /locus_tag="Bpro_0335"
FT   CDS_pept        356230..356802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42300"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP2"
FT                   /protein_id="ABE42300.1"
FT                   /translation="MDDIVRQAIAKWPNVPNCYGWLGLDARGNWYMRDDKAQAAGPFTS
FT                   AGTSGSLAGKGSLLKHDKLIDFIQRNYESDAGGQWFFQNGPQRVYVELEATPLIWRIDV
FT                   APGFAVTAHTGQPARVQRCIVDEHGRLYLDTDLGFGLVHTQDMACAADAVEQGLWVPDE
FT                   LPTRDLPVRFGYVRSPQLLQKSSGMRL"
FT   gene            complement(356885..357751)
FT                   /locus_tag="Bpro_0336"
FT   CDS_pept        complement(356885..357751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0336"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42301"
FT                   /db_xref="GOA:Q12GP1"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP1"
FT                   /protein_id="ABE42301.1"
FT                   /translation="MSANDHTTAHEEAHTGPIKTPQQLLAAVFFSFVIPIFAIIGLVYY
FT                   VTSARGPSAGAVDAEKAVAQRIQKIGMVEIRDANRPLKSGEEVYKAQCVACHAAGAAGA
FT                   PKFGDTAAWAPRLPSGFAALWNSALKGKGAMGAQGGGDFEDVEIGRAVVYMAAAVGGKF
FT                   AEPAAPAAAAQAPAAEAAASPPASVVAALAAANKPAQAAAGSAPAAAGAGEALYKQACV
FT                   ACHAAGVANAPKFGDKAAWAPRIKTGLDALTASVIKGKGAMPPKGGSTAADADIRSAVE
FT                   YMVSAAK"
FT   gene            complement(358129..359451)
FT                   /locus_tag="Bpro_0337"
FT   CDS_pept        complement(358129..359451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0337"
FT                   /product="HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42302"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GP0"
FT                   /protein_id="ABE42302.1"
FT                   /translation="MAALNAWMNGEFVGAWQVNRGTHNFSYAPSWLESEKSRPLSLSLP
FT                   LTRTLEIKGEVVANYFDNLLPDNDKIRERIGRRFRTKTLDAFALLEAIGRDCVGAVQLL
FT                   PEGTVPDGWNHVECEPLTEEQVADALRAVPGDPVARQVNEAPPFRISLAGAQEKTAFVQ
FT                   VDGQWCRPLGATPSTHIFKLPLGVIANTTRVEMFDSVENEWLCAQIIQALGLPMAHTEM
FT                   AMFGDQRALVVERFDRGWMKEGKWIARLPQEDFCQALGLPPRLKYEDDGGPSVADGLKL
FT                   LSGSADAQTDRTAFQLAQLAFWLMAAPDGHAKNFSIFLRQGNAYDMTPLYDVLSVWPYV
FT                   GKGRGQLHLRNARLAMALRSKNTHYDIHTIRARHWHDLAMKNGGPFVWEAMLGLVDRVV
FT                   LALDTVEAQLPQSFPERIWEPISQGMRSQAERFLSEAANVS"
FT   gene            complement(359451..359966)
FT                   /locus_tag="Bpro_0338"
FT   CDS_pept        complement(359451..359966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0338"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42303"
FT                   /db_xref="GOA:Q12GN9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN9"
FT                   /protein_id="ABE42303.1"
FT                   /translation="MHMDFPIHLTSQLREHLRSLRKTHGLTQAALGRLLGVGQARVAEI
FT                   ENNPGAVSVDQLMKVLSALRASLVLRDDVVEVVADRPNAAALHATPQASKPKKPAKQPS
FT                   VNIPPTGQWRTVPLTGGGGHPAKSVLVSRSDTKTPSDAQALRDANPHADVTATSKRNFV
FT                   IRPKKGSW"
FT   gene            complement(360199..361746)
FT                   /locus_tag="Bpro_0339"
FT   CDS_pept        complement(360199..361746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0339"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42304"
FT                   /db_xref="GOA:Q12GN8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN8"
FT                   /protein_id="ABE42304.1"
FT                   /translation="MYSYEDRIRAVRLYIKLGKRTGATIRQLGYPTKNALKSWHREYEQ
FT                   GGNLRVGHVRSRSKYSAEQKRVAVEHYLNHDRFLAGTRKALGYPCRDTLAAWVHELLPE
FT                   TRRKVVGKAQAVLLPREAKQAAVIELCTRQVSAQAIAQKLGVTRPTLYKWKNQLLGREA
FT                   PASMKRSNDSGSTPKPKELTELQQQVELLERDIRRLQLEHDLLKKANELLKKGLGVDMQ
FT                   LLTNREKTLLVDALKELYALPELLAQLDLARSSYFYHRARVKMADKYLAVRQTLTDIFE
FT                   LNHRCYGYRRLQASLTRQCVTISEKVVQRLMKQESLVVAKPKRRRYGSYLGEISPAPEN
FT                   LINRDFHAAAPNEKWLTDITEFQIPAGKVYLSPIIDCFDGLVISWTIGTHPDAELVNTM
FT                   LDAAIETVAGGNDRPVVHSDRGAHYRWPGWLSRIGDAKLIRSMSRKGCSPDNAACEGFF
FT                   GRLKTELFYPRDWKTTTIEQFIQVVDSYIRWYNEKRIKISLGSLSPIEYRESLGLTA"
FT   gene            362086..362589
FT                   /locus_tag="Bpro_0340"
FT   CDS_pept        362086..362589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0340"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42305"
FT                   /db_xref="GOA:Q12GN7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN7"
FT                   /protein_id="ABE42305.1"
FT                   /translation="MTTPAGTPSESAVTPAAPMLVLDRKSNGRAIYDPEAKRALVQQCL
FT                   QPGVSVAATALRAGVNANLLRKWITKHQRGIGERASAPPSTIAGDRMPVVLRCDTAAAM
FT                   TAAPAPGSLAGAPAPITIELHGARVHVASGVDPTTLAAGCGRCAPPHDRAPIGHAGVAG
FT                   RRHH"
FT   gene            362591..362884
FT                   /locus_tag="Bpro_0341"
FT   CDS_pept        362591..362884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0341"
FT                   /product="IS66 Orf2 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42306"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN6"
FT                   /protein_id="ABE42306.1"
FT                   /translation="MRCGFDSLAARIQTALTENPFSGHIFVYRGRRGDLIKLLWWDGDG
FT                   LCLLAKRLERGRFIWPQAESGVISLTSAQLSMLLEGIDWRRPERTWVPQRAV"
FT   gene            363291..363623
FT                   /locus_tag="Bpro_0342"
FT   CDS_pept        363291..363623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42307"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN5"
FT                   /protein_id="ABE42307.1"
FT                   /translation="MRVPAVAPNADPPICSRLAKTCPNNWNWWLRRRQAVEPAIGHLKS
FT                   DHRMDRCWLQGALGNALHSISCAAGYNLRWLLRAIARLDLGTVFFLPVAGGVVAGAGHT
FT                   NVVWRT"
FT   gene            complement(363740..364756)
FT                   /locus_tag="Bpro_0343"
FT   CDS_pept        complement(363740..364756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0343"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42308"
FT                   /db_xref="GOA:Q12GN4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN4"
FT                   /protein_id="ABE42308.1"
FT                   /translation="MNLKELAKSLGVHASTVSRVLNPATRHMVGKEVAAKVLAAAARHN
FT                   FTPNNVASSLRTRRSNIVGIVLPDISNPVFPPILLGIETELRKHGLVALLANGGEDPKQ
FT                   QRTVVDQLLARQVDALILATATRKDRLIDHCLSKNTVVVTINRGEDHGRVSSVMNDELL
FT                   GMRLAFDHLVSLGHTEIVHIVGPQNLSTGYLRRAGFIQAAVANGWQKSKLNMVDCTAYT
FT                   REAGRVACQTLLKTFPKTTAVLAGNDLVALGCYDVLLEKKIKCPRDMSIVGYNDMPFVD
FT                   LVSPALTTVRIRHHEMGIQAAQLILRRIQQGQDGEAEIRLKPELVVRQSTRSPRKQD"
FT   gene            complement(364858..365442)
FT                   /pseudo
FT                   /locus_tag="Bpro_0344"
FT   gene            365514..366179
FT                   /locus_tag="Bpro_0345"
FT   CDS_pept        365514..366179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42309"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN3"
FT                   /protein_id="ABE42309.1"
FT                   /translation="MNRVDANEARSALRAWRAPYADWVDHRTGLGQAHALALVGLAAAQ
FT                   VVQVRHRQAGQALEAAVAMRQCPLEQVHGGRARQRAVGAVHLGQQQGISRGVAPRKHMS
FT                   RAAVALVQALAVQHACQQPGELGARVAAGVPQIAQHHAFIGPIQAGIAQELGHRDDVGV
FT                   ARLIAVGHAKAHLQCAGQEGLKLGGCLQTGFVHVDHHAKNDRPNPAAQAHTSLDKTCR"
FT   gene            366248..366976
FT                   /locus_tag="Bpro_0346"
FT   CDS_pept        366248..366976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0346"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42310"
FT                   /db_xref="GOA:Q12GN2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN2"
FT                   /protein_id="ABE42310.1"
FT                   /translation="MTKGIDRVALVTGGSGGIGRAVAEKLASQGVAVGIAYGNSETKAA
FT                   ETVEKIIAEGGRAFAIKGDVTHAADVKRLFDETEKKFGKISVVVSVTGSFLMRPFAEAS
FT                   EADYDTGMTVNAKGTYLVYSEAARRVVDGGRIIGISSNLVLSGRPGLGLYVAGKAAVEQ
FT                   FSKILAKELGSRQITVNAVAPGPTDTEMLSEAGRKSAPTITPLGRIAQPIEIANVVAFL
FT                   ASPEGGWVNGQVVGVNGGII"
FT   gene            367009..367401
FT                   /locus_tag="Bpro_0347"
FT   CDS_pept        367009..367401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0347"
FT                   /product="DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42311"
FT                   /db_xref="GOA:Q12GN1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN1"
FT                   /protein_id="ABE42311.1"
FT                   /translation="MQNTLSTVDLVILATRLTYGASSVFHGYSKLRGGPKQFAAAWGLP
FT                   PPVAYVVVFTQIICGALFAAGVLTAYAGLGLMMIAAGALGAMLKRGAPFAAPGKLGWDY
FT                   PLMHLIVPLVLVVIGPGRYSLQALVN"
FT   gene            complement(367407..367733)
FT                   /locus_tag="Bpro_0348"
FT   CDS_pept        complement(367407..367733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0348"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42312"
FT                   /db_xref="GOA:Q12GN0"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GN0"
FT                   /protein_id="ABE42312.1"
FT                   /translation="MIVSLKVKSEYLEEFLNSLNEVLDAMRLETTFVNTIACRSPDDPN
FT                   SFLLFETWLNREHFMTTELKRAYRVPHEERLGYMLLEKRELAFWTPIRGDFSFGNGWMQ
FT                   GTPR"
FT   gene            367871..368152
FT                   /locus_tag="Bpro_0349"
FT   CDS_pept        367871..368152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0349"
FT                   /product="YCII-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42313"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM9"
FT                   /protein_id="ABE42313.1"
FT                   /translation="MLFAIHALDKKNSGSLRADAAQEHGAFLGNAAAWGLEIVFSGPLV
FT                   DANSPIGSLLVVEAQEIGIAKKFIEADPLAKAGVYEKVSVTGFLKKRG"
FT   gene            368186..369316
FT                   /locus_tag="Bpro_0350"
FT   CDS_pept        368186..369316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0350"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42314"
FT                   /db_xref="GOA:Q12GM8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM8"
FT                   /protein_id="ABE42314.1"
FT                   /translation="MFATRFSKLQACVMFAGVALAFSAGAQVKVGVFVPLTGDAAGYGQ
FT                   SALEAIQLAVKQKNDAGGVLGQKIELVVRDDGAKPEQSVTVAKRLATSDGVLVMLGSIS
FT                   SPASFAATQVALQTGTPQIVLLGTAQRITTQGNPWVFRGTIPDTKLSGDLVEFIIRKYP
FT                   GKKKVGYLYVNDDFGRGGFEAFKARAESSGLTIVAEEKYAPGDLDFTSQLTKIQSENPD
FT                   VFVDWSRYTEGALVAIQAKRKGMTLPHFGSEGLSHPNFIKLAGDASDGMMYPVPFSMTT
FT                   QSGNNIAVTLAQDIKKTYNKEIEYTHALAYDAMRAVIFAIEKSGTTTDKLKFRDALKSL
FT                   EFDSTRGKFKFDAKGDPTLLPSIVKLSSGKEQDANK"
FT   sig_peptide     368186..368266
FT                   /locus_tag="Bpro_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.904 at
FT                   residue 27"
FT   gene            369335..369733
FT                   /locus_tag="Bpro_0351"
FT   CDS_pept        369335..369733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0351"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42315"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM7"
FT                   /protein_id="ABE42315.1"
FT                   /translation="MKKEFIRGTWQKTRAFSPAVITEGGKTIWIAGHTGQKDDQGNSLA
FT                   ANFDAQTRQTFRNIEATLAQAGATLKDIVTVTVFLTDVRNTTRMTEIRAEVFGSEFPAS
FT                   AAITVTAFADPTMMIEIQGVAVVPAKGV"
FT   gene            369736..370059
FT                   /locus_tag="Bpro_0352"
FT   CDS_pept        369736..370059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0352"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42316"
FT                   /db_xref="GOA:Q12GM6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM6"
FT                   /protein_id="ABE42316.1"
FT                   /translation="MTSPTPVCVEIQFQIKPELEEEFFRQLTAFSHVVASEPECLEFRI
FT                   YRDMADKAKFRVSETWVSLAHFETVQMAKDYYPPYFEKVRDMWAVPIQMTKWTPLVTHQ
FT                   KAD"
FT   gene            370059..370943
FT                   /locus_tag="Bpro_0353"
FT   CDS_pept        370059..370943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0353"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42317"
FT                   /db_xref="GOA:Q12GM5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM5"
FT                   /protein_id="ABE42317.1"
FT                   /translation="MNLSQISELAVAGFAIGCIYALIALGFTMIIRTTGVLHFAQGEVV
FT                   MLGAMAGLTALQFAQLPFIVVLLVGMLFGGLVAVVVEVTVYRWLNYRKAPLANVIIATV
FT                   GVSIVLQNVARLVWGSEARAYPKLFEVDTYTLGSAHIPPQLIWIIVLGAMVMIVLQLFL
FT                   SKTQTGRALQACAQDADAAYLMGIDVRRMTTYTYGIAGLLGGGAGVLLGSMFYASFGMG
FT                   FIVGIKAFVAATVGGLGSIGGAVLGGLVFGLVETATSVVISSAYRDAIGMILLILILLV
FT                   SPGGLAGLRRPQR"
FT   gene            371010..371945
FT                   /locus_tag="Bpro_0354"
FT   CDS_pept        371010..371945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0354"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42318"
FT                   /db_xref="GOA:Q12GM4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM4"
FT                   /protein_id="ABE42318.1"
FT                   /translation="MCAIPLFIQQKYLLHVISLAMIFGIAALSLQLLLGFTGLLSMGQA
FT                   AFLGVGAYTAGILAVKLQYPFLVCFVAAGVVSGLISLILVPITRLKGVYLSVATLGFTI
FT                   AIHLVFLNEEWLTGGSQGLSSIPPPAIGSLAIGGEQGIYYLCLAVAIGSFAAFHLLVSS
FT                   RFGRALQAIKLDEDAARASGINVTLYKSQAFVTAAVFTGWAGALFTYHNQYLNPNDFTF
FT                   WKSIEIVIMVAVGGIGSLAGAVFGAFAVTLLPEVLGDLENYRMIIFGSLVVLCMGLGHS
FT                   GLAGLIGSGFRKWIYFRAAAPAADLQEVPQ"
FT   gene            371942..372718
FT                   /locus_tag="Bpro_0355"
FT   CDS_pept        371942..372718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0355"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42319"
FT                   /db_xref="GOA:Q12GM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM3"
FT                   /protein_id="ABE42319.1"
FT                   /translation="MTQIQVNAMTRRFGGVFAVDQVSTAIPKGEIRGLIGPNGAGKTTL
FT                   LNLISGALAPSSGEMLMEGKVLSNLRADQRAAHGIRRTFQNLKLFGELTVLENVVLGLH
FT                   SSTDSGILDAIFRTPRHRREERWALEQSRQALEMVGLGRVADLQASSLAYGHRRLLEIA
FT                   RAIVSQPKVLLLDEPAQGLNPTEASELVQLLRKINETDMTVVLVEHHMDVIMKACSRIT
FT                   VLNYGRVLAEGTPAEIKNDASVVSAYLGGPVKLAEV"
FT   gene            372719..373447
FT                   /locus_tag="Bpro_0356"
FT   CDS_pept        372719..373447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0356"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42320"
FT                   /db_xref="GOA:Q12GM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM2"
FT                   /protein_id="ABE42320.1"
FT                   /translation="MLDVKDLKVSYGEVPALRGVSLVVKKNEIVTVIGANGAGKSTLLR
FT                   TISGLSKVKGGTIEFDGIAVGSKQPQDVVKLGIAHVPEGRHVFPLLSVEDNLKVGAYLN
FT                   RRKQVIAEDLDRAFSMFPRLAERRHQAAGTLSGGEQQMLALGRAMMTRPRLLLLDEPSL
FT                   GLAPKIVDEVIQTIVKFRSEGVTILLVEQNANLALAIADRAYVMTLGQVTLSGSASEVQ
FT                   ADPAVRASYLGEIANDCMKD"
FT   gene            373453..374319
FT                   /locus_tag="Bpro_0357"
FT   CDS_pept        373453..374319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0357"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42321"
FT                   /db_xref="GOA:Q12GM1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM1"
FT                   /protein_id="ABE42321.1"
FT                   /translation="MNHHLIDSEASVTRFVIAAMSDTQDPRLKRIMECAVQHLHAFARE
FT                   CDLSEDELEAGLRFITEIGQQTHHSHNEVVLAADVLGLSTLVALRNNPSAHGQTAAALL
FT                   GPFWRKDAPICTNGESIARTPSSHPSLEVSGYVRDDAGNPITQAQVDVWQASPTGLYEN
FT                   QDAAQEDMNLRGRFLTDDKGRYLFKTVRPAGYPVPTDGSVGKLLRAQKRHPYRPAHIHF
FT                   MVSAPGHKTLITQVFADDSEYLSTDVVLGVTKALVGMFQEKDGCYSLNYDFVLQEGISK
FT                   FPEPPIK"
FT   gene            374331..375095
FT                   /locus_tag="Bpro_0358"
FT   CDS_pept        374331..375095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0358"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42322"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GM0"
FT                   /protein_id="ABE42322.1"
FT                   /translation="MTISTLPLSGQVAVVVGGGGGIGKAAAGRLARLGARVALLDRADD
FT                   AELKRLADDLPGAGHGGVFAQIDDSETLVAAASAVQARWGRADILVNAAGFTKPIPHKD
FT                   LDALTDELIDQMFAVNWRGQFAAIRAFAPLLRQNGQGLVVNISSIAATTGVGSNVAYCA
FT                   LKAGIDVMASCLGRALAPDIRVMNVSPGVVDTTFVPGRDQAWNDKQAVTTPLRRIGSTE
FT                   DIAAAIEACATTLKFSTGTVLQVDGGRHLGTP"
FT   gene            375107..375985
FT                   /locus_tag="Bpro_0359"
FT   CDS_pept        375107..375985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0359"
FT                   /product="protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42323"
FT                   /db_xref="GOA:Q12GL9"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL9"
FT                   /protein_id="ABE42323.1"
FT                   /translation="MAHKTIITCAVTGNITTPDQHPGLPITPEQISTASLEAAEAGASI
FT                   VHIHVRDPKTGKPSMEVEYYRDVMSRIRSANRKLVINLTTGPGGRFVPSEEDPQVAGPG
FT                   STLLVPEKRVVHIPLLKPDICTLDLNTMNSGEQVVINTPKNVARMAKVIREAGVKPEIE
FT                   LFDSGDIHLAHALIKAGVLEGPGLFSLVLGVKYGFSATPETMLYAKSLLPSGAIWSGFG
FT                   IGGSEFPMVAQSYLLGGHVRVGFEDNLYLEKGVLAPNNAALVTKARNIVESLGGQISNC
FT                   DETRQILSLHP"
FT   gene            376021..376998
FT                   /locus_tag="Bpro_0360"
FT   CDS_pept        376021..376998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0360"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42324"
FT                   /db_xref="GOA:Q12GL8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL8"
FT                   /protein_id="ABE42324.1"
FT                   /translation="MHAIRVHEKAPNIDALSFALVGLEQPSAPAGQCVVKVLSAGVNPS
FT                   DVKAALGAMPHAVWPRIPGRDYAGIVVDGPKGLLGKEVWGSGGELGIRRDGTHATYLLV
FT                   DIDSVREKPKSVSILEAGAVGVPFITAYEGLRRAGLPTKEDVVLVFGGNGKVGQATTQL
FT                   ATRAGAKVFGVELRKESYRGHASADVDMIDASTQDVSEYVKEKTGGKGATIIYNTVGSP
FT                   YFEQANKSLAISGRQIFISTIERAVPFDIFAFYRGQHTYVGIDTLALDSLAGAKIFDEL
FT                   APGFNDGSLKPFPVESDSVFTLDKAVQGYRNVLAGARERVVVQP"
FT   gene            376995..377333
FT                   /locus_tag="Bpro_0361"
FT   CDS_pept        376995..377333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0361"
FT                   /product="Cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42325"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL7"
FT                   /protein_id="ABE42325.1"
FT                   /translation="MNVTRISGAPAYFPPHHEAMHCLRLQGHEAGLSESVWLGMSYLLP
FT                   GGGTSLDASSVEKHYVVLEGEVTVSTEADQVVLKKYDSCRLAAGEKRALANRTNFVACI
FT                   LLAMPYPR"
FT   gene            377357..378289
FT                   /locus_tag="Bpro_0362"
FT   CDS_pept        377357..378289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0362"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42326"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL6"
FT                   /protein_id="ABE42326.1"
FT                   /translation="MATSVLKVLAFDGGYNVPIWVAQKFGFFESNGLQVELSFTPNSGA
FT                   LVQALMTGSADIALAGFDNFVAYQEGQGEAALELPPDIFSFMGGDSGFLTLVAKGEVTS
FT                   MERLKGKKVSVDAMTTGFAFALREILEKEGLRDGDIEYVKAGGTAQRFLGLMAGQYDAT
FT                   LLRTPYEMLAMDRGFVALTTVREQLGHYMGTVGATRRAWASSHESQLLQFIVSYRAALD
FT                   WLYTPGNRNTAVELLVEKVAGLDTAIASSALDLLLDEQEGLIADMRIDPMSVQTVLKLR
FT                   SKYGTPQKDLIDPTKYLDRSYLIKAFNAG"
FT   gene            378318..379286
FT                   /locus_tag="Bpro_0363"
FT   CDS_pept        378318..379286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0363"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42327"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL5"
FT                   /protein_id="ABE42327.1"
FT                   /translation="MKLFTTLLLSISAAFSLPALAQPYPTRPVKILVTAGAGSSADLLA
FT                   RIAADELGKRLGQPFIVENKPGAGGNIAADVVAKAKPDGYTLLMATVSTHGINPSLYVK
FT                   LPFDPVKDFAPIGLLASNPNVLVVSPSLPVNNLQELIALAKKTPDGLTYSSGGTGTSQH
FT                   LAAEIMAAEAGIKLTHIPFKSAPESLNAMLSGQVVMSFASIPVALQQVKAGKLKAIGVT
FT                   ANKSAPAWRDLAPPLASQGLPGYDVSAWFGLAAPAGTPADIVKRLNSESTAAFKTSAVQ
FT                   TKLESLGMEELSSTPQYFDSFIRSEIVRWSKIVKQSGAKPE"
FT   sig_peptide     378318..378383
FT                   /locus_tag="Bpro_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            379293..380465
FT                   /locus_tag="Bpro_0364"
FT   CDS_pept        379293..380465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0364"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42328"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL4"
FT                   /protein_id="ABE42328.1"
FT                   /translation="MTSSVPKQGLRKPNLIFTLNKRVTATFVLVALSLANVAHAAELVV
FT                   GQVGPFVGLQAPQAKAYAAGMNLVFDAANRIRGATNTFRLVRRDDGGRAEDTVSVTRKL
FT                   IEDEKPIILAGFFGSKNLALLSGSGLLEREKIALVGYRTAELQIDDPQFFSVRAGISEE
FT                   IARITQHLSTIGIRDLGIFYEEGAGATRLVAVADELAKKTGVAFAVRASYSPGTARVTS
FT                   AVELFLKRPPQAILLVTSSAAAAGFIEQYRTAGGAAKIFSHSGVDIEQLNRQLTEEQLQ
FT                   GVAIAQVTPSPYKNSSSLSKEFADAVAASADKGLPVSYAMMEGYIAGKVIVEAVRRQGS
FT                   KVSRQTMMATLDALAAFDLGGYAIGFKPGSHTGSKFVELSIVTSSGRIRQ"
FT   sig_peptide     379293..379415
FT                   /locus_tag="Bpro_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 41"
FT   gene            380493..381017
FT                   /locus_tag="Bpro_0365"
FT   CDS_pept        380493..381017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0365"
FT                   /product="transferase hexapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42329"
FT                   /db_xref="GOA:Q12GL3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL3"
FT                   /protein_id="ABE42329.1"
FT                   /translation="MAIYSLNGVAPQISESAWVEKSATVIGNVELQNDASVWFGAILRG
FT                   DSDKIHVGKGSNIQDRSVFHVDKGQPLHIGNFVTIGHGVTLHGCSIGDGSLVGINAVIL
FT                   NGAMIGKNCLIGAGSLVTEGKEFPDGWLVVGSPAKAIRPLTREQIAGLERSARHYMNNA
FT                   VLFRTSCLGIA"
FT   gene            complement(381641..382393)
FT                   /locus_tag="Bpro_0366"
FT   CDS_pept        complement(381641..382393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42330"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL2"
FT                   /protein_id="ABE42330.1"
FT                   /translation="MSLYPLPLEVLQINAQLKKPTLEPAPSQTILALEQAFDTLMKWCD
FT                   ERLLFIGGSLEVMVIYAPLRPMTTRQRRQLRQRIESQVGVTGCQMEVVDLLSIHSLRVK
FT                   AACLEALSQAQRYLADRIADCADALAGLDPSASRSWSASVDRAGASLALENWSLQIWLS
FT                   ISRPDRAPVPEFNSFVHKTIELRDVEAFIPDWLGLHWSRVEIERDLSVGQWVAETHGWR
FT                   VNVYGRPTAQLTHREVMLRLMGAVCAAW"
FT   gene            complement(382390..383400)
FT                   /locus_tag="Bpro_0367"
FT   CDS_pept        complement(382390..383400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42331"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL1"
FT                   /protein_id="ABE42331.1"
FT                   /translation="MTQTKSLFHSQRPLHQKRVDRPHPSELSQPSLPMGVWLPRRPRHP
FT                   ASDGFNRHAASNQPSYVYLFVHATENRFKIGKSKSPTDRLAQLPEAGQIDGTQSLRVAL
FT                   PDRQRAGQVESLLHKGLAGYRLQLSWMSASGMFKVQSQPWDGATEWFSLTGLRHAIELL
FT                   RAVPGLHDAEGALLQTLDGQPYWLDRLDDHRSLQDQRRHEAGRYNLGRLEHVCDVLMQI
FT                   KRHLDFCWTESSDQKASAGTLRIKGFKPWWTIEHLAPRLALTSHELWALKTGKLPSKPD
FT                   GAMQAFTPLVKLIRYAGDEPKDLELVLNAMERIRKLPAGAVIARRWAAFREVITS"
FT   gene            complement(383415..383873)
FT                   /locus_tag="Bpro_0368"
FT   CDS_pept        complement(383415..383873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42332"
FT                   /db_xref="GOA:Q12GL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GL0"
FT                   /protein_id="ABE42332.1"
FT                   /translation="MPENIPPAPPEIPSTPTGKDSKSAPLDLSLMAFFALLMGLPLILF
FT                   LFWIGGSWWQSEVVSSRPIGNFIHMSGPGGLQSRVVIETDSGFYPLLQAPVISKGTSLV
FT                   LELRGSGQRFVCDLPRTLCIKTTPDEFTRSDQPLNPSDPVAPSHPAKP"
FT   gene            complement(384019..384741)
FT                   /locus_tag="Bpro_0369"
FT   CDS_pept        complement(384019..384741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42333"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK9"
FT                   /protein_id="ABE42333.1"
FT                   /translation="MKPRPILIHSSPAQPMSGKPLMNKPIPSRIHRTHRDNPVASAQMD
FT                   QGLPPGLPPLSELPGHTRPFYGKPMTEEFVKNFLGNKAVVDAYYHPKVIAGVASAGDPA
FT                   QRSDLPTLIPMAMAMRAASRAAAMELIKPHERPLVHLATMVYPCGLFFCAYLDDPHALA
FT                   VGPQFHEVALMRSMLLELPLKKLKGRHTAMGNTLAAVLGLAHSAEDVDLEQVSRLATAV
FT                   HLANARITTLWAPPEPAA"
FT   gene            complement(384738..385148)
FT                   /locus_tag="Bpro_0370"
FT   CDS_pept        complement(384738..385148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42334"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK8"
FT                   /protein_id="ABE42334.1"
FT                   /translation="MTKQSRKPTPSAKARQTPAADQPSLARIHDLASFAAISIPPELRQ
FT                   ILGEEEYESHIKEMEAIEIGWIIRVPKDVVYLRSRVVTVPFGGQKQVQAPDPQASKVDA
FT                   KAKEKGTSAAAPRPKQSSRTPAKSARKPRGQA"
FT   gene            complement(385272..386687)
FT                   /locus_tag="Bpro_0371"
FT   CDS_pept        complement(385272..386687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0371"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42335"
FT                   /db_xref="GOA:Q12GK7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK7"
FT                   /protein_id="ABE42335.1"
FT                   /translation="MGSIRRLESQGTLFMDFRYAGQRLREYTMLPDMPANRKRLQKALD
FT                   RIETDIALGTFDYEKTFGKPLPQPEPKTKDGSVDRTARSDGLPVLSRNGTPLFGEFAQQ
FT                   WFTEVEVSWRRSYRITQKGALDKYLLPFFGDKEVGHITKADVLAFRASLAKVTTRKSQG
FT                   TLSNRRVNAVMKPLRQILNEAADRFEFNSAFRNIKPLKMKRSDVQPFTLDEVELILNTV
FT                   RVDYRNYFNVRFFTGMRTGEAHGLKWKYVDFERRLILVRESIVLNEEDELKTDGSVRDI
FT                   HMSQVVYDALKAQYQAAGEFSEYVFCSRSGQPINNQNFLNRVWNPLLRHLGLEHRRAYQ
FT                   MRHTAATLWLASGEAPEWIARQLGHTSTEMLFRVYSRYVPNLTRQDGSAMERLLASRMS
FT                   TGANVRADNPPAPVNKVVPQPLPKLRGITGGRATRPKSGRTNVLPDYFGDAEPQPPPAW
FT                   HRAPVNGTGPRHA"
FT   gene            complement(386680..386919)
FT                   /locus_tag="Bpro_0372"
FT   CDS_pept        complement(386680..386919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42336"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK6"
FT                   /protein_id="ABE42336.1"
FT                   /translation="MSEVTYLTTDELSSRIKYDSRTIRERLKDSVLLEGRHYIRPFGGR
FT                   KTLYIWEHIENDMGQVSGSGPVSIPMANGGVLHG"
FT   gene            387070..387285
FT                   /locus_tag="Bpro_0373"
FT   CDS_pept        387070..387285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0373"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42337"
FT                   /db_xref="GOA:Q12GK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK5"
FT                   /protein_id="ABE42337.1"
FT                   /translation="MIKCHLSKLMGERKLKISDVARDTGLHRNTVTLLYQETATRIDIE
FT                   AMDALCRYFSVRVGDLFEFIDNSTPA"
FT   gene            387538..387978
FT                   /locus_tag="Bpro_0374"
FT   CDS_pept        387538..387978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42338"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK4"
FT                   /protein_id="ABE42338.1"
FT                   /translation="MRTGQSVEVDFRGLVNWVRLGNQLTHQIHPYPAKLLPHIAHFFAR
FT                   ASTYTGKQGRILDPFCGSGTVALEASLAGHKPLVADANPLALLITRVKTTPYNLEELRA
FT                   SLDSLLKRVVRYRTAPNISVVNDQLWYSSTLHSCGPCSTRLR"
FT   gene            complement(388483..388857)
FT                   /locus_tag="Bpro_0375"
FT   CDS_pept        complement(388483..388857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42339"
FT                   /db_xref="GOA:Q12GK3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK3"
FT                   /protein_id="ABE42339.1"
FT                   /translation="MRGESAALKKASAQYRSDIAGLKRQVRDLERQVVRLSKGMTTQRP
FT                   SLPEEQTPVKARFGAKGFAAQRRRLGLSASELGFLLNCSGQSVYKWEQGKARPRASQMP
FT                   AIAALRKLSKSQAVKVLEAR"
FT   gene            388898..389173
FT                   /locus_tag="Bpro_0376"
FT   CDS_pept        388898..389173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42340"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK2"
FT                   /protein_id="ABE42340.1"
FT                   /translation="MAIFGIGKYYKVLVAANPATGEPNSPFNHMTASAIGCLHFMQMDF
FT                   LPCRSSSVPPPPAVDFLSLSFPSKLTRLPQSMAGCRGSRAMPFSQN"
FT   gene            389233..389478
FT                   /locus_tag="Bpro_0377"
FT   CDS_pept        389233..389478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42341"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK1"
FT                   /protein_id="ABE42341.1"
FT                   /translation="MRFFTKKRPNSSPHQGISTLKFQENKAVAVLKPEQDEVVVASGQH
FT                   VARPLPSKVRDASRLAVVVGPLPAADLTCSMHLRIL"
FT   gene            389805..389880
FT                   /locus_tag="Bpro_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            389805..389880
FT                   /locus_tag="Bpro_R0002"
FT                   /product="tRNA-Arg"
FT   gene            390220..391011
FT                   /locus_tag="Bpro_0378"
FT   CDS_pept        390220..391011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0378"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42342"
FT                   /db_xref="GOA:Q12GK0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GK0"
FT                   /protein_id="ABE42342.1"
FT                   /translation="MTSTIRQPPAVSSLFNQSLEKGLAVLRAFDAAHRTLTLAELATLT
FT                   GMSKGSAQRTVHTLQQLGYVGKHPQTRRFQLLPRVIEIGFNYLAAHPLIRVANPYLSQL
FT                   ANASGETASLTEPVGLDMVYVAQLVTSKFIPVHTPVGMRIPMYCTSSGRAWLSALPDAQ
FT                   VRAVLEASTRVARTPYTLTDVDAILARVAACRQVGYASNCEELFLGDMGIGAPILDSNG
FT                   QAVAAVHLSPPTSRWTMEEAQRKLSPMVIECARAISQSIAH"
FT   gene            complement(391055..392302)
FT                   /locus_tag="Bpro_0379"
FT   CDS_pept        complement(391055..392302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0379"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42343"
FT                   /db_xref="GOA:Q12GJ9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ9"
FT                   /protein_id="ABE42343.1"
FT                   /translation="MDTGVTPRIDATRLWQSLMDLAQIGATPKGGVRRLALTDEDRQGR
FT                   DLVARWCREAGLEVRIDEVGNMFARRAGRDPQARAVATGSHIDTQPSGGKFDGNYGVLA
FT                   GLEVMRTLDDLGIETRAPLEVVVWTNEEGSRFTPVMMGSGAFAGLFNPDFVHTQKDRAG
FT                   ISVGDELQRIGYRGTQPCGAVPGGMFAAYFEAHIEQGPVLEAQGLPIGIVSGALGQQWY
FT                   DVTVTGMDAHAGPTPMELRRDAMLAAARMVEAVNRIALDEAPHGRGTVGFVQVQPNSRN
FT                   VIPGCVQFSVDFRNPSQGGLDRMDAAMHAQFTRIAGDGKVAVEIRQVVKFEPCLFDSAC
FT                   VASVRRAAQALGLPHMDVVSGAGHDAVYVAGVAPAGMIFVPCKDGISHNEIEDALPEHI
FT                   AAGANVLLLAMLERAQ"
FT   gene            392541..394241
FT                   /locus_tag="Bpro_0380"
FT   CDS_pept        392541..394241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0380"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42344"
FT                   /db_xref="GOA:Q12GJ8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ8"
FT                   /protein_id="ABE42344.1"
FT                   /translation="MSTHTLPSTPAKRHFACSLAPASALSLALAATLGLTATVALAQEK
FT                   TLRIAMTAADIPRTLGQPDQGFEGNRFTGIPIYDSLTQWDLSKANAPSVLIAGLATSWA
FT                   VDAKDKTKWVFKLRPGVKFHDGSAFNADAVVWNVAKVFDKEAPQFDPSQVGVTASRMPT
FT                   LRSARKIDDMTVEFTTSEPDSFLPINLTNLFMASPAQWDAKLKAVPASVTAPAERSKAA
FT                   WTAFAADPAGSGPFKVTRFVARERLELAAHKTYWDARRVPKIDKVVMLPMPEANARTAA
FT                   LLGGQVDWIEAPAPDAMPQIKQRGFTIYSNAQPHVWPWQLSFAEGSPWLDKRVRQAANL
FT                   CVDRGGLSQLLGGMMAEPKGTVPPGHPWWGNPKFDIKYDVKGAQALMTQAGFSAAKPVK
FT                   VKVQISASGSGQMQPLPMNEFMQQSLKQCFFDVQFDVIEWNTLFTNWRKGAKDPSANGA
FT                   NAVNVSFAAMDPFFAMVRFVSTKTFPPVSNNWGYYGNADVDKLVADARTSFDEKSRDAA
FT                   LARLHAHIVEDAPFVWVAHDVGPRAMSAKVKNVVQPKSWFIDIATMTMD"
FT   sig_peptide     392541..392669
FT                   /locus_tag="Bpro_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 43"
FT   gene            394302..395255
FT                   /locus_tag="Bpro_0381"
FT   CDS_pept        394302..395255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0381"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42345"
FT                   /db_xref="GOA:Q12GJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ7"
FT                   /protein_id="ABE42345.1"
FT                   /translation="MQRYLLSRVLYALPIMLGVAFVCFALVHLAPGDPLMSILPPDASA
FT                   ELQAQLRELYGFNRSLPEQFALWVWRALQGDLGVSIASNRPVATEVLTAVGNTLRLAVV
FT                   ATTIGFVLGCLFGFVAGYFRNSWIDRLASMLSVMGVSVPHYWLGMVMVIVFSSQLAWLP
FT                   GTGAGPAGSGDWSWDWGHLQFLVLPALTMSVIPMGIIARTVRALVADILDQEFIVGLRA
FT                   KGLTHTGVFFHMLKNAAPTALAVMGLQLGYLLGGSILIETVFSWPGTGFLLNSAIFQRD
FT                   LPLLQGTILVLALFFVLLNFLVDVLQTLLDPRIART"
FT   sig_peptide     394302..394391
FT                   /locus_tag="Bpro_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.891) with cleavage site probability 0.521 at
FT                   residue 30"
FT   gene            395281..396216
FT                   /locus_tag="Bpro_0382"
FT   CDS_pept        395281..396216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0382"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42346"
FT                   /db_xref="GOA:Q12GJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ6"
FT                   /protein_id="ABE42346.1"
FT                   /translation="MAALTASSSADAGISSASAAPAMPSASLPAQRSRGYWTAAMLRFV
FT                   HDPVAVGAVLVVLMLIAMAIFGPWLAPADPYDASMLKRLKPIGTAGLPLGSDELGRDML
FT                   SRLIMGARLSLFIGITPVILAFFTGSVIGIVAGYAGGIVNTAIMRTIDVFYAFPSVLLA
FT                   IALSGVLGAGVVNSLISLTIVFIPQIARVAESVTTQVRGRDYVEAARASGANAFTIVRV
FT                   HVLGNVLGPIFVYATSLIAVSMILASGLSFLGLGVKPPEPEWGLMLNTLRTALYVQPWV
FT                   AALPGVMIFITSIAFNILSDGLRSAMDNKG"
FT   sig_peptide     395281..395340
FT                   /locus_tag="Bpro_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.798) with cleavage site probability 0.749 at
FT                   residue 20"
FT   gene            396218..397258
FT                   /locus_tag="Bpro_0383"
FT   CDS_pept        396218..397258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0383"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42347"
FT                   /db_xref="GOA:Q12GJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ5"
FT                   /protein_id="ABE42347.1"
FT                   /translation="MMQQTPDVGGPAQPLLTIRGLQKHFAIKGGPLGGGGDVVRAVDGI
FT                   DFEVLKGETLGVVGESGCGKSTTARLMMQLIEPTAGEVIFDGRSVGGRDLPVKEFHRQV
FT                   QMVFQDSYASLNPRLTIEDSVAFGPQVHGVSRAEAVIRARDLLARVGLEPQRFAERYPH
FT                   ELSGGQRQRVNIARALALQPRMVILDEAVSALDKSVEAQVINLLLDLKAEFGLTYVFIS
FT                   HDLNVVRYISDRVMVMYLGQVSEIGPSDALYDKPQHPYTRALLSSIPSMDPDHRTEEAA
FT                   LAGDPPNPINPPSGCRFHPRCDMVAPVCSQRVPARVAVGTRQAVSCLMYEPGSGHPSAP
FT                   QLALAA"
FT   gene            397312..398379
FT                   /locus_tag="Bpro_0384"
FT   CDS_pept        397312..398379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0384"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42348"
FT                   /db_xref="GOA:Q12GJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ4"
FT                   /protein_id="ABE42348.1"
FT                   /translation="MPDTPPLTSSAAEPMVSLRDLSVTFTGGRKPVHAVSGVSLDVQRG
FT                   EVVALIGESGSGKSVTLRTLLRLHNERRTQVGGQVRVAGRDVLTMSQRELADFRGKVAS
FT                   MVFQEPLLALDPVYSVGAQIIEALRRHDRLSQAEAQQRALALFERVRIPSPQRRLQAYP
FT                   HEMSGGMRQRAMIALALACKPQLLLADEPTTALDATVQIQILLLLRELQRELGLSVVFV
FT                   THDIGAAVEVADRIAVMYAGRIVEEGTARELIRSPRHPYTMALLQSRAHGAMTRGTRLE
FT                   TIGGAPPDLSALPPGCAFAERCRLATEACCIAQPPAVELAPGHRARCIHTDAAAGLSTM
FT                   LAVPTPAPMRPVMLS"
FT   gene            398447..399631
FT                   /locus_tag="Bpro_0385"
FT   CDS_pept        398447..399631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0385"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42349"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ3"
FT                   /protein_id="ABE42349.1"
FT                   /translation="MPLHDPAHAFVPYPDVPVPSAFTGPLADLRFGVKDLFDVAGYPTG
FT                   GGSPTVLALSGIKTRTAPTVQKLLDAGALFAGKTVTDELAFSMNGNNAHFGAPLNGAAH
FT                   DRITGGSSSGSASAVSSGLCDFALGTDTGGSVRAPANHCGLYGLRPTHGRVSLESVLDL
FT                   APSLDTCGWFARDVGTFVRVGDVLLGEDVTPLPADVRLLWPEDVWAMMDAPARRVLESG
FT                   AAQSVQSLLGPTTPVQVVRESWDAMYWNFRYVQSREAWLTDGPLIERYAPSLGPGVAER
FT                   FAWSCNVTDEQVNAARAFRAAFRAQLAGLLGDDGVLLMPTMPDIAPLRSASEASLEDYR
FT                   NRAIRMLCIAGLAGFPQLSMPMARHEGAPLGLSLLGPAGRDRSLLALAVRIASS"
FT   gene            complement(399637..400269)
FT                   /locus_tag="Bpro_0386"
FT   CDS_pept        complement(399637..400269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0386"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42350"
FT                   /db_xref="GOA:Q12GJ2"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ2"
FT                   /protein_id="ABE42350.1"
FT                   /translation="MYPACCQIMQITNTSQSGQNPAAARPTLQPQLLTAGGFAPFGTVV
FT                   EPFAPPGSPDALPPQGARAINSGTTWRLDVVHDLGLNHEGGTPGLAVYSASARQFPIRL
FT                   EVLERHQLGSQSFLPLTGARFIVVVAAAGPAPDAAQLKAFYTTGRQGVVLHRGTWHHAL
FT                   LAVEPGSFAVIERHQSSHESAVDCEVAALPSSVWLELPGAQDGTIKD"
FT   gene            complement(400568..401257)
FT                   /locus_tag="Bpro_0387"
FT   CDS_pept        complement(400568..401257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0387"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42351"
FT                   /db_xref="GOA:Q12GJ1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ1"
FT                   /protein_id="ABE42351.1"
FT                   /translation="MIQFYFHPSPNPLKVALFLEESGLPYEVVPVDTRKGEQHLPAFLR
FT                   INPNAKTPAIVDGDATVFDSNAILLYLAEKSGQFLPESTPAARGQMLSWLMFVATGIGP
FT                   YSGQAVHFKHFAPEPKEYAVNRYLFEAERHYGLLDAQLAKHPYMLGETYTLVDMAVWGW
FT                   ARALPFILGPDAWAKLPNLKRHFDGITARPAAQRAEALKSRFSFKAEMDDAARKHLFPQ
FT                   NARLAGY"
FT   gene            401571..402065
FT                   /locus_tag="Bpro_0388"
FT   CDS_pept        401571..402065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0388"
FT                   /product="putative lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42352"
FT                   /db_xref="GOA:Q12GJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GJ0"
FT                   /protein_id="ABE42352.1"
FT                   /translation="MKAVKTVSSAAFAVLAALLMAGCAATAVRPGMSREEVVAHYGTPS
FT                   RVLPLGTGTRLQYSAQPAGQTAVMVDLDAAGKLVAARQVLNLDEFSKIEVGKWRREDVE
FT                   REFGRPATVDRVGSWSGDVMTYRWLDLDTSKYFWVYLDAGNVVRRTSQGMEIPIRMNDN
FT                   N"
FT   sig_peptide     401571..401651
FT                   /locus_tag="Bpro_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.573 at
FT                   residue 27"
FT   gene            complement(402105..403334)
FT                   /locus_tag="Bpro_0389"
FT   CDS_pept        complement(402105..403334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0389"
FT                   /product="Drug resistance transporter Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42353"
FT                   /db_xref="GOA:Q12GI9"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI9"
FT                   /protein_id="ABE42353.1"
FT                   /translation="MNPNADQLWRAPRWTLAVLLAVLGMLGPFSIDTYIPAFSGIATAL
FT                   GASPVEMQQTLSAYLFGFAFMNLFHGALADSFGRRPVVLWGIAVFTLASAGCALSQSIG
FT                   QLVFFRALQGLSTGAGIVVSRAVIRDMYPPAQAQQVMSQVTIYFGVAPAIAPLMGGWLF
FT                   VHLGWHSIFWFLTGVGATLWAANFRFLPETLRSEERQPFEVRHLMRGYWQLGSSPRFLL
FT                   LALASGVPFNGMFLYVLAAPAFLGQHLSLQPTEFFWFFILTISGIMSGAWLSGRLAGKI
FT                   APKRQIRHGFVIMLVTSLVNLAANLLFAPHVSWALFPIAVFAFGWALMVPVVTLLVLDL
FT                   YPERRGMASSLQAFIGSTANGLVAGLIAPLVMHSTPALATVSLGMMCIGLVSWAYLHHR
FT                   WPEIGRAVSL"
FT   gene            complement(403331..404170)
FT                   /locus_tag="Bpro_0390"
FT   CDS_pept        complement(403331..404170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0390"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42354"
FT                   /db_xref="GOA:Q12GI8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI8"
FT                   /protein_id="ABE42354.1"
FT                   /translation="MQHYPEAMLYVVATPIGNLADISLRALHVLQLVDAIACEDTRHTQ
FT                   TLLRHYGIEKPLLAVHEHNEAQAAGLVIERMQRGERVAYVSDAGTPAVSDPGARLVAAI
FT                   RAAGLKVMPLPGASSVTTALSVAGLTGDSGFVFAGFLPSKAGERDQAVAALQADTRATV
FT                   ILEAPHRIEALARALAVLQGRLVTVGRELTKQFEEIATVPAQDLATWLAAAPQRTRGEF
FT                   ALVLHAAAAQETPEDGTRVLQLLLAELPLKTAVKIAAEITGAPRNELYDTALKLKKA"
FT   gene            404221..404670
FT                   /locus_tag="Bpro_0391"
FT   CDS_pept        404221..404670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0391"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42355"
FT                   /db_xref="GOA:Q12GI7"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GI7"
FT                   /protein_id="ABE42355.1"
FT                   /translation="MWFSRKQVVKPPPDGSRAQPGQVTTKSRGDAAESAAQVFLARAGL
FT                   IPVESNYRTPGRGGGEIDLVMRTPDGTLVFVEVRQRSGASHGGAAASISPAKQQRIIFA
FT                   ARHYLMRFASPPPCRFDVVLVHGGPGQGPVENGRLEWLPAAFDAS"
FT   gene            404810..405409
FT                   /locus_tag="Bpro_0392"
FT   CDS_pept        404810..405409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0392"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42356"
FT                   /db_xref="GOA:Q12GI6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI6"
FT                   /protein_id="ABE42356.1"
FT                   /translation="MLEQRIEQHFIDSADLKYQAAHILSKPISAAIQAILASVTSGGKV
FT                   LACGNGGSAADAQHFAAEFVGRYERERPELGAIALTTDSSIITAIANDYDFNVIFSKQV
FT                   RALGGAGDVLLAISTSGNSANVLAAVEAAHEREMTVVALTGRGGGKMTHALRETDVHIC
FT                   VPHERTARIQEVHLLVLHCICDGVDTQLLGDQENPA"
FT   gene            405406..406074
FT                   /locus_tag="Bpro_0393"
FT   CDS_pept        405406..406074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0393"
FT                   /product="transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42357"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI5"
FT                   /protein_id="ABE42357.1"
FT                   /translation="MKYSVMKRLALFVCATAAVAGGLTACVPLAMGGAAAGTALVVTDR
FT                   RTSGAQLEDEGIELRAASRIRSNLGTRVRVNVTSYNRQVLLTGEVPNAQDKQLVEQVVS
FT                   RVENVVSVVNELAVLDSPSLMERSSDLLVTGRVKAMLLDARDLQSNAFKVVTERGTTYL
FT                   MGRVTQREADRATEVVRATPGVQKVIRLLEIISEEELARIRVGAAPAQPQAAAAKPSSN
FT                   "
FT   sig_peptide     405406..405516
FT                   /locus_tag="Bpro_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.746 at
FT                   residue 37"
FT   gene            complement(406162..407076)
FT                   /locus_tag="Bpro_0394"
FT   CDS_pept        complement(406162..407076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0394"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42358"
FT                   /db_xref="GOA:Q12GI4"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI4"
FT                   /protein_id="ABE42358.1"
FT                   /translation="MSSINTKTYEPSSPRKVAFLGLGVMGYPMAGHLALAGHQVTVYNR
FT                   SPARSTAWCAEFAATARPSSATVPRLAAAGADVVFSCVGNDDDLRSVTLGPDGAFAGMK
FT                   PGAVMVDHTTASADVARELHAAAQQLGLHFIDAPVSGGQAGAQNGILTVMCGGDAAAFE
FT                   SIKPAGMAFSRAFTLMGDSGAGQLTKMVNQVCIAGLVQGLSEAIAFGQKAGLDMNQVLD
FT                   VIGKGAAQSWQLDNRGKTMAADQFDFGFAVDWMRKDLGLVLDEARRNGARLPVTALVDQ
FT                   FYADVQAMGGRRWDTSSLIRRLK"
FT   sig_peptide     complement(406966..407076)
FT                   /locus_tag="Bpro_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.692 at
FT                   residue 37"
FT   gene            complement(407163..408299)
FT                   /locus_tag="Bpro_0395"
FT   CDS_pept        complement(407163..408299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0395"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42359"
FT                   /db_xref="GOA:Q12GI3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI3"
FT                   /protein_id="ABE42359.1"
FT                   /translation="MERDQASKFIHDLLKLMVSRNGSDLFITGDFPPAMKVDGKITKVS
FT                   PQPLNAGHTLALARAIMNDKQAAEFERTKECNFAISPPGVGRFRVNAFIQQGKVGMVMR
FT                   TIPAVLPTIDGLGVPQVLKDVVMSKRGLTILVGATGSGKSTTLAAMVDWRNEQSFGHII
FT                   TIEDPVEFVHAHKNCVITQREVGLDTDSWEAALKNTLRQAPDVILMGEIRDRETMEHAI
FT                   AFAETGHLCLATLHANSANQALDRVINFFPEERRTQLLMDLSLNLKAMISQRLVPKQDG
FT                   KGRFAAVEVMLNSPLISDLIFKGDVSEIKEIMKKSRNLGMQTFDQALYDAFESHFITYE
FT                   DALRNADSVNDLRLQIKLNSQRAKSTDLAAGTESFAIV"
FT   gene            complement(408468..409511)
FT                   /locus_tag="Bpro_0396"
FT   CDS_pept        complement(408468..409511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0396"
FT                   /product="pilus retraction ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42360"
FT                   /db_xref="GOA:Q12GI2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI2"
FT                   /protein_id="ABE42360.1"
FT                   /translation="MDITQLLAFSVKNKASDLHLSAGLPPMIRVHGDVRRINIDPLDHK
FT                   QVHAMVYDIMNDTQRKNYEEFLEVDFSFEIDGLARFRVNAFNQNRGAGAVLRTIPSKIL
FT                   TLEQLNAPKILGDLALKPRGMVLVTGPTGSGKSTTLAAMVNFLNETEYGHILTVEDPIE
FT                   FVHESKKCLINQREVGPHTLSFNAALKSALREDPDAILVGEMRDLETIRLAMSAAETGH
FT                   LVFGTLHTSSAAKTIDRIIDVFPAEEKEMIRSMLSESLQAVISQTLCKTKDGAGRVAAH
FT                   EIMLGTSAIRNLIREAKVAQMYSSIQTGNSVGMQTLDQNLTELVKRNVISPAEARGKAK
FT                   IPENFPG"
FT   gene            409562..410278
FT                   /locus_tag="Bpro_0397"
FT   CDS_pept        409562..410278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0397"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42361"
FT                   /db_xref="GOA:Q12GI1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI1"
FT                   /protein_id="ABE42361.1"
FT                   /translation="MTMIVRNLQLVRDRITTACVAAGRDPASVRLLAVSKTFGADAVID
FT                   AMSDGQRAFGENYVAEGVEKILALRAWQAAQAGAPAVLEWHCIGPVQSNKTRLVAEHFD
FT                   WVQSVDRLKTAQRLSEQRPPHLPPLQICLQVNVDGGANKSGAAPEEALALAQEIAQLPR
FT                   LTLRGLMAIPEPAIDFVAACAVHARTRAIFDQINAAGVLPAPMDTLSMGMTADLEAAIH
FT                   SGSTMVRVGTAIFGKR"
FT   gene            complement(410442..410993)
FT                   /locus_tag="Bpro_0398"
FT   CDS_pept        complement(410442..410993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42362"
FT                   /db_xref="InterPro:IPR022061"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GI0"
FT                   /protein_id="ABE42362.1"
FT                   /translation="MKFNPAFLATIALAMTIATGAAAQTMKPGLWEIHNKMQSGSGSGE
FT                   MEQAMANMDKQMAGMPPEQRKQMQDMLAKQGMGQGGAGGMSMKICMTREMVERNEMPSQ
FT                   QQGDCKTTHSPRSGNTMKFSYTCAQPPSSGEGQITYVSDTAYTMKMATTATVRGKAEKM
FT                   NMDASGKWLSADCGNIKPKK"
FT   sig_peptide     complement(410922..410993)
FT                   /locus_tag="Bpro_0398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.922 at
FT                   residue 24"
FT   gene            complement(411090..411569)
FT                   /locus_tag="Bpro_0399"
FT   CDS_pept        complement(411090..411569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0399"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42363"
FT                   /db_xref="GOA:Q12GH9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH9"
FT                   /protein_id="ABE42363.1"
FT                   /translation="MSEPHIEIDRIDLKILNVLQQDGRISNLKLAESVALSPTAVLARV
FT                   QRLTRDGYILGYEALLNPLKLGAGMMVFVEVLLDRTTPNVFEAFKAAVQVHHEIMECHM
FT                   VAGGFDYLLKTRMADMAAYRSFAGTVLWQLPGVRETRTYAVMEEVKNTTRLALGV"
FT   gene            complement(411641..412066)
FT                   /locus_tag="Bpro_0400"
FT   CDS_pept        complement(411641..412066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0400"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42364"
FT                   /db_xref="GOA:Q12GH8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH8"
FT                   /protein_id="ABE42364.1"
FT                   /translation="MDALDQQLLSLLRKDARTNVATLAQKLGVSRGTVTNRITKLEDAG
FT                   IIVGYTVRLRPDAQPNEIKAWMSIAVEGNEARKVIASLLGEPGVATLHDTNGRWDLLAE
FT                   LRAQNLSELSKVLERIRLIRGISSTESSIHLETYRMT"
FT   gene            412468..413232
FT                   /locus_tag="Bpro_0401"
FT   CDS_pept        412468..413232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0401"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42365"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH7"
FT                   /protein_id="ABE42365.1"
FT                   /translation="MKRFKTWTLLGLALLAAITAQARSLDEVRKEGKIIIATEGQFAPF
FT                   NYFQGAKLSGFEVELAELVAKKMGVSVEWKALGFDALLAGLRQDRWDLVIASHGITEER
FT                   SRAVTFADPHYCSGGSIVSLDPAIRTTADLNGKVISVQTGSTYMDNVRKLAGVKDVKNF
FT                   PQDTDARSALVSRRVDAWVTDKFVASIAIAANPGAGMKLGDFVFIERIAAAVGKGNASL
FT                   AQGYNKALADVLADGSYSALSKRYFNEDVRCK"
FT   sig_peptide     412468..412536
FT                   /locus_tag="Bpro_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.886 at
FT                   residue 23"
FT   gene            413237..414058
FT                   /locus_tag="Bpro_0402"
FT   CDS_pept        413237..414058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0402"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42366"
FT                   /db_xref="GOA:Q12GH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH6"
FT                   /protein_id="ABE42366.1"
FT                   /translation="MPSPRRWPESPMKFAFPEWPGHWSRQQRSSATMVLASVVLVVLLW
FT                   LMAIPLALVPEPIGVNAQSFAKGTRVTVQLTVIAGLVGIVIGVLAALGKISRLPPLRWI
FT                   ASLYIWVVRGTPLLVQVLFVFLALPTLVPALQLSDFSSACVALAFNAGAYNAEAIRSGL
FT                   LAVPKGQIEAARSLGLSSFFTFIDVTFPQAFKISLPPLVNNTVALLKDSSLAYAIGVVE
FT                   LTNVGNRIQAATFQPLPTLVTTAVIYLVLTTVLTQISGAVERRYDVEGRQP"
FT   gene            414171..414908
FT                   /locus_tag="Bpro_0403"
FT   CDS_pept        414171..414908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0403"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42367"
FT                   /db_xref="GOA:Q12GH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH5"
FT                   /protein_id="ABE42367.1"
FT                   /translation="MSTPLITVENVNKRFGAHHVLRDVSTHFEAGQVTVIVGASGSGKS
FT                   TLLRMLNRLERHDSGRIRVDGIEVDDDLTHLDALRRELGMVFQQFNLFPHLTVLDNVAL
FT                   APRRVRKTPRSEASAQAMDLLRRVGMEAHAHKYPFALSGGQQQRVAIARALAMQPKVML
FT                   FDEPTSALDPEMVKEVLDVMKQLAQSGMTMVIVTHEMGFAREVADRVLFIDQGQVAQDA
FT                   PPAEFFGAQANPRIRAFLGQVIH"
FT   gene            415043..416470
FT                   /locus_tag="Bpro_0404"
FT   CDS_pept        415043..416470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0404"
FT                   /product="conserved hypothetical protein; putative protein
FT                   (DcaP-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42368"
FT                   /db_xref="GOA:Q12GH4"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH4"
FT                   /protein_id="ABE42368.1"
FT                   /translation="MKNMKRSAITLMLLASGTLSLSALAQTPKDFEELRQEFLRLRQEL
FT                   NQLKAQPPAAAPAVSNAAIERLEQLELKQKDAVVLGDIPGSFRLPGSETSLRLYGVAEL
FT                   NAVHEFKGDNSANDYSTFVPYAPINGSTNRTGQTYLHARTSRIGIEASTPTPHGPLAVK
FT                   VEGDFNNDPRTGNSAVYGTVGNIYTQQATNSYNFRLRHAYGQFGGLLVGQTWSTFMDLD
FT                   NSPETVDFNGPIGSTFIRQPQVRYAYGTKDMGTFTVAAENSVSYVLDNTGVATPAGFSR
FT                   VPDFIARWDKSFGWGAMSVRGLTHELRVNGDIGGASVNASRRGYGVGATALVKMRDAKD
FT                   FASFAVTYGKGIGRYLNYIEGASYDPATNDILLEKALGVVVGYQYKASDTFRTNFVLGW
FT                   QKNYDNAYTAFARANGLDTGQFGINRRVYQAHLGFIYNPIKNVDFGAEYVFGQRETLSG
FT                   EKGNMSRVNLSAKYYFN"
FT   sig_peptide     415043..415120
FT                   /locus_tag="Bpro_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            416543..417091
FT                   /locus_tag="Bpro_0405"
FT   CDS_pept        416543..417091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0405"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42369"
FT                   /db_xref="GOA:Q12GH3"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH3"
FT                   /protein_id="ABE42369.1"
FT                   /translation="MATTLEHSPSPQPSPQRGEGGNAVASKNSQPLSQFQLSGTGAPPP
FT                   DGIGGRWCACPAGRVTARIVLLIFMVAGDRLLHAMRLTDASFEIAGGVILFLMAMGMAF
FT                   PGMGVSLADSGHGGEPMLVPPAIPVITGPSALATVLLLAARQPDRGWTWAAAIGLLLSA
FT                   MAVDKLISGLRRAFPGVTG"
FT   gene            417236..420205
FT                   /locus_tag="Bpro_0406"
FT   CDS_pept        417236..420205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0406"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42370"
FT                   /db_xref="GOA:Q12GH2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH2"
FT                   /protein_id="ABE42370.1"
FT                   /translation="MRLPFPYRPEGQVVASLLKSLAGALDWAAAVQPAQPWVQAVRDNP
FT                   PPFWAMESLLKEYPISSAEGLALMRLAEALLRVPDAETAIALTADQLGRADFETAGDGV
FT                   MARLSASAIAMSKKFLPEGGQPNLMSKLGARTVVAATLRAVQLLGRQFVLGQNIGEAMN
FT                   EADDARRKMPNLRFSYDMLGEGARTDADALRYLASYTNAIESIAAGASNASPTEQNDGI
FT                   SIKLSALHPRYEDAQRERVMAELVPRVWGLCELAARANINLTVDAEEVDRLELSLDMFE
FT                   ALAARVAQHYPQWQGFGLAMQAYQTRSLALIEQVIAIGRRYKLRLMCRLVKGAYWDSEI
FT                   KRAQELGLPHYPVFTHKHHTDVSYLACAQALLSAPDAIYPQFAGHNAGTIAAILQMASR
FT                   NGVPFELQRLHGMGEGIFREVLKNPLISCRVYAPVGAHRDLLAYLVRRLLENGANSSFV
FT                   HQLADESVNMGELLTSPLRLEPEPSLPLPPTLYGPGRPNSLGLDLTVDSMRAPLFAAFE
FT                   SVRVPTVPEFDARLATSAVAMGVSSYQKWSKVEVAERAAILRRAADALQQQMPKFCALL
FT                   VKEAFKTWGDAVSEVREAVDFLRYYANEAERIMAPVALPGPTGETNELRLTARGAWVCI
FT                   SPWNFPLAIFTGQVAAALATGNAVLAKPAEQTPGVAWEAVKLLHAAGVPEGALQLLHGP
FT                   GETVGAALVAAPQVAGVVFTGSTQVAKIINRALAAKDGPIVPLIAETGGINAMLVDSTA
FT                   LPEQVADAVVQSAFRSAGQRCSALRLLCVHEGIADGVIDMIQGAAQELVLGNPAELATD
FT                   VGPVIDREAFDNIQRHLKRLGTDSKVLVARRENGAEAADLMANSIAPAAFEVSSLAEVK
FT                   DEIFGPVLQIVRWGSGELKSPEAVIEQINALGYGLTLGLQTRIDSRAQALAAAAHVGNI
FT                   YVNRNMIGAVVGVQPFGGEGLSGTGPKAGGPHYLYRFCAEQTVTVNTTAAGGNAALLAG
FT                   "
FT   gene            complement(420252..421421)
FT                   /locus_tag="Bpro_0407"
FT   CDS_pept        complement(420252..421421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42371"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH1"
FT                   /protein_id="ABE42371.1"
FT                   /translation="MMLVRKTQETVLQALSRQASVALIGPRQVGKTTLALEIGKQQNAL
FT                   YLDLEAIEERDKLSNPTAFLSAYEDRLVILDEIHRVPDLFLTLRGLIDQGRRHGQRTGR
FT                   FLLLGSASLDLMRQSGESLAGRISYIDMTPLSVLEVPTDAIEALWIRGGFPDSFLAQDD
FT                   RQSLDWRKDLLRTYLERDVPMFGSRIPAETLRRFWTMLAHNQGALHNASRLAAGLEVSS
FT                   QTVSRYTDLLVDLLLVRRLQPYHANVGKRLVKSPKVYIRDSGLLHALLNIAVRDALLGH
FT                   PVVGASWEGFVIENLINAAPAFTVPGFYRTSGGAEIDLLLELPGGELWAIEVKRSRAAK
FT                   PARGFYEACEDLKPAKRFVVHGGLERYPISADVEAIGMRELAETLSQLA"
FT   gene            421908..422393
FT                   /locus_tag="Bpro_0408"
FT   CDS_pept        421908..422393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42372"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GH0"
FT                   /protein_id="ABE42372.1"
FT                   /translation="MQLITVKIDKPEATNFILGQTHFIKSVEDLHEALVGAVPGIKFGL
FT                   AFCEASGKCLVRWSGTDPAMVELARNNAKTLAAGHCFIIFLGEGFYPLNVLNTVKMVPE
FT                   VCRIFCATANPTEVILAETEQGRGVLGVVDGFPTKGVEDEDDISWRKNLLRQIGYKL"
FT   gene            422608..423051
FT                   /locus_tag="Bpro_0409"
FT   CDS_pept        422608..423051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42373"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG9"
FT                   /protein_id="ABE42373.1"
FT                   /translation="MPNTTWILVANASTAKIYANHGTKKGLKILKETEHPESRQKSADL
FT                   ATDRPGHMPGIGNGHGACQPQTDPKRNAAQHFAQELAREFNHGRSTNQFGRAILIAPSS
FT                   FMGLLNDKLDGPTAKLVSDRFEKDYTKASEKELTGHLESCIYL"
FT   gene            423155..423403
FT                   /locus_tag="Bpro_0410"
FT   CDS_pept        423155..423403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42374"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG8"
FT                   /protein_id="ABE42374.1"
FT                   /translation="MPAPSLPALPTMGTAGASGVVTVLPVKTPEPEPRAPERYLRAMLI
FT                   VCIHEVFALVCLHRSGQMRIISFIIDGLVQCCTLSGT"
FT   gene            423691..425004
FT                   /locus_tag="Bpro_0411"
FT   CDS_pept        423691..425004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0411"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42375"
FT                   /db_xref="GOA:Q12GG7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR033687"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG7"
FT                   /protein_id="ABE42375.1"
FT                   /translation="MKNLPSFDHSRLLATIDRLAPSMTQTLSAFVAAHSPSGAEQPAAE
FT                   FLERKLTDLGLDAERIVLNSSLIESLPLFSCPCDPDNGRYNLLARHLPRSTGGRSVLFN
FT                   GHLDVVPTGPESLWTKPPYVPWVKDGWLHGRGAGDMKGGLVCALVAYEALRELGLQPAG
FT                   IVGFNAVLDEENTGNGTLATVHALQNALAKARLTDFDAVVIPEPFGETLMSAQVGVCWL
FT                   FIEITGKPAHVAYMNQGINPIEAGIAIMADLKQLESEWNAPAQRHPLFRDAAHPINFNL
FT                   GRIEGGEWNSSVPCTCTLGLRFSFFPGMTAGEATRQVTQRIRATAARVNPALTVDIRTR
FT                   GHFSPGCEYDLDAPAMQVLAEAHRKVTGAPPAQLACTATTDGRHFALMTDIPVTVYGPV
FT                   ARNIHGIDEAVSLDSMKRVAATMAQFMVDWCGVEPLAA"
FT   gene            425030..425314
FT                   /locus_tag="Bpro_0412"
FT   CDS_pept        425030..425314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42376"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG6"
FT                   /protein_id="ABE42376.1"
FT                   /translation="MTHPSAVATVQIDNERVKVTEWRFAPGAETGYHRHGMDYVVVPMT
FT                   TGTLLLETPQGEIRSLLTAGVSYTRLTGVEHNVINANDHEFVFVEIELK"
FT   gene            complement(425327..426727)
FT                   /locus_tag="Bpro_0413"
FT   CDS_pept        complement(425327..426727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0413"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42377"
FT                   /db_xref="GOA:Q12GG5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG5"
FT                   /protein_id="ABE42377.1"
FT                   /translation="MSDIWRLSASRVANLIAQRKLSATEAAESALARLAVVNPRLNAVV
FT                   DYRPDEVLRRAGAIDAAMARGENPGPLAGVPVTVKINIDQAGFATSNGLTLQKDLIAST
FT                   NSPVVDNLLKAGAVIVGRTNTPAFSYRWFTSNRLHGRTLNPRNTALTPGGSSGGAASAV
FT                   AAGIGHIAHGTDIAGSIRYPAYACGVHGLRPTLGRVAAYNASSPERTIGGQVTAVSGPI
FT                   ARTVHDVRLALAAMAAPDARDPWWVPAPLTGPVLPRMAAVCVRPDGLNTCPEVVAALLD
FT                   AADRLRDAGWTVDELDALPPIKEACTSQITLWMGDGYEAMVRAAEREGDEGAITALAGQ
FT                   AKIAGAMTAEKLSGALIRRATITRSWQQFMERYPVVLMPACAELPFPADLDLQGPEAYA
FT                   RVWAAQMPMIGLPLTGLPSFVVSTGMLGASPVGVQIVAGRFREDLCLAAGEAIEARGAP
FT                   PMPADVSD"
FT   gene            complement(426739..427989)
FT                   /locus_tag="Bpro_0414"
FT   CDS_pept        complement(426739..427989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0414"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42378"
FT                   /db_xref="GOA:Q12GG4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG4"
FT                   /protein_id="ABE42378.1"
FT                   /translation="MDRRARLLGPAYRLFYETPLHPVRGEGVWLYDADGTRYLDAYNNV
FT                   ASVGHCHPHVVEAIARQASVLNTHTRYLHEGVLDYAERLLGTMPSGLAHAMFTCTGSEA
FT                   NDLAMRIARSHTKAEGLIVTRFAYHGVTAAIAEASPSLGKFVQLGEAVRTEPAPDSYRI
FT                   APEAMGATFAAGVREAIADLRAHGMRPAALMVDTVFSSDGIFTDPPGFLAEAVDAIREA
FT                   GGVFIADEVQPGLGRTGDAFWGFLRHGVLPDIVTMGKPLGAGHPLAGLAIRPDVLAAFG
FT                   RECRYFNTFGGNPVSMAAGMAVLDVIEQEGLMDNAQRVGRYLRIRLSELGRRHALIGDV
FT                   RGAGLFVGVEMVTDRGTRAPATAQTARIVNALRERGVLLSGTGEHANTLKIRPPLVFSE
FT                   ANADMLVETLDSVLTTL"
FT   gene            complement(428042..429124)
FT                   /locus_tag="Bpro_0415"
FT   CDS_pept        complement(428042..429124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0415"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42379"
FT                   /db_xref="GOA:Q12GG3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG3"
FT                   /protein_id="ABE42379.1"
FT                   /translation="MTVATATSVFAVDFDESEVLSETSPQLDPAWVHALALQHYGIAGE
FT                   MKALTGERDRNYLLQSAQSGARFMLKISHPAEKALVADFQTQALLHIAATDAGLPVQRI
FT                   VPTLGGEPSFLCNPGDGLPRVVRLFSYLPGLPLPDAPHTLAQRQNLARTLARLDLALRD
FT                   FDHPAGALALPWDIQRADSVRGLLAHIADPGRRALAQRALDRFERDVKPVLPGLRRQPI
FT                   HNDFNIYNVLVDPADTDRIAAILDFGDMVRAPLIDDLAVAAAYQLGASDDPLADIVPFV
FT                   AAYHAVLPLLPAELDLLFTLMTARLVMVVAISGWRAARHPDNAAYLLRNNPLSWARLQA
FT                   CERIGHNAATDALRRACGLD"
FT   gene            complement(429121..430149)
FT                   /locus_tag="Bpro_0416"
FT   CDS_pept        complement(429121..430149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0416"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42380"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG2"
FT                   /protein_id="ABE42380.1"
FT                   /translation="MKVVYSDQHKDHDPQLFMVRGRLKRSNEQPERAFRLLSAVQEGGH
FT                   DVIACEDFGAGPRAAIHTPEYLRFLETAYERWQGLDDPSQEVMPNIHPFPGEPCTYPES
FT                   VVGQAGFHMGDNACSIGPHTWQAATASAHVATHAAQLVADGERAAYALCRPPGHHAYAD
FT                   RANGFCYLNNVAIAAQHLRRVHDRVAILDIDVHHGNGTQGIFYRRPDVLTISLHGDPRN
FT                   FTPFFTGHAHERGEGAGLGYNINKPLALGTGIDGYLPALRDACLSVRAFAPGALVVALG
FT                   LDAHEHDPYKGMKITTPGFALLLAEIARLGLPTVLVQEGGYLSDDLGPNLASALRGFAG
FT                   VA"
FT   gene            complement(430167..430931)
FT                   /locus_tag="Bpro_0417"
FT   CDS_pept        complement(430167..430931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0417"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42381"
FT                   /db_xref="GOA:Q12GG1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG1"
FT                   /protein_id="ABE42381.1"
FT                   /translation="MRNYAPARKPHNETNRMTFSSPSDTASFESVEAPDLVELVEAQLT
FT                   RAIVEGRLAPGSRIVEADIARRMGVSRAPVREAARRLERQGVLVARPRHGFAVRTISVQ
FT                   EIDDIFEVRISLEMTAIERACSKADDAGLARLQELVHAMVREAPTQPQHQRIAADLAFH
FT                   TLICELSGNAQLHRIFSNTQTEMRMIIALCDAVYHDPSGMAETHQPIADALLRRDATAA
FT                   RAAMRLHLDDAWQHVRALFVKQHGAASASSNP"
FT   gene            complement(430928..431848)
FT                   /locus_tag="Bpro_0418"
FT   CDS_pept        complement(430928..431848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0418"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42382"
FT                   /db_xref="GOA:Q12GG0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GG0"
FT                   /protein_id="ABE42382.1"
FT                   /translation="MTTATAILRPPGSKGAGVAFFFCALVAFASYDAFCKQMLQYYPAP
FT                   FINLMRYLSVICIAFAMLLHHGDLRIWRAPQKKLLVLRGVMLGTVATCFMTALIWMPLA
FT                   EATAIYFTAPLLMVALSPWLVGEQVRRSRWVAVTVGFGGMLLIVRPGGDLPWLGTVLMA
FT                   VSAVCYAIFQLLTRRLAGLVPSPVQYGYTALVCLAVTALPAPFFLPVHRPAPGEVLLLL
FT                   AGGACSGAAQWLLLAAFERVEASTLAPLNYFQLLLAVAFSTFWFRKPPDGLAMSGIALI
FT                   VAAGIYLARSRPAGPAVLAAARAGG"
FT   sig_peptide     complement(431759..431848)
FT                   /locus_tag="Bpro_0418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.880 at
FT                   residue 30"
FT   gene            complement(431845..433101)
FT                   /locus_tag="Bpro_0419"
FT   CDS_pept        complement(431845..433101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0419"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42383"
FT                   /db_xref="GOA:Q12GF9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF9"
FT                   /protein_id="ABE42383.1"
FT                   /translation="MTRNIRINRERLWRSLMDLAAIGATPKGGNCRLALSGLDGQGRDL
FT                   VVGWMQAAGLAITVDQVGNIFGRRAGRNPALAPVATGSHIDTQPTGGKFDGCFGVLAGL
FT                   EIMRTLQERGIETEAPLELVIWTNEEGTRFVPVMMGSGVHCGVFPLETALAATDVDGKS
FT                   VRDELAKIGYAGSAPIGQVRLGRYFEAHIEQGPILEAEDTVIGVVTGSLGLRWYDCTVT
FT                   GMEAHAGPTPMPLRRDALYAASFLMQEVVRIGREFAPQGRGTVGVVGIHPNSRNVIPGR
FT                   VSFSVDLRHENADMLAEMDRRLRRACEALAGGETAGYPVGVNLVDVQHFAPTPFAPDMV
FT                   AAVRKQAQALGYSHRDIVTGAGHDAVYMAGIAPTAMIFVPCKDGISHNEVEDADPRHLE
FT                   AGANVLLGAMLAQAGVAGS"
FT   gene            complement(433121..434182)
FT                   /locus_tag="Bpro_0420"
FT   CDS_pept        complement(433121..434182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0420"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42384"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF8"
FT                   /protein_id="ABE42384.1"
FT                   /translation="MQAFFADDQLLHDPQQFMRLGRICKPTDLPARAHALQAALAAHGI
FT                   AVATPPDYGRAPLETVHSTDYLDFLEGAYARWTAVKLPGLEPGIEVLPNLSPYCSGHVN
FT                   AARGPCPSPSVVAQAGYYLRDLSCPIGPHTWHSVLRSAHSAVAAADAVCQTGDAAYALC
FT                   RPSGHHACRDSASGFCYVNNSACAAHRLLQHYGRVAVLDVDAHHGDGTQHIFYDSADVL
FT                   TVSMHADPAGYYPFYSGYAHERGAGAGAGCNLNLPLPHGAGSEPFLQALDAGLAALRDF
FT                   APRALVLPLGFDTYKDDPVSVLKVEIDAYRQVGERAGALGLPTVIVQEGGYKVDAMGMA
FT                   LDAFLGGFQAGRS"
FT   gene            complement(434182..435552)
FT                   /locus_tag="Bpro_0421"
FT   CDS_pept        complement(434182..435552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0421"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42385"
FT                   /db_xref="GOA:Q12GF7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF7"
FT                   /protein_id="ABE42385.1"
FT                   /translation="MNAFTHAENAAHDIAAHLHPFTNLATHPQVGPLVIQRGDGIFVED
FT                   DQGRRYLEAMSGLWCASLGFSNARLAKAGCDALHALPYYHTFNHRSNPAAIELAQRLLD
FT                   IAPVPMSKVFFANSGSEANDTAVKLVWYYHNAIGKPDKKKIIARKNAYHGVTVAAASLS
FT                   GLAPNHRDFDLPIARILHVDCPHHYRYGLPGETEEAFATRLAEALEQRILAEGPDTVAA
FT                   FFAEPVMGAGGVIVPPASYFEKIQAVLRKYEVLLVADEVICGFCRTGEMFGSTTFGMQP
FT                   DILTSAKALSSGYMPISAVMVSGKVHAAVAANSGKIGTFGHGFTYSGHPVAAAVALETL
FT                   KVYEDEQLLAHVQSLAPQFQRGLQRHASRPLVGEVRGVGLIGAIELVADPASRTPFDPA
FT                   KKVGARLAELALEQGLIVRAMGDAVAFCPPLIITAAQVDEMFARFDRAMVRLEQEQP"
FT   gene            complement(435607..436572)
FT                   /locus_tag="Bpro_0422"
FT   CDS_pept        complement(435607..436572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0422"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42386"
FT                   /db_xref="GOA:Q12GF6"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF6"
FT                   /protein_id="ABE42386.1"
FT                   /translation="MELNAIRKPAPCVALLSEELNMQYLADAFNEVCPGVDLRMGSDLG
FT                   ILEDIDAAVCWFPPHGLLAQLPNLTLVQSLAAGIDHIVADPELPRQLPLCRIVDTGMAA
FT                   GMKAYVSWAVVQHHRGMKAYVASSAAGQWQEQDVVSPRRHRVGIAGLGTLGMACAEALA
FT                   TIGYTVRGWSRSAKDALPDGVTGFHGDGQLDAFLSGCDTLVCLLPLTPQTRGFLNAGLF
FT                   AKLPRGAHLINVGRGAHLVEADLLPALESGQLSAATLDAFSQEPLPRDHPFWGNARILI
FT                   TPHIATRTDRLVIAQQTLANLASLQQGQRPVNLVDLARGY"
FT   gene            complement(436572..438236)
FT                   /locus_tag="Bpro_0423"
FT   CDS_pept        complement(436572..438236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0423"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42387"
FT                   /db_xref="GOA:Q12GF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF5"
FT                   /protein_id="ABE42387.1"
FT                   /translation="MNATVTPMKPVQPVLDIVDLSICLPKGADRALAVEGATLSVLPGQ
FT                   TLCVVGESGSGKSMIANAVMGLLPRPQVAPVAGKILFEGVDLLSLTEAQMRELRGRRIG
FT                   MVFQEPMTALNPVMRIGEQIGEVFDAHGSVPAAEKRRRILAALADVGLPDPELLIDSYP
FT                   FRLSGGQRQRVMIACALVLEPVLLIADEPTTALDVTTQAQILKLVRELQQRRGTAVLFI
FT                   THDFGVVSEIADHVVVMQTGKVVEAGPASAVLRAPQHPYTRKLIAAIPHGQAQRATPTD
FT                   DVVRVLQVQDLCKIYKSGNGLFKRARSVQAAKDVNFELHRGQTLGLVGESGSGKSSVGR
FT                   CLVGLAPFDSGRILFKGRNLSQGEAFRREAAGRIQMVFQDPYASLNPRHRVGAAIAGGP
FT                   IAQGVSKTEAMARAMELLNLVGLGADAAQRYPHEFSGGQRQRIGIARALAMQPELLVAD
FT                   EPVSALDVSVQAQVLELFAQVREQFQLAMVFITHDLRVAGQMCDHIAVMQRGEVVEYGE
FT                   THKVLGNPQHAYTRQLIDAVPRLASPNALDETPAMVA"
FT   gene            complement(438233..439078)
FT                   /locus_tag="Bpro_0424"
FT   CDS_pept        complement(438233..439078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0424"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42388"
FT                   /db_xref="GOA:Q12GF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF4"
FT                   /protein_id="ABE42388.1"
FT                   /translation="MMKSPFWQRFCRNKGAVIGMAVLLLVAVVALIGPSIASNDPWGMV
FT                   QQPFLRPWTEPGFAMGTDTLGRDIMSGVIYGARISLLIGVVSTVVALLIGVTLGAIAGY
FT                   FGGWIDAALMRFTEIFQAVPSFALAIVLVAIFQPSVGSIVAAIAIVSWPPVARLVRSEF
FT                   LTLRQRDFVQAALLAGQSTPRIILTQILPNAMSPIIVMASLMVATAILLESSLSFLGLG
FT                   DPNQMSWGYMVGSARTVLRQAWWMALFPGLAIVLTVLALNLVGEGLNDGLNTRLDGRSK
FT                   "
FT   sig_peptide     complement(438965..439078)
FT                   /locus_tag="Bpro_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.857 at
FT                   residue 38"
FT   gene            complement(439075..440049)
FT                   /locus_tag="Bpro_0425"
FT   CDS_pept        complement(439075..440049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0425"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42389"
FT                   /db_xref="GOA:Q12GF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF3"
FT                   /protein_id="ABE42389.1"
FT                   /translation="MKRTQFMLTRVLQGLVAILLIATVNFMLVRAAPGDPVSVLAGEAG
FT                   ASDPQFVAQLRAQFGLDQPITTQLATYIGKVVRLDLGFSYRQQQPVLKLIMDRLPATLL
FT                   LTGSAFALSLLFGITLGALSARRAGTWVDSSITVVALIFYATPLYWLALMAVLVFTVQL
FT                   DWLPGFGFSTVGSGATGLALAWDVAQHLLMPALTLALFYMAVYARMTRAAMLDVAQMDF
FT                   IKTARAKGVRPGRILRAHVLRNALLPVVTLAGIQAGGMIGGAVLTETVFAWPGIGRLMF
FT                   DALLQRDYSLLLGAFLVTAAMAVLFNLITDLVYTLVDPRIELT"
FT   sig_peptide     complement(439954..440049)
FT                   /locus_tag="Bpro_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.990 at
FT                   residue 32"
FT   gene            complement(440087..441655)
FT                   /locus_tag="Bpro_0426"
FT   CDS_pept        complement(440087..441655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0426"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42390"
FT                   /db_xref="GOA:Q12GF2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF2"
FT                   /protein_id="ABE42390.1"
FT                   /translation="MKRRNLIQMGAAAATGLTLAGVPLHLLAAGKKGGVINAVVQPEPP
FT                   GLMMGITQNAPTQLIAGNIYEGLLRYDEKITPLPSLATSWTSNKEGTLFTFKLKPGVLW
FT                   HDGKPFTSADVVFSAAVFLRKTHARLRANLAAIESIKAIDPLTVEFKLKYPFGPFLGIF
FT                   EVGSMPMVPKHIYEGTDFATNPANATPIGTGPFKFKEWVKGSYIQLVANDKYHVKDVPL
FT                   VDSIYFHIIPDAASRAAAFESGKVDLVPGGAVEYFDVLRLSKLPGAAVTTKGWEFFAPH
FT                   AWLWINNRKAPMDNIKFRQAMMFAIDREAICKVAWQGFAKPATGPFNSNIKFHSTDVAK
FT                   YPRNVETAKKLLAEAGYKGETLRMLPLPYGETWTRSAEILRQNLAQAGVKIEMVATDVA
FT                   GWNQKLNEWDYDLAFTYVYQYGDPALGVARNYTTANIAKGSPFNNVEGYSNPKIDALFD
FT                   AGAKESDPEKRRAIYLQAQKILLDEVPVAWLYEINFPTLYRTKLSNIVSSAIGLNDSLS
FT                   TASIA"
FT   sig_peptide     complement(441569..441655)
FT                   /locus_tag="Bpro_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.890 at
FT                   residue 29"
FT   gene            complement(441714..442505)
FT                   /locus_tag="Bpro_0427"
FT   CDS_pept        complement(441714..442505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0427"
FT                   /product="class II aldolase/adducin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42391"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF1"
FT                   /protein_id="ABE42391.1"
FT                   /translation="MPLHAVGHKATPMSDAERRVREDLAAAYRLVALHGMDDSIYTHIS
FT                   ARVPGAHDQFLINPFGMLFRDITASSLVKIDLEGRILDESPYDVNPAGFTIHSAVHAAR
FT                   HDAACVLHTHTVAGVAVSSLAGGLQPCNQWSLQFYKRVVYHDFEGIALDADERERLVAD
FT                   LGPTARALILRNHGLVTLGRTIAEAFILMLNLERACRVQVAIQSSGSPVYPVPHEVCEK
FT                   TARQYESGDSNRLPGLPDPDAREWRALLQRLEPAAVTSFRD"
FT   gene            complement(443109..446078)
FT                   /locus_tag="Bpro_0428"
FT   CDS_pept        complement(443109..446078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0428"
FT                   /product="diguanylate cyclase/phosphodiesterase (GGDEF &
FT                   EAL domains) with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42392"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GF0"
FT                   /protein_id="ABE42392.1"
FT                   /translation="MTSSLPTIPPSAAVAAASGTSMVPLSEPDFDGLVQLAARFCGTGA
FT                   AILHLAGEETTSSSWSVGLPEKADSLADFYAQVLLRGGQPLTITDAATDPTLSRHPLVA
FT                   GPAGLRFFAAVPLIASDGTPLGVLAVMDAAARACRDGDLDALNILGRQVVAQLDLRRQH
FT                   KFLADRSAEREQQSRMRLQHSENRLHIAMRTAQMGNWSLNLADDSLTLSSEFPAILGTS
FT                   AAMPQTLEELLLHYAAESRGRLRHVISECARKGTPFDEEAQMLTAQDGRRWVRIIGEVV
FT                   RDGQGAITRIQGALQDINARKQAQEETLRLAMRLTTTLASITEAFVTLDREGRFTYLNQ
FT                   ESERLLQRSTAELLGQEIWQDFGEEVSGRLRQHIQRALATNRQVEFEYFDAPLGKWLEV
FT                   RAYPFAEGLAVYFRDVSERRNSQEQLMLLETGIARLNDIVVIVEASPHHGSGPQIVFVN
FT                   DAFERHTGYTRDEVLSRMPGMLQGPGTRQDELARIFSALQQWKQARGELVIYRKDGGSF
FT                   WVDLEIVSVAAQNGDLTHWVAVGRDITQRKAADEKIHHLAFYDPLTELPNRQLLLDRLE
FT                   QALADCTITRQEGVLMFIDLDNFKILNDTVGHSKGDLLLQKVAVRLKGCVRKLDTVARL
FT                   GGDEFVVMLQDLGTQPEAATRKAQIVAEKVLATLREPYDLAGYQHYSTSSIGVTPFNAR
FT                   QGSVSELLKQADLAMYQAKTMGRNTVCFFDPDMQASVSANAALSTDLRAGLREHQFLVH
FT                   YQPQVDREQRITGVEALLRWKHPQRGMVSPAEFIPVAEETGLILPLGQWVLEQACLQLA
FT                   VWQKRPETAGLSIAVNVSVRQFRHPDFVDMVMAAIKHTGIQPHNLKLELTESLLADRME
FT                   IAIAKMGTLKALGVTLALDDFGMGYSSLSYLKRLPLDQLKIDKSFIADVFSDPNDAAIC
FT                   SAIISLAQSLGLDVIAEGVETEAQRSFLAGLGCGYYQGFLFCPPLPIAEFEAFMQGAAP
FT                   "
FT   sig_peptide     complement(445998..446078)
FT                   /locus_tag="Bpro_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.597 at
FT                   residue 27"
FT   gene            446347..446652
FT                   /locus_tag="Bpro_0429"
FT   CDS_pept        446347..446652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42393"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE9"
FT                   /protein_id="ABE42393.1"
FT                   /translation="MNTMQDLRQCPDVATLKPAVHALCSRFGRIERLDILTAMHEGQQQ
FT                   AICFLRLDSPENEQALMKTLGVGKFGGEVVFVVDLVSPDSQEDSGPSSQWADSGNF"
FT   gene            446800..447351
FT                   /locus_tag="Bpro_0430"
FT   CDS_pept        446800..447351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0430"
FT                   /product="protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42394"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE8"
FT                   /protein_id="ABE42394.1"
FT                   /translation="MATPFFGKRENETSTTSPNLRGASNGYGTSGTSSTLQSASAAANQ
FT                   QSNAKPVNDASASTSKEGGSKLTVGPNIKLKGVEITDCDTLVVEGLVEATMDSRVIQIA
FT                   EQGAFKGSADIDVAEIRGEFNGNLTVRQKLVIYSTGKVTGTIRYGKLVIEEGGQLSGEI
FT                   QFGALGSKPAAMVKPGLQAV"
FT   gene            complement(447409..448134)
FT                   /locus_tag="Bpro_0431"
FT   CDS_pept        complement(447409..448134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0431"
FT                   /product="LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42395"
FT                   /db_xref="GOA:Q12GE7"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE7"
FT                   /protein_id="ABE42395.1"
FT                   /translation="MPKFVELWVYLSASPLFGLTATLVVYVLAQAAYARLGHAPWANPV
FT                   LWTMVCIASGLLLTDVPYPSYFAGAQFIHFLLGPAVVALAWPLWQRREELRRRWWRLLL
FT                   AALAGGAAASGSALLLAWALGLPAEVALSLVPKSVTAPVAMGIAEKIGGIPALAAVFAV
FT                   ITGLVGALAGKYLFDALRIPANQAGWAARGFALGTASHGIGAARALQVNADAGAYAGLA
FT                   LGLQVVLASLLIPLAFRWF"
FT   sig_peptide     complement(448045..448134)
FT                   /locus_tag="Bpro_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.873) with cleavage site probability 0.742 at
FT                   residue 30"
FT   gene            complement(448127..448498)
FT                   /locus_tag="Bpro_0432"
FT   CDS_pept        complement(448127..448498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0432"
FT                   /product="LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42396"
FT                   /db_xref="GOA:Q12GE6"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE6"
FT                   /protein_id="ABE42396.1"
FT                   /translation="MQALRGLAWLLALQSIGELLTRGLSLPFPGPVIGMMLLLPALRWR
FT                   MVREPVSACADFLLTHLSLLFVPVGVGVMTHLSLVSQYGVRMLAVIVLSTLAGLAVTVL
FT                   SLHLLQGRLDPLGKEDPHA"
FT   gene            complement(448530..450032)
FT                   /locus_tag="Bpro_0433"
FT   CDS_pept        complement(448530..450032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0433"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42397"
FT                   /db_xref="GOA:Q12GE5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE5"
FT                   /protein_id="ABE42397.1"
FT                   /translation="MNAPLSPPQHDLHERAERQSHVVQALQAVLPAHALLWNSEDTTPY
FT                   ECDGLTAYRQRPLVVALPETYAQVQAVLQTCHSLEVPVVARGAGTGLSGGAMPHRLGVT
FT                   LSLAKFNKILKLDPTSRTAVVQGGVRNLAISEAAAPCGLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTVHNVLKVKGFTITGEEVEFGSDALDASGYDLLSIIIGSEGMLAVTT
FT                   EVTVKLVPKPQLARCIMASFDDLRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVH
FT                   AGYDLSAEAILLCESDGTPEEVEEEIGRMSEVLRRCGATAIAVSQNEAERLRFWSGRKN
FT                   AFPASGRISPDYMCMDSTIPRKRLADILLAIQDMEKKYQLRCANVFHAGDGNLHPLILF
FT                   DANDADQLHRCELFGADILETSVAMGGTITGEHGVGVEKLNSMCVQFSAEENEQMFGVK
FT                   RAFDARGLLNPGKVIPTLNRCAEYGKMLVRGGQIAHPDLPRF"
FT   gene            complement(450179..451162)
FT                   /locus_tag="Bpro_0434"
FT   CDS_pept        complement(450179..451162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0434"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42398"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE4"
FT                   /protein_id="ABE42398.1"
FT                   /translation="MKNRRLALALIAQAAISFAAMTGVVHAQSDYPTKPVKIIVPFPPG
FT                   GTSDVMGRMLADELTKILKQPFIVENVAGAGGTIGTDRASRLTPDGYTLIQTGVGQNAV
FT                   AHGLDANLKYNSMKDFAHISQIHSGPNVLVVHPATPYKSVKDVVAYAKANPGKLDYGFT
FT                   HAASGHMAMELFKQTAGIYMTGISYRGGGPMLTDILGGTIPMMFINQDAALPHVKAGKL
FT                   RALAVTSAQRNPLYPDVPTIAESGYKGFEALSWSGISAIKGTPQPIVDKLEAAVAQAMQ
FT                   SDAIKQRMGSVGFIIPAQGSKPYTAFVKQEIDTWTRVIKTAGLKAE"
FT   sig_peptide     complement(451079..451162)
FT                   /locus_tag="Bpro_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 28"
FT   gene            complement(451431..452582)
FT                   /locus_tag="Bpro_0435"
FT   CDS_pept        complement(451431..452582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0435"
FT                   /product="galactarate dehydratase / L-talarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42399"
FT                   /db_xref="GOA:Q12GE3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR033978"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:2OG9"
FT                   /db_xref="PDB:3CB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE3"
FT                   /protein_id="ABE42399.1"
FT                   /translation="MKTTTSSTPSDRITWVRISSCYLPLATPISDAKVLTGRQKPMTEI
FT                   AILFAEIETAGGHQGLGFSYSKRAGGPGQFAHAREIAPALIGEDPSDIAKLWDKLCWAG
FT                   ASAGRSGLSTQAIGAFDVALWDLKAKRAGLSLAKLLGSYRDSVRCYNTSGGFLHTPIDQ
FT                   LMVNASASIERGIGGIKLKVGQPDGALDIARVTAVRKHLGDAVPLMVDANQQWDRPTAQ
FT                   RMCRIFEPFNLVWIEEPLDAYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHRAAD
FT                   YLMPDAPRVGGITPFLKIASLAEHAGLMLAPHFAMELHVHLAAAYPREPWVEHFEWLEP
FT                   LFNERIEIRDGRMLVPTRPGLGLTLSGQVKAWTREEAQVGTRP"
FT   gene            453172..454203
FT                   /locus_tag="Bpro_0436"
FT   CDS_pept        453172..454203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0436"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42400"
FT                   /db_xref="GOA:Q12GE2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE2"
FT                   /protein_id="ABE42400.1"
FT                   /translation="MPAPALTHSPGFKAATLHDVAREAGVSLITASRALSNPTLVSDKT
FT                   IERVQKAVEATGYIPNLLAGGLKSRRSLMVAGLVPTISVAQFLPTVQSLTEALDADGYQ
FT                   LILGQTGYNRSREDALLNTMISRRPDGIVVTGLVHSQAARERLRRLGIPIVETWDLSDR
FT                   PIDMLVGFSHLKVGSAVAGYFLGKGWHRLGIATGDDHRGSLRREGFLATVGHEVPTAVV
FT                   PAPSNLALGRRALAELLQQDPKLEAVYCSSDQLAQGVLVEAQARGLRVPEDLAVCGFGD
FT                   ADFAAHLQPSLTTVHVDGAAIGRLAARLIVARCRGEPIAERVIDVGFRIVERQSTGGGA
FT                   SQA"
FT   gene            complement(454261..455160)
FT                   /locus_tag="Bpro_0437"
FT   CDS_pept        complement(454261..455160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42401"
FT                   /db_xref="GOA:Q12GE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE1"
FT                   /protein_id="ABE42401.1"
FT                   /translation="MAAPARIPPIQCLLTFEALARLRSVTQAAEELCVTPSAVSHRVKQ
FT                   LEQIIGTKLFGRADFSLTTEGSEYLAHVREGLATLQKFPGTAGQNGTTGKRKLRLAITP
FT                   TFARSILIPRLRQFTEAYPEIDLTLQVSIPLLDVVAEDADLIVRFGTGRYADMEHVCLA
FT                   HDDVTPLASPAFVREHGPFEAAEDLEGESLLRSPLEPWRTWFVANNLDWPEPQDGSQFN
FT                   DIGLMCDAAAAGMGIALIRLKLGAPWLDNGSLVRLGNNAVFGRNVPSPHAHYLCWRTGT
FT                   MDRWECAAFADWLRKSLT"
FT   gene            complement(455166..456014)
FT                   /locus_tag="Bpro_0438"
FT   CDS_pept        complement(455166..456014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0438"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42402"
FT                   /db_xref="GOA:Q12GE0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GE0"
FT                   /protein_id="ABE42402.1"
FT                   /translation="MNHAYILTLSCPDRRGIVHAVSGFLLQNGGNIEEAAQYNDHDTGL
FT                   FFMRVQFACDQLTHEELSQQLKGFAEPFQMNWKLHATTQPMRTVIMVSKEGHCLNDLLF
FT                   RCKSGLLPLDVRAIVSNHREFYQLAASYNIPFHHFPVTAASKAQVEDKQLEIIESEGAE
FT                   LVVLARYMQILSNDLCRKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVT
FT                   GDLDEGPIIEQDVARVDHSKTVEDLTAMGRDTESQVLARAVKWHSEHRVLLNGHKTVIF
FT                   K"
FT   gene            456453..457526
FT                   /locus_tag="Bpro_0439"
FT   CDS_pept        456453..457526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42403"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD9"
FT                   /protein_id="ABE42403.1"
FT                   /translation="MQNFFAKKLRELLILSFACAAFTVQADEWQAERYPWDMRPFFCSY
FT                   KKNVETELCKADNWPSYEVTRERLRSLRWTGRFALLERALTELATSEELLPNGFNKATA
FT                   VHWTLEELVQDHRRAAIIGGDPLALWKSVVPQSKFLLLTDAMLLHRRAWELRGGAASTV
FT                   LPESGELFALRLGDAEKKLMQAPPSLKDTAVWHLILLKIAIEGRGVESDPQTVFLNAVK
FT                   RWPKSADFYMEMISYLSPVRGGSWAAVEAFIDHSSRQLESTEGMSFYARLYASIGNEVT
FT                   RGQTAMDWVKMRRGFDDWIARDSRASVKNLYASYACFARDKSTFGKAIGQILKQELLPG
FT                   QWLAGHSYEACARWAGI"
FT   sig_peptide     456453..456533
FT                   /locus_tag="Bpro_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            457734..458804
FT                   /locus_tag="Bpro_0440"
FT   CDS_pept        457734..458804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42404"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD8"
FT                   /protein_id="ABE42404.1"
FT                   /translation="MPNIFLRIIREILILSLACGAAAAQAERLPAERYPWDMRPLKCNF
FT                   EEGVESFFCKANDWPDFAVTKDRLRMLGQQGQFALLERALRELATSEELFPGGVNKAAA
FT                   VYGTLDEFVDDHRGKIEESSLTKWRSAFPHSDFILLADALALHAKAWSARGEGVASTVS
FT                   PESWEIFAKSLGEAEKKLMSAPPSLKDTAVWHLILLTVALEGRGVKSDPRTVFLNAVKR
FT                   WPRYLSFYRLIASRLVPKWGGSWEAVDAFIDHSSRQLESTEGMSFYARLYAALGDAVVK
FT                   ERTAMNWTRMKRGFDDWIARDPNAVLKNLYASYACFARDKSTFGKAMSLIPKQELSPDS
FT                   WLDGYSYEACIRWAGI"
FT   sig_peptide     457734..457814
FT                   /locus_tag="Bpro_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.952 at
FT                   residue 27"
FT   gene            complement(458935..459816)
FT                   /locus_tag="Bpro_0441"
FT   CDS_pept        complement(458935..459816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42405"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD7"
FT                   /protein_id="ABE42405.1"
FT                   /translation="MLHVPLLALSALSGFPGALICVAAMALAGGCASRPGPPEAPILQP
FT                   PSGSAAAATVARLDALLPIDALLIGEQHDAAEHQQIAQQVVARLAARGLLGALALEMAD
FT                   AGVSTAALQPSASEEQTRHALKWNDKAWPWTAYGPAVMTAVRAGVPVLGANLPRAQMQG
FT                   SMDDSKLDVQLPGPALKAQQQLIRLGHCNLLPESQITPMTRVQIARDITMAHTLSQAAL
FT                   PGKVVVLLAGSGHVDRHLGVPQHLPSNLSSKSIGLLAETLRNATEHIAKFDAIWPARPA
FT                   PEKDYCAEFRMR"
FT   sig_peptide     complement(459736..459816)
FT                   /locus_tag="Bpro_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.579 at
FT                   residue 27"
FT   gene            459890..461017
FT                   /locus_tag="Bpro_0442"
FT   CDS_pept        459890..461017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0442"
FT                   /product="putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42406"
FT                   /db_xref="GOA:Q12GD6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD6"
FT                   /protein_id="ABE42406.1"
FT                   /translation="MLPDAAKRLLSLLRSPPVCVIGTLLIAWAAAALCVMLRTPLPWMI
FT                   GPLLVTAIISMLGGATASWTPLRDAGQWIIGCALGLYFTPQVVALVAGLWWAIALNIVW
FT                   ALALGWIFGAWLHRVHHGPGPLHVSGLSRITTYFAAPIGAASEMTLMGESHGAQTDLVA
FT                   SAHSLRVLLVTLIIPFGFQWAGLHGLDTTLPGVRDVHFPGLALLAGLTGIGCWTMLKLK
FT                   RTNPWFIGALVVSLLLTACGFTLSALPQWMTNAAQLVIGISLGVRFTRSFVHLAPRWLG
FT                   SVALATVGMMGLCAGFAWMLARFSNLHWATLLLGTSPGGIAEMAITAKVLQLGVPVVTA
FT                   FHVTRLAAVLLLAEPMYRWMYQKRPAAQAESPPAE"
FT   gene            complement(461154..461435)
FT                   /locus_tag="Bpro_0443"
FT   CDS_pept        complement(461154..461435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42407"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD5"
FT                   /protein_id="ABE42407.1"
FT                   /translation="MHMLYDSDSFVVVQIHANAPEESAPAPAVPQLARHGFEIVDKRSG
FT                   KEVYLDGSWAEMFQQRLSAWAQKTPTQEEIEDTLEGYSGLANTPISLH"
FT   gene            complement(461568..462749)
FT                   /locus_tag="Bpro_0444"
FT   CDS_pept        complement(461568..462749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42408"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD4"
FT                   /protein_id="ABE42408.1"
FT                   /translation="MNSVLAAPGVASGVSRTAPPRRALGMLAVLVLAVHTLLLRTTPDR
FT                   FGPETDPASTRSRAAPAFVTRSIEVPPPSKVLPPPAAPPAVKPVVKAPVKPKRPPVPVQ
FT                   ENEAVAADSPAQPATDSVAPQAPDSLAVSESPAAPSADSVPLPAADTATASNSTANTPP
FT                   EATAPPPPAGASQTPVTAIALPPSVRLAYKMTGQAKGMTYHANAELGWHQAGGSYDARM
FT                   TVSALFLGSRSMASTGQVDAGGLAPTRFSDKSRSEVAAHFEADKARITFSANTPAVPWI
FT                   KGAQDRVSVFLQLGGMLAGSPASFPVGSSISLYTVGPRDADTWTFLVEAEESVSLPFGD
FT                   IVALRLTRQPRREYDQKVEVWYAPSLGYLPVRSKITQYNGDFVDQQLNTVNKF"
FT   gene            complement(462746..463609)
FT                   /locus_tag="Bpro_0445"
FT   CDS_pept        complement(462746..463609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0445"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42409"
FT                   /db_xref="GOA:Q12GD3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD3"
FT                   /protein_id="ABE42409.1"
FT                   /translation="MNAPPGSLDTPLAAPPAAPLTDLPPQRAGIQSVEVGFSLLGVLAA
FT                   APGPLMLRDLAAAAGMSAAKAHRYLVSFQRLGLVTQDAGSTRYDLGPAALKLGLASLSR
FT                   LDSVKLARQRLQPLMEHIGQTLALAVWGNQGPTIVHWEESPQAVTVNLRLGDVMPLLSS
FT                   ATGLCFAAFMLNQHASQNRLAALLKDELARTQKLGRKDLPTSMAKATALLDEVRQRGLA
FT                   RVVDTLLPGVAGFCAPVFDADGHLALGMVALGSLATFDPAWDGAVARPLAAAARQLSSD
FT                   LGFTGA"
FT   gene            463815..464810
FT                   /locus_tag="Bpro_0446"
FT   CDS_pept        463815..464810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0446"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42410"
FT                   /db_xref="GOA:Q12GD2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD2"
FT                   /protein_id="ABE42410.1"
FT                   /translation="MKLATYKDGSRDGQLVVVSRDLATAHYATGIASKLQQVLDDWNFL
FT                   SPQLQDLYETLNNGKARHAFPFEPAQCMAPLPRAYQWADGSAFINHVELVRKARNAEVP
FT                   ASFYTDPLMYQGGSDDFAGPCDNVVVASEEFGIDFEAEVAVITADVPMGATPEQALEGI
FT                   RLVMLANDVSLRNLIPDELAKGFGFFQSKPATAFSPVAVTLDELVFNGENAWDKGRLHM
FT                   TLQSTWNGRKVGMCEAGPEMTFHFGQLIAHICKTRNVRAGSIVGSGTVSNKDWSHGYSC
FT                   IAEKRAIETIEDGKPKTPFMKFGDTIRIEVKGKDGLSVFGAIEQKVAPLR"
FT   gene            complement(464851..465453)
FT                   /locus_tag="Bpro_0447"
FT   CDS_pept        complement(464851..465453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0447"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42411"
FT                   /db_xref="GOA:Q12GD1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD1"
FT                   /protein_id="ABE42411.1"
FT                   /translation="MAYTFASATVLLLLITDPLGNIPIFVNALRGVAPERRMRVVLREV
FT                   LIAFLLLLAFMFVGDGFLRLMNLSDLSLQIAGAVVMFLIALRMIFPSAQPEAAPLQGEP
FT                   LIVPLAIPGLAGPSALATVMLLVSQAPARRLEWIAALSVTMVVCAVVLVLSERIQRIAG
FT                   DRVMMAFERLMGLILVAISVEMLLRGLKLFVAQLGQP"
FT   gene            complement(465513..465926)
FT                   /locus_tag="Bpro_0448"
FT   CDS_pept        complement(465513..465926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0448"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42412"
FT                   /db_xref="GOA:Q12GD0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GD0"
FT                   /protein_id="ABE42412.1"
FT                   /translation="MKSLFHFAFNVRDLDLARSFYGGVLGCTEGRSTDTWVDFDFFGHQ
FT                   ISLHLGEPFKTERTGHVGDKLVPMPHFGLVLALPDWQALAQRLQAAHTEFVLAPQVRFE
FT                   GEPGEQWTMFFCDPFGNPIEIKGFRSLEALYAS"
FT   gene            466073..467017
FT                   /locus_tag="Bpro_0449"
FT   CDS_pept        466073..467017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42413"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC9"
FT                   /protein_id="ABE42413.1"
FT                   /translation="MATYPDPQQCPTWQETTMSDADNNSFAGFGKLVPGFDFLQNLAKQ
FT                   AADSASQSIPQLPKLGSWVAPTLNVEELDKRIDELKAVQFWLDQNATALKATIQALEVQ
FT                   KMTLATLRGMNFNMGDMANAFKLKVADGVADKAKTFSGLEIPPSAFNGHQANAQASEDT
FT                   AEKARAKAKAKAKVAAAKSSDATAAAGGVVDPMQWWGALTQQFQTIAADAMKDVARKTA
FT                   VDTTKNMAAGLAKDAVKTATDMATGLAKGMAESAGKTVAGGARAAMNTALRSAQDWPTP
FT                   ASMASSAAQSPSGPKAKTPARKTARSTVRKTTP"
FT   gene            467046..468338
FT                   /locus_tag="Bpro_0450"
FT   CDS_pept        467046..468338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42414"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC8"
FT                   /protein_id="ABE42414.1"
FT                   /translation="MKLFPYGHATHPQWQMAAGLVLAQLRAHMTLPGYARAPTLALLYI
FT                   TDHYAVHAQDILDHLSAELPDITDWSGTVGVGIASNNVEYFDEPALAVMLCELPHDQYR
FT                   VFSGVSPLPPAASGRFKAHTALVHADAGTPDVAELIDEMAQRTESGYVFGGLASSRSST
FT                   VQFAFSGHGNVKGHGAAGGVFNGGLSGVAFARDPSGGMVLMSRITQGCQPVSANHDITA
FT                   CESNVVTGLDGQPALDVMLEDLKVSLDQPREALARVRTTLVGLSRPEDSLHDARSRRAG
FT                   QFGAEVVVRHVIGLDPARKGIAIAEVPHVGMKLAFCERNAQAARADLIRVCAEIREELE
FT                   PEEVTLDVASALGGVPADAAPHPARRIAGAIYVSCSGRGGPHFGAPSAELQIVRRALGD
FT                   VPLVGFFAGGEIARHHLYGYTGVLTVFAAAD"
FT   gene            complement(468401..468664)
FT                   /locus_tag="Bpro_0451"
FT   CDS_pept        complement(468401..468664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0451"
FT                   /product="helix-turn-helix protein, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42415"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC7"
FT                   /protein_id="ABE42415.1"
FT                   /translation="MKAKTFEQQFDEGVDITASLDLSKAKRVLQVQKRVNVDFPAWMID
FT                   SLDREASKLGVTRQSVIKVWLAERLEESASNTSRRRMRAEGT"
FT   gene            complement(468654..468917)
FT                   /locus_tag="Bpro_0452"
FT   CDS_pept        complement(468654..468917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0452"
FT                   /product="protein of unknown function DUF497"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42416"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC6"
FT                   /protein_id="ABE42416.1"
FT                   /translation="MNSFEFDESKSESNFLKHHINFIDAQLLWNDPRLLEIPAKTEDEP
FT                   RYLVIGLINGKHWSAVVTYRGANIRLISVRRARTEEVALYES"
FT   gene            complement(469047..469310)
FT                   /locus_tag="Bpro_0453"
FT   CDS_pept        complement(469047..469310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC5"
FT                   /protein_id="ABE42417.1"
FT                   /translation="MFVQAGLAAKRGRTGVGAHAHAVLRHPLQADRTHGGQCGHVVSEQ
FT                   FVHQHFVAGTKVVERVVVHRHAPANPPVWPMTRSSLPVLPLR"
FT   gene            complement(469686..470417)
FT                   /locus_tag="Bpro_0454"
FT   CDS_pept        complement(469686..470417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0454"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42418"
FT                   /db_xref="GOA:Q12GC4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC4"
FT                   /protein_id="ABE42418.1"
FT                   /translation="MSTSADLVTVLKKELKAAQMTYADLARALGMAESSVKRMLAKGDM
FT                   PLSRIDAICRALKLDFSELARRVADTQPLLAELTEVQEKAVVADKKLLLAAICVLSQWT
FT                   LEQMTDSYRLSEAECIKYLAQLDRIGIIELKPMNRYRLKLAKTFRWRPHGPVMDYFRDN
FT                   ALLDYFSGGFDGAGEGLLLVHGSISRSLAPSFLERMQRVAQDFAQQHQADQKLADKDRE
FT                   GYTLLLAMRSWEFEAFAALRR"
FT   gene            complement(470536..470721)
FT                   /locus_tag="Bpro_0455"
FT   CDS_pept        complement(470536..470721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42419"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC3"
FT                   /protein_id="ABE42419.1"
FT                   /translation="MTTQWALAHKAEQRRMARRAWCNRTHSAVTQKVNAIEEGKVNGHT
FT                   AFLKFASGQLLFLGSI"
FT   gene            470797..471603
FT                   /locus_tag="Bpro_0456"
FT   CDS_pept        470797..471603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42420"
FT                   /db_xref="GOA:Q12GC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC2"
FT                   /protein_id="ABE42420.1"
FT                   /translation="MFQLEKPERLLWGAVLVLLLAAVAGPFVAEPAHAHDLADQRAWGR
FT                   IPFTLNVLSNLPFALWGAAGLGCLVWRRRATGPVGLTARHGLAALFFTGLLATAATSAW
FT                   YHWQPDDLGLAVDRLGMAVAFAGLLGLAAAERVSARAGLALGAAMLVLGPCAVGVWLSS
FT                   GNALPWGLLQFGGMGLIVWLACLPPLADEIPMASGDSPIRWATVVAIYALAKLFEFGDQ
FT                   LVFDWTGHLVSGHSLKHVVASCTAWPVVAALIPTRKTKAESLQITA"
FT   sig_peptide     470797..470901
FT                   /locus_tag="Bpro_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 35"
FT   gene            471684..473645
FT                   /locus_tag="Bpro_0457"
FT   CDS_pept        471684..473645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0457"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42421"
FT                   /db_xref="GOA:Q12GC1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC1"
FT                   /protein_id="ABE42421.1"
FT                   /translation="MSVDTSALVAPPAAHEHPNQFALLKQRRFAPFFWTQFSGAANDNL
FT                   FKFAFTVMVTYQLSVSWLPPALAGLVIGALFILPFLLFSATSGQLTDKFEKTRVIRFVK
FT                   NLEVVIMLIAAAGFMSNNANVQVPVLLGCTFLMGLHSTIFGPVKFAYLPQALNERELTG
FT                   GNGMVEMGTFVAILLGQVVGGLMVAVPQVGPDYVAIACVLLALVGRAVSQFIPLTPATD
FT                   PGLRINWNPVTETWRNLRLARDNVVVFRSMLGISWMWFFGAVFLSQFPSFAKEVLHGNE
FT                   QVASLLLVVFSIGIATGSLLCEVLSKRHVEIGLVPVGAIGMSVFAVDLYFASRGLPPAP
FT                   VMSVGAFMLHQAHWRVMIDLALLSLFAGLYSVPMYALIQLRSPPTHRARIIAANNILNA
FT                   LFMIVSAILAGALLKSGFSIPQIFLLVGLANAVVGFYIFLLVPEYLLRFIALVASRLVY
FT                   RFKIQGDDNIPAQGAAVLTCNHVSFVDPVLLMAASPRPIYFLMDHRIFKMPVLGWLFRL
FT                   AKAIPIAPRAEDPVAYEAAFEAAARVLRNGDLLAIFPEGGITRDGELQVFKAGIMKILE
FT                   NAERDGLSVPVIPMALTNLWGSFFSRVEQVRGEQVAMVRPFRRGLFSRVGLNAGPAIAP
FT                   ADVQPEALRTRVAALMDA"
FT   gene            473761..474216
FT                   /locus_tag="Bpro_0458"
FT   CDS_pept        473761..474216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42422"
FT                   /db_xref="GOA:Q12GC0"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GC0"
FT                   /protein_id="ABE42422.1"
FT                   /translation="MQTLIHRDSRPWQLQVWVSFLIAVFLCAVGLSYLPGQDLDRAFMV
FT                   MGYLFCLSAAFVLAKHVRDHENSRADTPMFRLVVWGGFFLAMSLTGWGLWRMEINETYK
FT                   AFLGVSWLYLITCSFTLAKTLRDKHEADLSEARMAAGRQSRGGADAG"
FT   gene            474278..474736
FT                   /locus_tag="Bpro_0459"
FT   CDS_pept        474278..474736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42423"
FT                   /db_xref="GOA:Q12GB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB9"
FT                   /protein_id="ABE42423.1"
FT                   /translation="MKSKLASLLIAVSTMLMVAAVPLRANAQSEVAALSAVSALPVASV
FT                   VVGASVAAGAVVAVPVMLSTAGAVLVVKTVESTARGTVYVLESASDGARASIEVVGQGL
FT                   AGASLVAGTALTVSVIGAGVVLSAAGEAIAFLPNALGRALLHNERLTH"
FT   sig_peptide     474278..474361
FT                   /locus_tag="Bpro_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.790 at
FT                   residue 28"
FT   gene            474790..475617
FT                   /locus_tag="Bpro_0460"
FT   CDS_pept        474790..475617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42424"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB8"
FT                   /protein_id="ABE42424.1"
FT                   /translation="MNCPTSCLTNHLGVGLLAAALLAAPAAHAGRSCETGKPTTRTVER
FT                   GLTLAGKTLASLNASGQKVVVLARAGQDLSKYGVRYSHLGLAYQQSDGQGGSTWRVLHK
FT                   LNECGTSGSAIYRQGLGEFFLDDLWRFEAAWLPLTPEAQARLLSLLQDPGRALSLHHKP
FT                   YSIVSYAWGRKYQQSNQWAIETLAAAMEPGVNSRERAQAWLQFKAYEPAVLRIGPLTRL
FT                   GGRLTAANVAFDDHPNDKRFSDRIETVTVDSVFDWLPRAQLAAPGQTPTIVKL"
FT   sig_peptide     474790..474879
FT                   /locus_tag="Bpro_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.987 at
FT                   residue 30"
FT   gene            475662..476732
FT                   /locus_tag="Bpro_0461"
FT   CDS_pept        475662..476732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42425"
FT                   /db_xref="GOA:Q12GB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB7"
FT                   /protein_id="ABE42425.1"
FT                   /translation="MSKGLRLSEKWFHRGLWLVALVFAGFLIGLGGTVVGDLPKVEKRL
FT                   SLDDFMDPATTTALRTAIKTATRAEQDAQSALEQAQLKRRAAQADSAAARDTFNNWLAT
FT                   RRATQLADQDPELIERTRALDALKARERATGVAVEAQQQAALDARQAAARERGKLAELQ
FT                   EVAQKLLNAEYRRVELRVFLYRLALTLPLLVAAGWLFAKKRKSTYWPFVWGFIIFALFA
FT                   FFVELVPYLPSYGGYVRYIVGIVVTALVGRQAIISLNRYLEKQKLAEQLPDAQRREELS
FT                   YDTALTRLSKAVCPGCERAVDLKNPEIDFCPHCGIGLFDHCFKCSTRKSAFARFCHACG
FT                   ASGEQARPAPPVASAA"
FT   sig_peptide     475662..475772
FT                   /locus_tag="Bpro_0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.862) with cleavage site probability 0.689 at
FT                   residue 37"
FT   gene            complement(476835..477836)
FT                   /locus_tag="Bpro_0462"
FT   CDS_pept        complement(476835..477836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0462"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42426"
FT                   /db_xref="GOA:Q12GB6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB6"
FT                   /protein_id="ABE42426.1"
FT                   /translation="MQYRRLGTSNLKVSTLCLGTMMFGQQTPFDEAARIVASAREQGLN
FT                   FIDTADVYNKGQSEKDVGKLLAGQRHHWVLASKLGNPVSEAVNEGHYSRRWLMQETDAI
FT                   LARLQTDYLDILYLHRDYHEANLEEAVRALGDLIRLGKIRSFGLSNFRGWRIAEVARLC
FT                   KELGVPPPAVCQPYYNLLNRGPEVEILPACGHYGLGVVPYSPLARGVLTGKYPPGQPPA
FT                   EGTRAGSGDKRILETEFREESLVIAQKIKVHCEAKGLVPGQFAAAWVLTNPLISSVIVG
FT                   PRTLAHLEDVYAATELKLTPDDEAFINGLVVPGHASSPGYNDPAYPFFGRPV"
FT   gene            complement(477880..479670)
FT                   /locus_tag="Bpro_0463"
FT   CDS_pept        complement(477880..479670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0463"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42427"
FT                   /db_xref="GOA:Q12GB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB5"
FT                   /protein_id="ABE42427.1"
FT                   /translation="MSMTSPEPLKPRLPAHFLWIALAVAVALGYLFGLGGDHIPRLGDE
FT                   LVYAHIARLTAETGRWLPLVSSYDFMRNTKPPLLFWQAMAAGGWGEHWTLLNLRLPSVV
FT                   YSWAIALMVGLLTWKVVRSEATPAPEASPGAATAADRSSRAITLGAIAALAYLSFLSSY
FT                   RYGRPYLTSAPETFWLFGVFFALAWSPAKLLASRWKFPLLAGITIGIGCLYKSFTMVVP
FT                   VGFGLALCYQVLGARQAPWQIFRRGIVIDTIKVAAICAIALAVFGLWFAVDPQPGEVWR
FT                   EFVVGENAGKFKSSPGYFKVALRGSGGFLTIITGYFSNAGFLLPVAVGCIWTAWRSYRQ
FT                   GVPVSDAEKVLWLWLLALALVFLLPNQRSARYLIPAMPALAILMALYWSRIARLWFSIA
FT                   LALCLLGALAMGLIGFGAVRATQTGWLYSPLFWLFLAALAAACVIGMAQKELTRPIAAA
FT                   AGFAVLFALAWATAPFNGDIGHFRAETNALLKGQAVSVPSNFNGHFERYEFIIPGAKIV
FT                   PYFAAQPVDYQDVNALLNSTRYALVQRRVGQKPCDACRIVDERWDLRSRQDANEGLLAV
FT                   FRTPETYLYAKEYLVERLTP"
FT   gene            complement(479651..480181)
FT                   /locus_tag="Bpro_0464"
FT   CDS_pept        complement(479651..480181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0464"
FT                   /product="GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42428"
FT                   /db_xref="GOA:Q12GB4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB4"
FT                   /protein_id="ABE42428.1"
FT                   /translation="MGTLRSLAEALISRLPPRLQPMARWRFIKFGAVGASGTVINIAVL
FT                   YVAQEFLLTFIADFHSRLNYSIALAITCATISNFYWNRRLTWRDRKHEVHHSALFLFFK
FT                   YVMAAGLSIVVQSLLTKWLAIYLHYILANLVAIVVASVCNFVANDRMTFRRRAKIQPPN
FT                   AATTPPADVHDKP"
FT   gene            complement(480181..481428)
FT                   /locus_tag="Bpro_0465"
FT   CDS_pept        complement(480181..481428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0465"
FT                   /product="glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42429"
FT                   /db_xref="GOA:Q12GB3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB3"
FT                   /protein_id="ABE42429.1"
FT                   /translation="MNIQLQRWIDRWVGIPLCAAVSGLNAVTRALRGPSREVAATTAPR
FT                   AIVVILLSEMGSLVLAHDMFARLKQRYPGAELHALLFRKNREILDLMKVVDPAHVHTVH
FT                   DKSLSGLLSSLWKAIAELRRARVDVAIDCELFSRISSLLSFASGAPVRVGFHRHTQEGL
FT                   YRGSHINRPVPYNPYHHISAQFLALARAIDSTAVPKSKLPMVGTNKPPPHVQLDGALVQ
FT                   GIAQRLAQDFPAIAGKPLVLVYPGGGILPIRAWPLASYTTLCEGLVADGCAVAVIGLKD
FT                   DQALAQQLVANVNQAYPAGPVIDLTGYTRSISELLALFHVARLLVTNDGGPGQFAALTP
FT                   IWTLMLFGPETPALYAPHTPKCHSFYSQWPCSPCLTAYNHRSSYCDGDNQCLKVIAPAT
FT                   VLAKARECLAETPVTA"
FT   gene            complement(481432..482628)
FT                   /locus_tag="Bpro_0466"
FT   CDS_pept        complement(481432..482628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0466"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42430"
FT                   /db_xref="GOA:Q12GB2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GB2"
FT                   /protein_id="ABE42430.1"
FT                   /translation="MLEFEVLKTDARTGEGANAHPGSHARRGQLTLTHGVVQTPIFMPV
FT                   GTYGTVKGVMPQSLHEMGAQIILGNTFHLWMRPGLDVMKQFGGLHRFESWDKPILTDSG
FT                   GFQVWSLGDMRKISEEGVKFASPVNGDKLFLTPEISMQIQTVLNSDIVMQFDECTPYDT
FT                   KGHITTESEARSSMELSLRWAKRCVAEFDKLENPNALFGIVQGGMYQNLRHESLEALVE
FT                   LDLPGYAVGGVSVGEPKEEMQRIMAHTPHRLPADKPRYLMGVGTPEDLVEGVGAGIDMF
FT                   DCVMPTRNARNGHLFTRFGDLKIRNARHKADEQPLDTTCTCYTCKGRTMPDGSTSGGFS
FT                   RAYLHHLDRCGEMLGPMLASIHNLHYYLNLMQEIRDALDAGRFGEFAARFRTDRLRGV"
FT   gene            complement(482651..483712)
FT                   /locus_tag="Bpro_0467"
FT   CDS_pept        complement(482651..483712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0467"
FT                   /product="S-adenosylmethionine"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42431"
FT                   /db_xref="GOA:Q12GB1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB1"
FT                   /protein_id="ABE42431.1"
FT                   /translation="MKTHFSLSDFDFALPEELIAQHPAAQRSASRLLDGRSSPATDRRF
FT                   ADLPDLLTPGDLLVFNDTQVVKARLFGQKSTGGRLELLIERVLPALADASHEVAAHMKV
FT                   SKKPQPGAVLQMDGGFTATLLGRWPQEDGPLYRFRFSSDPYALMAQHGHVPLPPYITHS
FT                   DSAEDELRYQTVFAKNPGAVAAPTAALHFDEAMLAQLEARGIARASVTLHVGAGTFQPV
FT                   KTETIADHTMHFERFEVPAATQQAIAACKARGGRVVAVGTTTVRALESHAKFGPACDDT
FT                   NIFITPGFEFAVVDLLLTNFHLPKSTLMMLVSAFAGYEHIMALYQHAIAGRYRFFSYGD
FT                   AMLLARKAPRASA"
FT   gene            483969..486164
FT                   /locus_tag="Bpro_0468"
FT   CDS_pept        483969..486164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0468"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42432"
FT                   /db_xref="GOA:Q12GB0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GB0"
FT                   /protein_id="ABE42432.1"
FT                   /translation="MSPPGAPARKAATFEEMAGDRGAPKAQVEKPQAKSPAQKALEKLG
FT                   LRRDIDLALHLPLRYEDETRIVQLRDARDGDMVQIEAQVTHSEVTFRPRRQLRVTVDDG
FT                   SDTCVLRFLNFYPSHQKTLSVGARVRVRGEIRGGSFAGGFGREMVHPSFKLAGGELPGA
FT                   LTPVYPTVASLPQAYLRKAVLSGLARADLSETIPQQFLNKNLPQPLSDLREALQFLHHP
FT                   TPDVMLSTLEDRSHPAWQRLKAEELLAQQLSQLQARRGRAAMRAPALGGQSMRNPAADD
FT                   GASLQGPHCTLHEQLLERLPFRLTPAQQRVCAEIDADLQKSIPMHRLLQGDVGSGKTVV
FT                   AALATARCMGAGWQCALMAPTEILAEQHFRKLIGWLEPLGIRTAWLTGSQKAKERREAL
FT                   ALIKSGEAGLVIGTHAVIQDKVEFKNLALAIIDEQHRFGVAQRLALRSKMTEGGQEPHL
FT                   LMMTATPIPRTLAMSYYADLDVSTIDELPPGRTPIVTKVVNDARRDEVIERIRGQLLEG
FT                   RQVYWVCPLIEESESIDLINATQTHEALSAALPGVGVGLLHSRMPVAEKKAVMSLFTEG
FT                   VMGVLVSTTVIEVGVDVPNASLMVIEHAERFGLSQLHQLRGRVGRGAAASACVLLYSTG
FT                   DAPRLGETARERLKAMVQTHDGFEIARRDLEIRGPGEFLGARQSGAPLLRFADLATDTQ
FT                   LLAWARGVAPVMLDQHAGLAQRHILRWLGGKAEFLKA"
FT   gene            complement(486234..486599)
FT                   /locus_tag="Bpro_0469"
FT   CDS_pept        complement(486234..486599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42433"
FT                   /db_xref="GOA:Q12GA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA9"
FT                   /protein_id="ABE42433.1"
FT                   /translation="MKAPSRQLLGGLLIAGSFAILGAAYALLQVVSRGHSLGGAIQFIA
FT                   SFACIGLLLGTIFAFDGGSEVKTTDRPFVRIAVGCFSGLLLALIWHWLGDGIALSVLLS
FT                   GILGYLGTFWARYVDFY"
FT   sig_peptide     complement(486519..486599)
FT                   /locus_tag="Bpro_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.798 at
FT                   residue 27"
FT   gene            487388..487765
FT                   /locus_tag="Bpro_0470"
FT   CDS_pept        487388..487765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0470"
FT                   /product="protein of unknown function DUF1044"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42434"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA8"
FT                   /protein_id="ABE42434.1"
FT                   /translation="MKRVFKTKTFDRWARKVVSDLLLCQAASEIEQGLFEADLGGGVCK
FT                   KRVAVPGRGTSGSTRTLVAKKHRSAIFFLAGREKSQPGSDFSDKEVDATKIIASRLQAA
FT                   DAQKLDELLAAEILKEICNGK"
FT   gene            487755..488090
FT                   /locus_tag="Bpro_0471"
FT   CDS_pept        487755..488090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0471"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42435"
FT                   /db_xref="GOA:Q12GA7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA7"
FT                   /protein_id="ABE42435.1"
FT                   /translation="MANKKPTEKNRVLDEMMEMAQALQGHELISKQDMAKMKLICQSPP
FT                   EYTAEKVTAIRVGRAKVSQSVLASILNVSVSAVQKWESPSSGKHPSGAAAKLLQLIDKK
FT                   GLESILA"
FT   gene            488160..489155
FT                   /locus_tag="Bpro_0472"
FT   CDS_pept        488160..489155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0472"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42436"
FT                   /db_xref="GOA:Q12GA6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA6"
FT                   /protein_id="ABE42436.1"
FT                   /translation="MTLTELKYIVAVAREKHFGKGAEACHVSQPTLSVAIKKLEEELQV
FT                   KLFERNANEITVTPLGEEIVRQAQSVLEQAENIREIAKRGKDPLAGALRLGVIYTIGPY
FT                   LLPDLVRQAIAKTPQMPLMLQENFTVKLLEELRTGEIDCAILAEPFPDTNLAIAPLYDE
FT                   PFMAAVPSAHALAARISVSAEELKKETMLLLGNGHCFRDHVLEVCPEFARFSSSADGIR
FT                   KSFEGSSLETIKHMVAAGMGITLVPRLGVPKEALLEAPVAKKPAKGKAAMAAAAAAAQP
FT                   NFIKYLPFEGHVPSRRVVLAWRRSFTRYEAIAALRNAIYACELPGVTRLS"
FT   gene            489163..490086
FT                   /locus_tag="Bpro_0473"
FT   CDS_pept        489163..490086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0473"
FT                   /product="Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42437"
FT                   /db_xref="GOA:Q12GA5"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA5"
FT                   /protein_id="ABE42437.1"
FT                   /translation="MSLSQPGISQAVPTVGRYAFFSITAPAAAQPAVLRQSLQRLAPLV
FT                   DGQAVVAAFGARLVAALGGTVPGLRDFPVLSEGAVEVPATPTALCLWLRGSDQGDLVLL
FT                   TRRLEKALAPAFHLDRVIESFRHGRGPTGHGRDLTGYEDGTENPEGEAADAAAFVQGLG
FT                   AGLDGSSFVAIQQWLHDLDAFEAMSRAEQDNTVGRRRSDNEELEDAPESSHVKRTAQES
FT                   FQPEAFVLRRSMPWALHAPGGSKVGLVFVAFGCSFDAFEAQMRRMAGLDDGIVDALFRI
FT                   SRPVSGAYLWCPPMQAGRLDLRQLGL"
FT   gene            490086..490946
FT                   /locus_tag="Bpro_0474"
FT   CDS_pept        490086..490946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0474"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42438"
FT                   /db_xref="GOA:Q12GA4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GA4"
FT                   /protein_id="ABE42438.1"
FT                   /translation="MLRRKLGLYLALIRWNRPAGWLLLLWPTLSALWVASHGFPGWHLL
FT                   TVFTLGTILMRSAGCCVNDVADRDFDRHVKRTAQRPVTSGQVSVREALVLGAVLALLAF
FT                   GLVLTTNAATIAWSFAALAVTLAYPFAKRYVSMPQAVLGVAFSFGIPMAFAAVQSRVPL
FT                   LAWVLLLGNLCWVIAYDTEYAMVDRDDDLKIGMKTSAITLGRFDVAGVMLSYLVYLSVW
FT                   ALALADIPQAAIYWMAIGLAGLQALWHGWLIRKRERDDCFKAFRLNHWLGFTVFAGIAL
FT                   SYLAA"
FT   sig_peptide     490086..490202
FT                   /locus_tag="Bpro_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.696) with cleavage site probability 0.611 at
FT                   residue 39"
FT   gene            complement(491027..491863)
FT                   /locus_tag="Bpro_0475"
FT   CDS_pept        complement(491027..491863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0475"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42439"
FT                   /db_xref="GOA:Q12GA3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA3"
FT                   /protein_id="ABE42439.1"
FT                   /translation="MSTPNPGSNEHIAFIGGGNMASAVIGGLLKQGLPAGQIQVVEPFA
FT                   EQRARLVQQFGVAVSDAPGASLSSAGLVVWAVKPQTFKEAAAQARAHTQAALHLSVAAG
FT                   IRSDSIAQWLGTERVVRSMPNTPALVGKGMTALFARPAATAADRAAVERVIQTTGEYLW
FT                   LNDEVQLDAVTALSGSGPAYVFYFLEAMIQAGTDMGLEPEQARKLAVGTFVGASALAHA
FT                   SDEPLEVLRARVTSKGGTTYAALTSMEQAGIKQQFMQAIEAARQRAGELGDEFGAA"
FT   gene            complement(491944..493437)
FT                   /locus_tag="Bpro_0476"
FT   CDS_pept        complement(491944..493437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0476"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42440"
FT                   /db_xref="GOA:Q12GA2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12GA2"
FT                   /protein_id="ABE42440.1"
FT                   /translation="MTYLLALDQGTSSSRSIVFDELGHIVAQAQQELPQIYPKPGWVEH
FT                   DPMEIWRTQLATAREALGKAGLKASDIRALGITNQRETTVVWHRATGQPIHNAIVWQDR
FT                   RAEATCAQLREQGKEALIQSKTGLLIDAYFSGTKLKWLLDNVPGVRAQAERGELAFGTI
FT                   DSWLMWQLTGGALHATDVSNASRTMLFNVRTNQWDAELLDLLGIPASLMPQVLPSSAHY
FT                   GETRPELLGHAIAIGGVAGDQQSALFGQACFKAGMAKNTYGTGCFMLMHTGTQFQTSHN
FT                   GLLTTSAAQTTAHPEFAMEGSVFVGGAVVQWLRDGLHAIQGSGEVQALAQSVPDSGGVM
FT                   MVPAFTGLGAPYWKPDARGTITGLTRGTTVAHIARAALESIAYQSAALLQAMSRDAVSS
FT                   GAAPLAELRVDGGACANDLLMQFQADLLGIPVLRPAVIETTALGAAYLAGLSSGVYRST
FT                   DELSGMWRAERTFLPTLGADSAAALMNRWEHAVRQTVLP"
FT   gene            complement(493492..494271)
FT                   /locus_tag="Bpro_0477"
FT   CDS_pept        complement(493492..494271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0477"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42441"
FT                   /db_xref="GOA:Q12GA1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA1"
FT                   /protein_id="ABE42441.1"
FT                   /translation="MRTPVNSNPRQIKLLDFVRAHGAASVEQLADKLGVTLQTVRRDVQ
FT                   RLADAGLLARFHGGVRVPSSTVENIAHQQRKSLSAEGKARIARAVAQRVPNDCSLILNI
FT                   GTTTEAVAKALLHHKGLRVITNNLNVAEILCGNPDCEVIVAGGVVRARDRGIVGEAAVD
FT                   FIRQFRVDIAVIGISGIEPDGSLRDFDYREVKVAQAIIAHAREVWLAADSSKFNRPAMV
FT                   ELAQLSQIDRLFTDKAPPEPFPALLEEANVICEIAHA"
FT   gene            494486..495568
FT                   /locus_tag="Bpro_0478"
FT   CDS_pept        494486..495568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0478"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42442"
FT                   /db_xref="GOA:Q12GA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12GA0"
FT                   /protein_id="ABE42442.1"
FT                   /translation="MQLALDHISKKVGAEHWLYELSLAPRSGEVTVLLGATQAGKTSLM
FT                   RIMAGLDVPTKGRVLVDNANVTATPVRERNVAMVYQQFINYPSLKVFDNIASPLRLRGE
FT                   PNIDQQVRSLAGRLHIEMFLDRLPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDY
FT                   KLREELREELTQLFAAGDSTVIYATTEPGEALLLGGYTAVMDGGELLQYGPTAEVFHTP
FT                   QSLRVARAFSDPPMNLIAALPVGQGVQLVGGPVLRMAVPSVSAQRLATLTAGIRGSALR
FT                   IEERAGDVVLAGRVELAEISGSDTFVHVATAAGELVAQLTGVHYFDLGVPLTLYLDPAQ
FT                   AYVFDAAGALLVAPGRKGGR"
FT   gene            495569..496648
FT                   /locus_tag="Bpro_0479"
FT   CDS_pept        495569..496648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0479"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42443"
FT                   /db_xref="GOA:Q12G99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G99"
FT                   /protein_id="ABE42443.1"
FT                   /translation="MARIDLDLAHAYRPNPRQDSDYALLPLKMSFRDGGAYALLGPSGC
FT                   GKTTMLNIMSGLLVPSQGSVRFDGLDVTRASPQQRNIAQVFQFPVIYDTMTVAENLAFP
FT                   LRNRKVAEAQIKKRVGEIAEMLDMSGQLNHRASGLAADAKQKISLGRGLVRPDVSAVLF
FT                   DEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTFAEEVVVMTRGRAVQTG
FT                   SADALFEKPSHTFVGHFIGSPGMNFLPAVVRAGVLRVAGQVLVLPADRALPDGDLKLGV
FT                   RPEYVVQAPPGDPAALPFKVTLVQDIGTHVMLTATIGEHTLKARLKPEAEVPQAGQQVW
FT                   LQVMGPHTCFYINEELVAA"
FT   gene            496734..497624
FT                   /locus_tag="Bpro_0480"
FT   CDS_pept        496734..497624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0480"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42444"
FT                   /db_xref="GOA:Q12G98"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G98"
FT                   /protein_id="ABE42444.1"
FT                   /translation="MSTTTKPVNQKAWLLVLPVIICVAFSAILPLMTVVNYSVQDIISP
FT                   ERRVFVGTEWFAAVMRDEDLHAALWRQLTFSLAVLAVEIPLGIALALSMPAQGWKASLV
FT                   LVLVALSLLIPWNVVGTIWQIYGRADIGLLGAMLQKMGFDYSYTGNASHAWATVLMMDV
FT                   WHWTPLVALLCYAGLRSIPDAYYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMD
FT                   SFMIYTEPFVLTGGGPGNSTTFLSQYLTQKAVGQFDLGPAAAFSLIYFLIILLLCFILY
FT                   NWMKRVGTQEKEGEQ"
FT   sig_peptide     496734..496814
FT                   /locus_tag="Bpro_0480"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.803 at
FT                   residue 27"
FT   gene            497706..498518
FT                   /locus_tag="Bpro_0481"
FT   CDS_pept        497706..498518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0481"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42445"
FT                   /db_xref="GOA:Q12G97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G97"
FT                   /protein_id="ABE42445.1"
FT                   /translation="MSKPKFQARTLFLIAYIVFALLPIYWMVNMSFKTNAEIVSSFSFF
FT                   PQHFTWDNYKTIFTDPSWYSGYINSLIYVAINTVISITVALPAAYAFSRYSFLGDKHVF
FT                   FWLLTNRMTPPAVFLLPFFQLYTTVGLMDTHIAVALAHLLFNVPLAVWILEGFMSGIPR
FT                   EIDETAYIDGYSFPGFFVRIFLPLIKAGVGVAAFFCFMFSWVELLLARTLTSVNAKPIV
FT                   ATMTRTVSASGMDWATLAAAGVLTIVPGAIVIWFVRNYIAKGFAMGRV"
FT   sig_peptide     497706..497816
FT                   /locus_tag="Bpro_0481"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.723 at
FT                   residue 37"
FT   gene            498648..498956
FT                   /locus_tag="Bpro_0482"
FT   CDS_pept        498648..498956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0482"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42446"
FT                   /db_xref="GOA:Q12G96"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G96"
FT                   /protein_id="ABE42446.1"
FT                   /translation="MFEWMAWTTPVAVFFSCIVLMLVGMTAWELRSPTRLERGFLPMET
FT                   TRGDRLFIGLLSAAYVNLIFVGISGKLAGWLNLEADPSIWISFVFSMALLAFIMRKG"
FT   gene            499053..500792
FT                   /locus_tag="Bpro_0483"
FT   CDS_pept        499053..500792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0483"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42447"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G95"
FT                   /protein_id="ABE42447.1"
FT                   /translation="MKMRNTRRTALALAAACAMAGPGWADEAAARKWIDAEFQPSTLSK
FT                   DKQQAEMKWFIDAAKKLQAKGVKEISVVSETITTHEYESKTLAKAFEEITGIKVKHDLI
FT                   QEGDVVEKLQTSMQSGKSIYDGWVSDSDLIGTHYRYGKIMNLTDYMAGKGKDYTNPGLD
FT                   LKDFIGTKFTTGPDGKLYQLPDQQFANLYWFRADLFARQDLKDKFKAKYGYDLGVPLNW
FT                   SAYEDIAEFFSVDVKTIDGKPIYGHMDYGKKDPSLGWRFTDAWLSMAGTADIGAPNGLP
FT                   VDEWGIRVAADKCTPVGASVSRGGATNSPAAVYALTKYVDWMKKYAPKEATGMTFGEAG
FT                   PVPAQGQIAQQIFWYTAFTADMTKPGLPVVNADGTPKWRMAPGPNGPYWKQGMQNGYQD
FT                   VGSWTFFTNHDADRTAAAWLYAQFITSKTTSLKKTIVGLTPIRESDIQSKAMTDMAPKL
FT                   GGLVEFYRSPARVAWSPTGTNVPDYPKLAQLWWKNVAEAVTGEKTPQKAMDNLAEEMDN
FT                   VMGRLQRAGMANCAPKLNPKGDPAKYLSDKAAPWAKLANEKPKGETINYDKLLQAWKDG
FT                   KAR"
FT   sig_peptide     499053..499130
FT                   /locus_tag="Bpro_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            501130..502731
FT                   /locus_tag="Bpro_0484"
FT   CDS_pept        501130..502731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0484"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42448"
FT                   /db_xref="GOA:Q12G94"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G94"
FT                   /protein_id="ABE42448.1"
FT                   /translation="MQPMTTESLPAPAPTRRHDLIARLAQPCQYDLAIIGGGATGLGVA
FT                   LDAAARGFSVVLVESHDFAKGTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLANA
FT                   PHLAQPLAFVMPSYKFWEAPFYGVGLKMYDALAGKAGLGPTEFLSRTETLDCLPTAQPQ
FT                   GLKGGVKYWDGQFDDARLALALARTAARQGALLVNYCAATGLIHENGKLVGLHAQDQET
FT                   GRLFEIKAKCVVNAAGVWVDQLRLQDGQAIGRETQPMVAPSQGVHIVVDRSFLPTDHAM
FT                   LIPKTADGRVLFAVPWLGKTILGTTDTPRHDLAREPLPFKEEVDFILRESARYLSRAPG
FT                   PTDIKSIWVGLRPLVKPSDDHAERTQALSREHTVLVSNSGLVTVTGGKWTTYRAMAEDV
FT                   METCFAAGLLPRRAGTATAHLKLVGAQDLGRKISDAPGVHLYGSEAAVVQGLPGAAHEL
FT                   GGGLTEAMVRFAARYEYARCVEDVLARRSRLLFLDAALARSLASEVAVLLQQENGVDPQ
FT                   LEAFLALCGQYLSLPD"
FT   gene            503173..503541
FT                   /locus_tag="Bpro_0485"
FT   CDS_pept        503173..503541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0485"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42449"
FT                   /db_xref="GOA:Q12G93"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G93"
FT                   /protein_id="ABE42449.1"
FT                   /translation="MIQTQSKLDVADNTGAKSVMCIKVLGGSKRRYASVGDVIKVSIKE
FT                   AAPRGRVKKGEVYSAVVVRTAKGIRRGDGSLVKFDGNAAVLLNAKLEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   gene            503551..503871
FT                   /locus_tag="Bpro_0486"
FT   CDS_pept        503551..503871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0486"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42450"
FT                   /db_xref="GOA:Q12G92"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G92"
FT                   /protein_id="ABE42450.1"
FT                   /translation="MNKIRKGDEVIVIAGRDKGKRGTVSLRKDDSHVLVDGINLVKKHT
FT                   KPNPLKGTTGGIVEKSMPIHQSNVAIFNAATGKADRVGIKLLADGKKVRVFKSSGDEIK
FT                   AA"
FT   gene            503874..504413
FT                   /locus_tag="Bpro_0487"
FT   CDS_pept        503874..504413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0487"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42451"
FT                   /db_xref="GOA:Q12G91"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G91"
FT                   /protein_id="ABE42451.1"
FT                   /translation="MARLQDQYREKIAPSLIEKFGYTSPMQVPRITKITLNMGVSEAVA
FT                   DKKVMDNAVSDMTKIAGQKPVVTKAKKAIAGFKIREDLPIGCMVTLRGVQMYEFLDRFV
FT                   TVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKTD
FT                   EECKALLTAFRFPFKN"
FT   gene            504422..504727
FT                   /locus_tag="Bpro_0488"
FT   CDS_pept        504422..504727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0488"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42452"
FT                   /db_xref="GOA:Q12G90"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G90"
FT                   /protein_id="ABE42452.1"
FT                   /translation="MAKQALLQRELKREKLAAKFAKKYAELKATSNDAKRSDEERALAR
FT                   LELQKLPRNANPTRQRNRCAITGRPRGTFRQFGLARAKIRELAFAGDIPGITKASW"
FT   gene            504746..505141
FT                   /locus_tag="Bpro_0489"
FT   CDS_pept        504746..505141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0489"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42453"
FT                   /db_xref="GOA:Q12G89"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G89"
FT                   /protein_id="ABE42453.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKAVVLVPSSKVKVAIAQVLKDEGY
FT                   IDGFSVKTDDGKSQLEIALKYYAGRPVIERIERVSRPGLRVYKGHGAIPQVMNGLGVAI
FT                   VTTPQGVMTDRKARATGIGGEVLCYVA"
FT   gene            505166..505699
FT                   /locus_tag="Bpro_0490"
FT   CDS_pept        505166..505699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0490"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42454"
FT                   /db_xref="GOA:Q12G88"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G88"
FT                   /protein_id="ABE42454.1"
FT                   /translation="MSRVGKMPVTLPQGVDVAIKDDQINVKGALGALALTQNALVTIKN
FT                   DAGKLTFAPANDSREANAMSGTMRQLVNNMVTGVTKGFEKKLSLIGVGYKAQAQGAKLN
FT                   LTVGYSHPVIMDMPAGITVATPTPTEVVIKGSDRQRVGQIAAEVRAVRPPEPYKGKGIR
FT                   YADEKITIKETKKK"
FT   gene            505711..506076
FT                   /locus_tag="Bpro_0491"
FT   CDS_pept        505711..506076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0491"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42455"
FT                   /db_xref="GOA:Q12G87"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G87"
FT                   /protein_id="ABE42455.1"
FT                   /translation="MLTKKEQRLRRSRQTRIRIATQGVARLTVNRTNLHIYASVISGDG
FT                   TKVLAAASTAEVEVRKEIGASGKGGNVAAAQAIGKRIAEKAKAAGVEKVAFDRAGFAYH
FT                   GRVKALADAAREAGLQF"
FT   gene            506094..506612
FT                   /locus_tag="Bpro_0492"
FT   CDS_pept        506094..506612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0492"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42456"
FT                   /db_xref="GOA:Q12G86"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G86"
FT                   /protein_id="ABE42456.1"
FT                   /translation="MAKFQAKSQNDAPDDGLKEKMIAVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKSKEVPAAVQKAMEEARRNMTKVSLKNGTIHHNVFGHWGAANVMMAP
FT                   APKGTGIIAGGPMRAVFEVMGITDIVAKSHGSSNPYNMVRATMDALNNSTTASEIAAKR
FT                   GKSVEEIFG"
FT   gene            506625..506807
FT                   /locus_tag="Bpro_0493"
FT   CDS_pept        506625..506807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0493"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42457"
FT                   /db_xref="GOA:Q12G85"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G85"
FT                   /protein_id="ABE42457.1"
FT                   /translation="MTKEAKVKVQLVRSPIGTKESHRATVRGLGLRGVNSVSELQDTPA
FT                   VRGMINKISYLVKVI"
FT   gene            506821..507252
FT                   /locus_tag="Bpro_0494"
FT   CDS_pept        506821..507252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0494"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42458"
FT                   /db_xref="GOA:Q12G84"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G84"
FT                   /protein_id="ABE42458.1"
FT                   /translation="MELNGIKPSLGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRAGGY
FT                   HKVGFEGGQMPMQRRLPKRGFKSHLLKFNAEVTLSALEQLGLAEVDLLALKTAGLVGQL
FT                   AKNVKVIKSGELSKAVKLNGISATAGAKAIIEAAGGSVA"
FT   gene            507273..508592
FT                   /locus_tag="Bpro_0495"
FT   CDS_pept        507273..508592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0495"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42459"
FT                   /db_xref="GOA:Q12G83"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G83"
FT                   /protein_id="ABE42459.1"
FT                   /translation="MATSSAQIAKTGKYGDLRNRLVFLLLALVVYRIGAHIPVPGIDPG
FT                   QLKELFKGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLLTYVVPTFEQMK
FT                   KEGESGRRKITQYTRYGTLALALFQSMGIAVALESSPGLVLVPGFGFRMTAVFSLTAGT
FT                   MFLMWLGEQITERGLGNGISILIFAGIAAGLPGAMGGLLELVRTGAMSVLVAIVIVAVV
FT                   VLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILL
FT                   PATVVGWFSSGESMRWLKDIAGTLTPGQPIYVMLYASAIVFFCFFYTALVFNSRETADN
FT                   LKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGT
FT                   SLMIIVVVTMDFMAQVQNYMMSQQYESLLKKANFKTSLGG"
FT   gene            508611..508829
FT                   /locus_tag="Bpro_0496"
FT   CDS_pept        508611..508829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0496"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42460"
FT                   /db_xref="GOA:Q12G82"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G82"
FT                   /protein_id="ABE42460.1"
FT                   /translation="MSKDDVIQMQGEVVENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLSRARIVFRAK"
FT   gene            508858..508971
FT                   /locus_tag="Bpro_0497"
FT   CDS_pept        508858..508971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0497"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42461"
FT                   /db_xref="GOA:Q12G81"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G81"
FT                   /protein_id="ABE42461.1"
FT                   /translation="MRVSASVKKICRNCKIIRRKGVVRVICTDPRHKQRQG"
FT   gene            508997..509362
FT                   /locus_tag="Bpro_0498"
FT   CDS_pept        508997..509362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0498"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42462"
FT                   /db_xref="GOA:Q12G80"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G80"
FT                   /protein_id="ABE42462.1"
FT                   /translation="MARIAGINIPPQQHAEIGLTAIFGIGRTRARKICEACDIAYSKKI
FT                   KDLTDGDLEKIRDQIALFTIEGDLRRETTMNIKRLMDIGCYRGFRHRRGLPMRGQRTRT
FT                   NARTRKGPRKAAAALKK"
FT   gene            509376..509780
FT                   /locus_tag="Bpro_0499"
FT   CDS_pept        509376..509780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0499"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42463"
FT                   /db_xref="GOA:Q12G79"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G79"
FT                   /protein_id="ABE42463.1"
FT                   /translation="MAKSPSNNAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGN
FT                   ALSWASSGGQGFKGSRKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRA
FT                   LGALGIRINSIADVTPVPHNGCRPQKRRRI"
FT   gene            509909..510532
FT                   /locus_tag="Bpro_0500"
FT   CDS_pept        509909..510532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0500"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42464"
FT                   /db_xref="GOA:Q12G78"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G78"
FT                   /protein_id="ABE42464.1"
FT                   /translation="MARYLGPKAKLSRREGTDLFLKSARRAISDKAKFDSKPGQHGRTS
FT                   GTRTSDFGLQLREKQKVKRMYGVLEKQFRRYFEEADRRKGNTGANLLFILESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAITVNGNSVNIPSYMVKTGDVIAVRDKSKKQTRVTEALELA
FT                   KQVGLPAWVDVNADKGEGVFKKVPDRDEFAADVNESLIVELYSR"
FT   gene            510628..511617
FT                   /locus_tag="Bpro_0501"
FT   CDS_pept        510628..511617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0501"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42465"
FT                   /db_xref="GOA:Q12G77"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G77"
FT                   /protein_id="ABE42465.1"
FT                   /translation="MQTNLLKPKTINVEQLGANRAKVTLEPFERGYGHTLGNALRRVLL
FT                   SSMVGHAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGE
FT                   GPVTAADIQTPHDVEIINPEHVIVNLSHGGKIDMQIKVENGRGYVPGTMRRYGDESPKS
FT                   IGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVLEIETNGAVTAEDAVRASAKILVE
FT                   QLAVFAQLEGNELAAFDAPVQRSSQQFDPILLRPVDELELTVRSANCLKAENIYYIGDL
FT                   IQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMRLESWPPAGLDKR"
FT   gene            511700..512098
FT                   /locus_tag="Bpro_0502"
FT   CDS_pept        511700..512098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0502"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42466"
FT                   /db_xref="GOA:Q12G76"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12G76"
FT                   /protein_id="ABE42466.1"
FT                   /translation="MRHGHGLRKLNRTSEHRLAMLRNMMNSLLQHEVIKTTLPKAKELR
FT                   RVVEPMITLAKEPTVANKRLAFDRLRDRDMVVKLFAELGPRYKARPGGYTRILKMGFRV
FT                   GDNAPMALVELVDRPEIEDTTADAAKAE"
FT   gene            512117..512193
FT                   /locus_tag="Bpro_R0003"
FT                   /note="tRNA-Met1"
FT   tRNA            512117..512193
FT                   /locus_tag="Bpro_R0003"
FT                   /product="tRNA-Met"
FT   gene            512533..513258
FT                   /locus_tag="Bpro_0503"
FT   CDS_pept        512533..513258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42467"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G75"
FT                   /protein_id="ABE42467.1"
FT                   /translation="MYLPRNFSSSRLVRLLSDLASVDVEASRQDFAERLGLWLDVFDGI
FT                   TLHAAHQSIKTVDEEKPSDRLLARTFALEEEFHRVRTALVKAITASSASPASGTETDAG
FT                   YAPYHQRYLDQQRHMALRIDALRAHVRQAIAKVSPQLGQLATFDAVMEQMFGGREQKLL
FT                   STVPVLLERRFGHLRKTRQLGLDAAQQQDALASWRQPGGWLDVFGKEVQEVLLAELEVR
FT                   LQPVVGLIEAFSNEVKTYQ"
FT   gene            513255..515426
FT                   /locus_tag="Bpro_0504"
FT   CDS_pept        513255..515426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42468"
FT                   /db_xref="GOA:Q12G74"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G74"
FT                   /protein_id="ABE42468.1"
FT                   /translation="MNRIFFAVAFAIGLMTVTWVGLGFVGSSWMALVMTAVIAGVYLLG
FT                   AFELRQFRAATASLAAALADIPQPLPDIGVWLVGVPPSLQNSVRLRIEGERVALPGPAL
FT                   TPYLVGLLVMLGMLGTFLGMVVTFKGAVFALEGSTDLHAIRSALAAPIKGLGLAFGTSV
FT                   AGVAASAMLGLLSAISRRERVDVARQLDSRIATVFRPFSLAHQRQETFKALQVQAHALP
FT                   DVVDKLQTMMEGMERRSQQLNEQLLGSQAQFHREVSVAYTGLADTVGQSLKDSLTASAR
FT                   VAGESIKPVVEAAMTEIAQESKRLHERVSDAAQTQLTGLSAQFSATARAVSETWTTALQ
FT                   NHARTSESQVNGLDRALAAFTDTFEQRSGVLLATVNEAVSRSQSDQASSDRQRLQAWTQ
FT                   ALESMAATLHGEWQRVGAQSLAQQQAVCLTLEKTAGEITERASHQASRTLDDIARLSTH
FT                   SEELIRSRIDSEADWMQQHGDRMDQLASVWRTELDALREEEATRGNAAVERLGELQAAL
FT                   ASHLATLGAALETPMTRLMQTASEVPQAAAEVIAQLRQEMTRLTERDNLALEERTGLVE
FT                   QIRALLQTIHQASGEQRAAIESLVGSAAAVLDKAGSQFAETLGAQAGKAEDMAAHLTGS
FT                   AVELASLGESFNHGVQLFNATNEKLIESLQRMEGTMNQSMARSDEQLAYYVAQAREVID
FT                   LSITSQQGIVEDLRQLHSKQASQSEGVAG"
FT   sig_peptide     513255..513374
FT                   /locus_tag="Bpro_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.337 at
FT                   residue 40"
FT   gene            515423..516085
FT                   /locus_tag="Bpro_0505"
FT   CDS_pept        515423..516085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0505"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42469"
FT                   /db_xref="GOA:Q12G73"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G73"
FT                   /protein_id="ABE42469.1"
FT                   /translation="MIDLDERGDGMEQTAPVWAVFGDLMSGLLGAFVLILVGVLVVQMD
FT                   LMANLEAEVQKRRVEEQRRIALEKALAIPLATGRVTLNNGRIGISGSVLFPLNSDQLRP
FT                   DGRLLLKSLVPPLQVYLGERDELLMVSGFTDDKPIQEGNQRFADNLALSAQRALTVTRA
FT                   LIEEGMPSSRAFAAAFGAEQPVASNTDEKGRALNRRVEMAPVPKSANVKPSTPSAHE"
FT   gene            516102..516845
FT                   /locus_tag="Bpro_0506"
FT   CDS_pept        516102..516845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42470"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G72"
FT                   /protein_id="ABE42470.1"
FT                   /translation="MPHSQRDGEKSLLSWHASLRNEGAQRLDPARFHYLELLSQRMDTA
FT                   PGEVRRILEGKLKIALADYGERFRQAQKAASDELASLSAKHPDLARELQRLFAAGDYGG
FT                   MRRLGAQSAFTRPCAPLAQLNQYIQNVKQDAIDRRLGSGPGSSLVSDMEAVSEMASVRR
FT                   FREVWSRIAAEDQVDQAVGRGPVNAGPLNSHMLVLRSLALMRKLSPDYLRRFLSHVDTL
FT                   LWLDQANQKYTPVKAKPARRSRQKK"
FT   gene            complement(517070..517276)
FT                   /locus_tag="Bpro_0507"
FT   CDS_pept        complement(517070..517276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0507"
FT                   /product="protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42471"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G71"
FT                   /protein_id="ABE42471.1"
FT                   /translation="MSSHVYKQLELTGSSATSIEDAVSTAIAKAHETVRNIQWFTVTET
FT                   RGHVVDGKVAHWQVSMKIGFTLE"
FT   gene            517356..517634
FT                   /locus_tag="Bpro_0508"
FT   CDS_pept        517356..517634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42472"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G70"
FT                   /protein_id="ABE42472.1"
FT                   /translation="MPALQTQKIPSPIDEGKRIYPCMPGWPFIDWAAFRSRRGFLAPIR
FT                   FSEALAPWFVIPDLIRDPWIAGRARNDKSRFSSFRFRVNNLNEPYCG"
FT   gene            complement(517893..518273)
FT                   /locus_tag="Bpro_0509"
FT   CDS_pept        complement(517893..518273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0509"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42473"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G69"
FT                   /protein_id="ABE42473.1"
FT                   /translation="MPLLHISLRAGKPEAYRQAIFDSLYCAMRETFNVPEDDQFMSISE
FT                   HDAANFRYGASYLGVARSDDLVFIQITANNTRTVEQKKALFRRIAELLGESPGIRPEDV
FT                   FVSLVEVAKENWSLGHGLAQYA"
FT   gene            518352..519215
FT                   /locus_tag="Bpro_0510"
FT   CDS_pept        518352..519215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0510"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42474"
FT                   /db_xref="GOA:Q12G68"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G68"
FT                   /protein_id="ABE42474.1"
FT                   /translation="MKMMERPLDLDAIEAFIRIAELDSFTRAAEAMRTTQAAVSLKLKR
FT                   LEERLGCRLVERTPRHVQLSAQGAAFLEHARELLEVHDRALAVFAGARQRLTIGISDHV
FT                   AGPELPALIARMNAQDPQLLIEIRIGSSGDLLQSFDRRELDTVIVRLHVGRSDGEILTE
FT                   EKFGWFAAPSWQHRAGEPLPLATLAEPCGVRAMAGQFLDAAAVPWIEIFVGGGVAAVAA
FT                   AVMAGLGVAALAPRMLPFGAVDVGPKLGLPDLPRLPVLLHSRVKDGRSRDALAALSAAF
FT                   RSAVRG"
FT   gene            519384..519866
FT                   /pseudo
FT                   /locus_tag="Bpro_0511"
FT   gene            519985..520269
FT                   /locus_tag="Bpro_0512"
FT   CDS_pept        519985..520269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42475"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G67"
FT                   /protein_id="ABE42475.1"
FT                   /translation="MLLPCTQLQVAIRASTSPIEDGDHRPFFPQAFKADHVAFCTGQIH
FT                   AWCVVSCFLRAEFNASLFEFGSCTLHHGDALWGDTAGETRFVGCEFGGE"
FT   gene            complement(520326..520832)
FT                   /locus_tag="Bpro_0513"
FT   CDS_pept        complement(520326..520832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0513"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42476"
FT                   /db_xref="GOA:Q12G66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G66"
FT                   /protein_id="ABE42476.1"
FT                   /translation="MGIAVVLLGLVLVSGIDTATFTSRSLLGDAMFIAAGTLWAGFGVL
FT                   LRKHRLDTLLATSVIAFSALVTHVPCYFWVTGAKGLLATSSEVFWTEALIQGLPAGTGT
FT                   LFTYAKMVSILGPARAAVFPALAPGLAALMAWPILGHTPGTFEVIGLLIVMAGLLFAVT
FT                   GASKR"
FT   gene            complement(520839..521264)
FT                   /locus_tag="Bpro_0514"
FT   CDS_pept        complement(520839..521264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42477"
FT                   /db_xref="GOA:Q12G65"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G65"
FT                   /protein_id="ABE42477.1"
FT                   /translation="MQNTLLPHSPTSPTGETAKLAAGIAVGLLAASIGAFYTVYARWGI
FT                   ARGLSSPDLTALHFGVAGLAMLPLLVKAFASQRTVLTEQWRVWIAVSLLAGTPFGLLMF
FT                   GALQFAPSSHAAVFPFSAMSVMGMLIGAWVLQDRITR"
FT   gene            complement(521288..521824)
FT                   /locus_tag="Bpro_0515"
FT   CDS_pept        complement(521288..521824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0515"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42478"
FT                   /db_xref="GOA:Q12G64"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G64"
FT                   /protein_id="ABE42478.1"
FT                   /translation="MTTINVPTREKVSPANQAIFDNLKKALGMVPNLYATFAHSETALA
FT                   SYMAFQNAKSSVSGKAREVVNLVVSQVNECEYCLAAHTMLGKMNGFTDEQILEIRHGHA
FT                   SFDGKFDALARLTKGITQNRGHVDQTLVTAFFAAGWTKENLVDAIVIIGDKTVSNYLHS
FT                   TTQVPVDFPAAPKLD"
FT   gene            complement(521879..522628)
FT                   /locus_tag="Bpro_0516"
FT   CDS_pept        complement(521879..522628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0516"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42479"
FT                   /db_xref="GOA:Q12G63"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G63"
FT                   /protein_id="ABE42479.1"
FT                   /translation="MNQPTVLVTGALTGIGRATAIAFAKQGANVVVSGRREEAGQSLAA
FT                   ELRTLGAKAEFIKADVANEAEVRSLVEKAVSLFGQLDIAINNAGTEGALGPITEQSTEN
FT                   VHATFSTNVLGTLLSMKHEIRAMQAQGHGSIVNLSSIAGKVGMAGASVYVASKHAVEGL
FT                   TKSAALEGAAFGVRVNAVAPGPVQTDMLDRFVGRDESVKAGFMAGVPAKRAATVDEIAE
FT                   TIIFVASSKAPYLTGQSIAVDGGFTIQ"
FT   sig_peptide     complement(522554..522628)
FT                   /locus_tag="Bpro_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.943) with cleavage site probability 0.682 at
FT                   residue 25"
FT   gene            522746..523669
FT                   /locus_tag="Bpro_0517"
FT   CDS_pept        522746..523669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0517"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42480"
FT                   /db_xref="GOA:Q12G62"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G62"
FT                   /protein_id="ABE42480.1"
FT                   /translation="MDKLSAMKTFVRVVEAGSFSAVADEMRATQSAISKQVAALEKELG
FT                   TKLLIRTTRSLSLSEEGERYFEQARRLVGEIAEAESDLRKGEGRLSGWLRVAASVGFGR
FT                   LKLMPLVKAFMDTHAGVKIDLRLHDGFIDLIEQGIDISVRIGELPDSGLIARRVGTSQR
FT                   MLLAHRDYLRSLPKGVKAPVNPEDLSNHNCVVYTELATRNLWAFEAGAGASEPLGTVKA
FT                   VRVGGRIQTNSSEVIRSAVTAGMGIGYSPTWLFESELARGEVVRVMPDWQSPHLPIHMV
FT                   SPPERKHSAKVKAFVEHVALELTSGK"
FT   gene            523696..523956
FT                   /locus_tag="Bpro_0518"
FT   CDS_pept        523696..523956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42481"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G61"
FT                   /protein_id="ABE42481.1"
FT                   /translation="MPAEGCTESMACMTTPAGTPSESAVTQPAPILVLDRKSNGHAIYD
FT                   PEAKRALAQQCLQPGVSVAATALRAEPADVIQVARHPREIT"
FT   gene            complement(523953..524864)
FT                   /locus_tag="Bpro_0519"
FT   CDS_pept        complement(523953..524864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0519"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42482"
FT                   /db_xref="GOA:Q12G60"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G60"
FT                   /protein_id="ABE42482.1"
FT                   /translation="MDKIESITAFVSVARAGGFSAASREIGVPLATLSRRVAELETSLG
FT                   VRLFHRSTRQIVLTESGIGYFAACQHILEYLKDAEETVVGEYRSPKGELSITAPVGFGR
FT                   QHLQPVATEFLRAYPDIDLRLLLVDRMVDLVGEHLDLAVRISTLSDSGQVARSVGEIKM
FT                   IVFGAPGYLKARGMPKHPSELVRHSCISWTSLGPYKAWLFREGGLEAMFPIRARLTTTT
FT                   PESAITAAVAELGLVQATSYQAEDAVRSGLLIPVLRDFEALPTPVSLVYPSSRLVPLKL
FT                   RVFLDFAAPRLAARLESVAKTL"
FT   gene            524986..525540
FT                   /locus_tag="Bpro_0520"
FT   CDS_pept        524986..525540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0520"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42483"
FT                   /db_xref="GOA:Q12G59"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G59"
FT                   /protein_id="ABE42483.1"
FT                   /translation="MSRLHTPASIGASPVAAQAALNAIDKQLGLVPNLFRVVANSPAAL
FT                   QGYVDFNSAASKGKLSAQTRERIALAVAEINGCGYCLAAHTYLAGNVAKLDEAEIVANR
FT                   KGASNDPKADKAVRFAAQVVHNRGHVSDNELATVREAGYDDAEIVEIVLAVALNTFTNY
FT                   LNEVAGTQIDFPATAPLVAAS"
FT   sig_peptide     524986..525045
FT                   /locus_tag="Bpro_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.872 at
FT                   residue 20"
FT   gene            525589..526455
FT                   /locus_tag="Bpro_0521"
FT   CDS_pept        525589..526455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0521"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42484"
FT                   /db_xref="GOA:Q12G58"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G58"
FT                   /protein_id="ABE42484.1"
FT                   /translation="MLNPALLNLPSTSYHFTEVEGLNVFYRSAGDPCAPTIVLLHGFPS
FT                   SSHMFRDLIPLLADRFHVIAPDYIGFGYSDAPSAQEFEYSFRHLTEIVQSLLGKFGIEA
FT                   YYLYMQDYGGPIGLRLATAHPERVLGLVFQNANVYMEGVSQAAADVFMPLWLRGDETGA
FT                   RQMLLAQTTRFQYTQGARNSASLNPDAWTHDQALLDRPGSADRQMALFKDYQTNVALYE
FT                   EWQAYFRQRQPKSLVAWGKGDPFFGVPGAEAFKRDLTNLEVHYFDAGHFALEEDCPAIA
FT                   ALIKRYF"
FT   gene            526482..527024
FT                   /locus_tag="Bpro_0522"
FT   CDS_pept        526482..527024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0522"
FT                   /product="protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42485"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G57"
FT                   /protein_id="ABE42485.1"
FT                   /translation="MNRKLSKLVVATLPIALTVVLGAQGAAQAQVQFSGKVLPLELAQE
FT                   AAQEALRSCEASGYRVSVSVVDVAGVERAFLRGDHSTIHTRETAYKKAYTIASLGPIFA
FT                   SISTGQLTERISKTPTGPALSTVSNIILLAGGVAIRHNDETIAAIGVGGAPGGALDEVC
FT                   AHAGVVRIQERVNALHQ"
FT   sig_peptide     526482..526571
FT                   /locus_tag="Bpro_0522"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.785 at
FT                   residue 30"
FT   gene            complement(527005..527286)
FT                   /locus_tag="Bpro_0523"
FT   CDS_pept        complement(527005..527286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42486"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G56"
FT                   /protein_id="ABE42486.1"
FT                   /translation="MDLLAPHEQRVITLLKNWSESAGCSYKKCHLQVFQHKNHRKYTAC
FT                   ALSSNQARPTLRNHRLECRFRDALFTGRRTRCISSKLEAVFLTIDAMR"
FT   gene            527345..527602
FT                   /locus_tag="Bpro_0524"
FT   CDS_pept        527345..527602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42487"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G55"
FT                   /protein_id="ABE42487.1"
FT                   /translation="MKIRNTISILAASIAMSSAFLAHAQNTQKMDEKTNMEMTKSDQDG
FT                   KHMKAETMKMAEGKSDKMTKDGMGHVNQSADVFKDLYRGR"
FT   sig_peptide     527345..527419
FT                   /locus_tag="Bpro_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(527761..528036)
FT                   /locus_tag="Bpro_0525"
FT   CDS_pept        complement(527761..528036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42488"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G54"
FT                   /protein_id="ABE42488.1"
FT                   /translation="MQPHNRQLGAGDSPDGRHAVAKPLGPVHHNMGNPYQRQTAVAAHQ
FT                   PVRLALQFQLSAFRWTATRFNFQRPESADVNRFCMCVYALNRTLAP"
FT   gene            528131..528271
FT                   /locus_tag="Bpro_0526"
FT   CDS_pept        528131..528271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42489"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G53"
FT                   /protein_id="ABE42489.1"
FT                   /translation="MPSILDLERRAELVQVQVQVQVQVIFNNNYEDQGQRNATTLMNML
FT                   H"
FT   gene            528351..528602
FT                   /locus_tag="Bpro_0527"
FT   CDS_pept        528351..528602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42490"
FT                   /db_xref="GOA:Q12G52"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G52"
FT                   /protein_id="ABE42490.1"
FT                   /translation="MARNRPASSWGHPLFRWALALVGVAAAVATLAVVVATAMQRSLVW
FT                   WEMTAIALAALIVAAVIKRSNVQKARRRAIDMRDSALW"
FT   sig_peptide     528351..528467
FT                   /locus_tag="Bpro_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.326 at
FT                   residue 39"
FT   gene            528659..528841
FT                   /pseudo
FT                   /locus_tag="Bpro_0528"
FT   gene            complement(529034..529264)
FT                   /locus_tag="Bpro_0529"
FT   CDS_pept        complement(529034..529264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42491"
FT                   /db_xref="GOA:Q12G51"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G51"
FT                   /protein_id="ABE42491.1"
FT                   /translation="MIKIPKNFAHLVYGVLQSGLTCAVATGISSVGSTSLEAYMLHWLK
FT                   SWVLSWLFMLPVVVLASPLIRRLADKLIHGA"
FT   gene            complement(529417..530106)
FT                   /locus_tag="Bpro_0530"
FT   CDS_pept        complement(529417..530106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0530"
FT                   /product="haloacid dehalogenase, type II"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42492"
FT                   /db_xref="GOA:Q12G50"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PDB:3UM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G50"
FT                   /protein_id="ABE42492.1"
FT                   /translation="MHAIKAVVFDLYGTLYDVYSVRTSCERIFPGQGEMVSKMWRQKQL
FT                   EYTWMRTLMGQYQDFESATLDALRYTCGSLGLALDADGEAHLCSEYLSLTPFADVPQAL
FT                   QQLRAAGLKTAILSNGSRHSIRQVVGNSGLTNSFDHLISVDEVRLFKPHQKVYELAMDT
FT                   LHLGESEILFVSCNSWDATGAKYFGYPVCWINRSNGVFDQLGVVPDIVVSDVGVLASRF
FT                   SPVDEAA"
FT   gene            complement(530131..531657)
FT                   /locus_tag="Bpro_0531"
FT   CDS_pept        complement(530131..531657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0531"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42493"
FT                   /db_xref="GOA:Q12G49"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G49"
FT                   /protein_id="ABE42493.1"
FT                   /translation="MKFITLGIFLFILGITLAVTYWAAKRTKTTSEFYAAGGNLGAVEN
FT                   GFALAGDWMSAAAFLGFVGLSALFGWDGALYALGALVAFMTILLLVAEPLRNTGRYTLG
FT                   DVIAYRMQRPQARVAAVVGTIVVNLAYLIPQMAGGGVLIKLLLDIPYSASVVFVGIGMI
FT                   VYVAFGGMLATTWVQIIKAVLLISTAVVLVVWILALFGFNPVALFDGMEAKYGSKILSP
FT                   GNFFKHPLDAFSLGISFVLGTAGLPHIMTRFYTVPDAKTARKSVIWLMFLAGGFFLVTT
FT                   LIGFASALLVGQDAIRAADKGGNLALPLLAQYLGGGVGTLGGQIFLAFVAAVAFATILA
FT                   VVAGLTLATSGAIAHDLYVNVIKQGVLSEKEQVRVARVSVIGIGIVATVLGLLAQGQNV
FT                   AVLVILAISIAASANFPIVVLSLFWRRFNTGGVIGGVGVGLISAIGLALIGPAFMGKEA
FT                   MFPIVNPAIASMPLGFLGAYLGTLLGGRNAKLEAHFDQVLFKAQTAIAID"
FT   sig_peptide     complement(531586..531657)
FT                   /locus_tag="Bpro_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.753 at
FT                   residue 24"
FT   gene            complement(531654..531920)
FT                   /locus_tag="Bpro_0532"
FT   CDS_pept        complement(531654..531920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42494"
FT                   /db_xref="GOA:Q12G48"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G48"
FT                   /protein_id="ABE42494.1"
FT                   /translation="MAAKKKLLVPMVLMYFGLFMGMTLLAGYAKGFMTQKISGAFNMAY
FT                   LLVLCCYFMCWIMGVIYVRIANRDFDVMASRAVHELAHGRGQA"
FT   sig_peptide     complement(531831..531920)
FT                   /locus_tag="Bpro_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.323 at
FT                   residue 30"
FT   gene            532375..533799
FT                   /locus_tag="Bpro_0533"
FT   CDS_pept        532375..533799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0533"
FT                   /product="sigma54 specific transcriptional regulator with
FT                   PAS sensor, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42495"
FT                   /db_xref="GOA:Q12G47"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G47"
FT                   /protein_id="ABE42495.1"
FT                   /translation="MQTHENISTSDSLSSKTEISELLHLRQLCKDFEEIYRNSFDGIFV
FT                   ADGKGITLMVNEGCERNYDLKAEELVGHHVSEFEKKGWIRPVIATRVAAERKRISAMQH
FT                   THTGKTIMVTGIPLFDDQGAVRKVIINSRDTTELVQLQEALLRTREDLQRVENEMKELR
FT                   LQNLKPDGVALKSQSMQRLSSLALRVAKVDTAVLISGESGVGKEVLARQIHKESQRSQG
FT                   PLIKINCGAIPRELLESELFGYEGGAFTGALKQGKVGLIETAHHGTLFLDEIGELPMNL
FT                   QVKLLQTLQDHTVVRVGGTRVVHVDLRVIAATNRDLQVMVDNNQFRSDLYYRLNVVPLS
FT                   VPPLRLRKEDIFPLTEHALDELNASYSFNKRFSERALKSLLTYEWPGNVRELRNIVERL
FT                   VVTTPTDLIDVIDLPEYLIAPVDQAFADPLEYRAKVAQFEKQLVAEALKKYGNTRAVAK
FT                   QLNLSQSTVVRKLNAA"
FT   gene            complement(533902..534492)
FT                   /locus_tag="Bpro_0534"
FT   CDS_pept        complement(533902..534492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0534"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42496"
FT                   /db_xref="GOA:Q120J5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q120J5"
FT                   /protein_id="ABE42496.1"
FT                   /translation="MGRTREFDTDTALDAATDTFWHQGFEATPMQDLCRSMNLGPGSIY
FT                   AAFGDKRNLFRQALHRYMDTVSMQALERINSAPSGLQGIRGYFEHLVDAMIDGKRRWGC
FT                   LMTNSLVEFASRDPELAVLFQLHLARLETTFAAALTRARAAGELRPDVGPEAAGYLVAV
FT                   VQGMNVLAKTKPGRRTLERIVEVAVAGLALPSS"
FT   gene            534631..535554
FT                   /locus_tag="Bpro_0535"
FT   CDS_pept        534631..535554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0535"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42497"
FT                   /db_xref="GOA:Q12G45"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G45"
FT                   /protein_id="ABE42497.1"
FT                   /translation="MRIAVMGTGGVGGYFGARLAKAGHDVSFVARGRQLAAIRDTGLRV
FT                   ESPLGNLHLKKVSVTDTPADIGPADIVLFGVKLWDTAEAAEAIKPLIGEHTAVVSFQNG
FT                   VVKDDILRQTLGEAHVIGGVCYIAATIAEPGLIRHSGAMQKLVFGEYDGTSTARVARFR
FT                   DACVEAGIDVEISDRIGQTIWEKFVFLVGLSGTTTVTRTPIGTVRANERARAFLRDVMD
FT                   EVVRVARADGVQVAEDYANNRLAFCDQLPATMTSSMHGDIERGSRLEVQWLSGDVVHRG
FT                   ARLGVATPCNRAILDILSVHSEGRTA"
FT   gene            535551..536645
FT                   /locus_tag="Bpro_0536"
FT   CDS_pept        535551..536645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0536"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42498"
FT                   /db_xref="GOA:Q12G44"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G44"
FT                   /protein_id="ABE42498.1"
FT                   /translation="MSPQHLTVRAIEATLVVVPMRRALGTSAMRVTQAPLLLLDLQTEE
FT                   GITGRAYLFCYLEAAGAAALALVRDINAELVGKTAAPAAVRRALEARFRLLGARGIVSM
FT                   LMAGIDIACWDALAICAGLPLATLLGAQPRPIPAYNSNGLGLLDARAAADEALELVSEG
FT                   FHAIKMRLGRPLAKDDLAAVRAVKQALPAGIALMADFNQALSRNAAVERCQQLDDEGLY
FT                   WIEEPVRHDDYATSAELTALLRTPVQIGENFAGPRAMAQALAQRACDFVMPDLERIGGV
FT                   SGWIDASALANVAGIEFSSHLFPEVSAHLLAGTPTAHWIEYVDWADAILQEPLKVVDGC
FT                   LSAPDRPGNGLSWDLGAVKHYQKV"
FT   gene            537001..537583
FT                   /pseudo
FT                   /locus_tag="Bpro_0537"
FT   gene            537649..537846
FT                   /pseudo
FT                   /locus_tag="Bpro_0538"
FT   gene            complement(537970..539277)
FT                   /locus_tag="Bpro_0539"
FT   CDS_pept        complement(537970..539277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0539"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42499"
FT                   /db_xref="GOA:Q12G43"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G43"
FT                   /protein_id="ABE42499.1"
FT                   /translation="MILFILSYLGGALTILAPCILPVLPFVFARIDQPFVKSGLPLLAG
FT                   MALTFAGVGTLGAVAGDWAVQANEYGRIVAIVLLATMGLALVAPRIAERVTRPLVTMGS
FT                   RLSNAAMQRTDKGANPTGPSFLLGIATGLLWAPCAGPVLGLVLTGAAIEGPSVRTSLLL
FT                   LAYAAGAVTSLALVLLAGGRVFAAMKRSLGIGEWFRKGLGFAVLAGVTAIALGLDTGVL
FT                   AQLSLGGGSTTMEKNLIERLRPQRAAQAPAAVLQAATLDRRGFMTVRSDSVTVAKLPPL
FT                   PVQGSMPPLSGAVEWLNSTPLTAEALRGKVVLVDFWTFGCVNCLNALPHVREWHRKYKD
FT                   QGLVVVGVHSPEFAFEKNINNVKNAVNRLDISFPVAIDNNFAIWRAFSNNYWPAHYFVD
FT                   AKGRIRFHHFGEGEYEKSEQVIQQLLEEARKEAKPV"
FT   gene            complement(539311..539592)
FT                   /locus_tag="Bpro_0540"
FT   CDS_pept        complement(539311..539592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42500"
FT                   /db_xref="InterPro:IPR014299"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G42"
FT                   /protein_id="ABE42500.1"
FT                   /translation="MNKLTATLLATCMAIGSVSAFAADEMKKDAMGKDAMAMDGMKKDA
FT                   MSHDAMAKDGMKKDAMGKDAMAKDGMKKDAMSHDAMAKDGMKKDEMKK"
FT   sig_peptide     complement(539524..539592)
FT                   /locus_tag="Bpro_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(539669..540460)
FT                   /locus_tag="Bpro_0541"
FT   CDS_pept        complement(539669..540460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0541"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42501"
FT                   /db_xref="GOA:Q12G41"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G41"
FT                   /protein_id="ABE42501.1"
FT                   /translation="MIKTPPRLAIDGDAVLKEAVSRISHASRIKEPARRDFLRRSLTLG
FT                   GLSMLTGCTLVDEASIDTALMRISRMNDKVQGWLFDPNRLAPTYPDSMITRPFPFNAYY
FT                   SESEVRQIEESSYRLEVTGLVADKRKWALAELRAMPQVDQVTRHICVEGWSAIGKWGGV
FT                   PFASFLRRVGADLTAKYVGFKCADDYFTSIDMPTALHPQTVLALTYDGQPLPPKYGFPM
FT                   KLRMPTKLGYKNPKHIQAIFVTNTYPGGYWEDQGYNWFGGS"
FT   gene            complement(540474..541106)
FT                   /locus_tag="Bpro_0542"
FT   CDS_pept        complement(540474..541106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0542"
FT                   /product="putative transmembrane hydrogenase cytochrome
FT                   b-type subunit oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42502"
FT                   /db_xref="GOA:Q12G40"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G40"
FT                   /protein_id="ABE42502.1"
FT                   /translation="MLSIIRSMNRGPEHQDKAPIHPVWMRITHWLNALAVLVLGASGWR
FT                   LYNAAPFFPFNIPRQLTLGGWLGGALQWHFAAMWVLGVNGLLYLAFNLATGRLLRKFFP
FT                   LSPRALLADLQAALKGRLAHADPRHYNMVQRLAYLFVMVDSVLLVISGLVLWKSVQFPL
FT                   LRELMGGYEGARLVHFFAMAALAAFVAVHLVMVALVPRTLLYMVRGR"
FT   gene            541183..541908
FT                   /locus_tag="Bpro_0543"
FT   CDS_pept        541183..541908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0543"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42503"
FT                   /db_xref="GOA:Q12G39"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G39"
FT                   /protein_id="ABE42503.1"
FT                   /translation="MESAKRVLIVEDDTHIAELLRMHLQDEGYAVQHAADGNAGLRELE
FT                   RGSWDALVLDLMLPGVDGLEICRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLA
FT                   KPFSVLELVARVRALLRRTDALARNARMESGLLELGNLRVDPVAREVQVEGKSVELTPR
FT                   EFDLLYFFARHPGKVFSRLNLLNQVWGYQHDGYEHTVNTHINRLRMKVEADPTEPRRIL
FT                   TVWGRGYKLAISAMEESGE"
FT   gene            541905..543368
FT                   /locus_tag="Bpro_0544"
FT   CDS_pept        541905..543368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0544"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42504"
FT                   /db_xref="GOA:Q12G38"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G38"
FT                   /protein_id="ABE42504.1"
FT                   /translation="MSFRGTLSQRLSVVFSVLLLACCSASAWLQIKANGRHDQEVTQRL
FT                   SNGLAAHIADNAALVERDGLNPEAVHDLFDKLMAVNPSVEVYLLDLDGRIQAQAAPPGH
FT                   LKRDRVDVAPIRRLLEGTPLPIVGDDPRGDGVQKVFSAAPLRVDDRDVGYVYVVLFGED
FT                   RDAVAANVAANSVLRTTLWSMALVALLGLLAGLAAFHLITRPLRDLTGAVRKFEKDGVV
FT                   SLHEAGPALERAGRGSDEIATLGQAFAQMTQRIAAQWRELTAQDQQRRELFANISHDLR
FT                   TPLTSLHGYLETLLIKADALDPGERRRYLEIALAQSRKVARLAQELFELARLEYGVVKP
FT                   DKETFALADLVQDVFQKFELAAEARHQRLVPDIAPGLPVVTADLGMIERVLTNLLDNAI
FT                   RHTPEGGEIVVQLRQDRESVCVEVSDTGPGIPGELQKSLFTRPAFSSAGGRSGGLGLVI
FT                   VQRILQLHGSDIRLLQRAEKGAVFFFQLT"
FT   sig_peptide     541905..541988
FT                   /locus_tag="Bpro_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            complement(543515..544054)
FT                   /locus_tag="Bpro_0545"
FT   CDS_pept        complement(543515..544054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0545"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42505"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G37"
FT                   /protein_id="ABE42505.1"
FT                   /translation="MWRGLLRAECQHLSYGASARKLCLSQKSYMVKRTSLEGADCPVAR
FT                   SLDVIGDWWSLLIVRDALDGLRRFGEFQKSLGLAKNILATRLKALVANGILELAPASDG
FT                   SAFQEYVLTVKGRDLFYVVASLRQWGDDYFFESGQARTKLVDRADGKPIRKLEVRAKDG
FT                   RVLSPEDTVVRKASAH"
FT   gene            544188..545447
FT                   /locus_tag="Bpro_0546"
FT   CDS_pept        544188..545447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0546"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42506"
FT                   /db_xref="GOA:Q12G36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G36"
FT                   /protein_id="ABE42506.1"
FT                   /translation="MQPHCRIPPMTIQQSVALNDMAVMPALPRRTLLLFALTSGLSVAN
FT                   IYYSQPLIENIARDLGMSPVFAGVVVTVTQFGYAIGLLFLVPLAELINHRRLIVGQLLL
FT                   SALALVAVGIASSVTVLLLGFAMIGLLAVVIQILVALAAAVSSPSEQGRAVGAVTSGVA
FT                   LGVIAARSIAGPLAALTSWRTVFVVSAALTSLAAYAMANSLPRRSTLGKTRSYWTLLRS
FT                   VVTLLLEERLLHVRAGLALLVFAAFGVLWSSLALELSAAPLSLSQAAIGLFGFAGVAGV
FT                   AGAASAGLLADRGWGQWTTGIALTLMFLAWWPLSRNQLPLWTLIVGVGALDMGGQAVHV
FT                   ASQSLLFRALPQARNRILAAYMLFYSVGTGVGALASTAAFAWSGWRGVCQLGAAISATA
FT                   LLFWAATLRESRRNRVVSPG"
FT   gene            545640..546710
FT                   /locus_tag="Bpro_0547"
FT   CDS_pept        545640..546710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0547"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42507"
FT                   /db_xref="GOA:Q12G35"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G35"
FT                   /protein_id="ABE42507.1"
FT                   /translation="MSSPTSSQQTNSTDQGANSHRRQFLNLTAIGLTGAAALAAYPLVS
FT                   AASSTTSAINSKGTPMSTSNLQNASANAPRASFHSVEADGVKVFYRESGPAQAPVILLL
FT                   HGFPASSHMFRELIPRLASKYRVIAPDLPGFGFTSVPDTRHYAYSFDSLARTTEAFVEA
FT                   LGLKRYALYVFDYGAPVGFRLALAHPDRVTAIVSQNGNAYEEGLGEAWAPFQQYWAAPN
FT                   SENRKALLSALTLETTHWAYTHGLPNPQAVAPESYQLDAALMARPGNSEVQLDLFLDYA
FT                   SNLKRYPAFQAYFREVKPRLLAIWGKYDQLFIPAGAHAFKRDNPNAVVKLLDASHFALE
FT                   THVEEIAAEMHVFLRS"
FT   sig_peptide     545640..545783
FT                   /locus_tag="Bpro_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.471 at
FT                   residue 48"
FT   gene            complement(546707..547918)
FT                   /locus_tag="Bpro_0548"
FT   CDS_pept        complement(546707..547918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0548"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42508"
FT                   /db_xref="GOA:Q12G34"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G34"
FT                   /protein_id="ABE42508.1"
FT                   /translation="MNLNFHPAGRHFLQIPGPSPVPDRLLRAMSYPTIDHRGPEFGALG
FT                   RKVLSGIKDIFKTRHPVVIYPASGTGAWEAALVNTLSPGDAVLMFETGHFASLWNKMAL
FT                   RLGLKPEFIGLPGTEGWRNGVQADMIEQRLRNDAQHQIKAVCVVHNETSTGVTSNIAAV
FT                   RRAIDAAKHPALLLVDTISGLASADYRHDEWGVDVTISGSQKGLMLPPGISFNALSPKA
FT                   VAASRDALLPKSFWAWDEIVEMNQTGYWPYTPNTNLLYALSEALDMISAEGLPQVFARH
FT                   ERLGKACRNAVEAWGLEIQCADPAVYSPVLTGVMMPEGVDADRVRQIVYQHFNMSLGAG
FT                   LGKVKGRMFRIGHLGECNDLTLLAALAGCEMGLKLAGVRLRESGTSAAMEFLAASAQPT
FT                   ATLG"
FT   gene            complement(548183..548950)
FT                   /locus_tag="Bpro_0549"
FT   CDS_pept        complement(548183..548950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0549"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42509"
FT                   /db_xref="GOA:Q12G33"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G33"
FT                   /protein_id="ABE42509.1"
FT                   /translation="MTPSGEDALDRMQSPSSTNQTDMTSTRQSTSRLDRENTIDAIYER
FT                   IYVAILEHRLHPGTKLGEERLADIFGTSRARIREVLARLAHEQIVELYPQRGAYLAKPS
FT                   IEQARDVFEARRLIEPAVLKRLIDTLTPEKIARLRQHQELELDARRREDKRTVIRLSGE
FT                   FHTLTAELAGNSALARSMRELCMLTCLIIFLYDAPTASSCRADEHTVIVDAIAKRDRVR
FT                   AEKLMLDHLHHIEHSLKLDSTAGEADLEAIFGS"
FT   gene            complement(548947..549672)
FT                   /locus_tag="Bpro_0550"
FT   CDS_pept        complement(548947..549672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0550"
FT                   /product="Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42510"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G32"
FT                   /protein_id="ABE42510.1"
FT                   /translation="MTQPVRLGVLTPSSNTALEPLTSAIAVEIPGVSAHFSRFRVTEIS
FT                   LDAQALGQFDDSKILAAAELLADAKVDVIGWSGTSSGWLGFDADHRLCERIRERTGIPA
FT                   TTAVLALNELLALQGVRKLALVTPYTADVQQRIMANYRALGIEVVAERHLGIRVNHDFA
FT                   GVEPSRLLALMREVAAEGPQAITTFCTNLRAAPMAQQVEEELGIPLLDTVSTTVWGMLR
FT                   AAGVPSANITGWGRLFQCS"
FT   gene            549982..551418
FT                   /locus_tag="Bpro_0551"
FT   CDS_pept        549982..551418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0551"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42511"
FT                   /db_xref="GOA:Q12G31"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G31"
FT                   /protein_id="ABE42511.1"
FT                   /translation="MSRAPFDLVIRNACVATASDTFKADIGVLDGRISQLGVGLDRGEK
FT                   EIDAAGRIVTPGGVDAHCHLDQPMAPPVRMADNFDTGTRAAACGGTTTVIPFAAQEKGQ
FT                   SLRAAVADYHQRADGRAHVDYAFHLIVSDPTPEVLNVELPALIAEGYTSFKIYMTYDDL
FT                   KLDDGQILDVLDVARQHGAMAMVHAENADCIEWLTKRLEAAGRTAPRFHAHARPMLVER
FT                   EATHRAIALSELVDVPILIVHVSGREAVEQIRWARAQGLKVFAETCPQYLFLTAEDLGM
FT                   DDSYRGARCVCSPPPRDKANQEVIWNGLNDGLFTLFSSDHAPFNYEGTEGRKPGGEEVS
FT                   FRHIPNGLAGIETRMALLYSEGVLGGRITLQKFVELTATNPAKAYGLHPRKGTIAIGAD
FT                   ADLVIWDEREFVLRNTQLHHAVDHTPYEGMTLKAWPGLTLSRGEVVWDGRDFHGRAGRG
FT                   QFLACGAPSLMPSRHVGRPA"
FT   gene            551415..552161
FT                   /locus_tag="Bpro_0552"
FT   CDS_pept        551415..552161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0552"
FT                   /product="Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42512"
FT                   /db_xref="GOA:Q12G30"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G30"
FT                   /protein_id="ABE42512.1"
FT                   /translation="MKLLLINPNISESVSELIRSEAQRSASAGTEIKVLTAPFGVAYIE
FT                   TRFEALIGAYAAAQLAAEHHAHYDAVVVAAFGDPGLTGLREALPVPVTGLTEAALASAC
FT                   LLGNRISIIAISQRIQAWYREVVQSYGLGSRLASIRALDRPLASIGQVQGEHAHALKAL
FT                   AERAVDEDGADVIVLAGAPLAGLARALKGQLPVPVVDGVSSAVRHAETLAALQPGTAQR
FT                   GSFAPPPVKPNRGLPPAIARLLDRAS"
FT   gene            552207..553217
FT                   /locus_tag="Bpro_0553"
FT   CDS_pept        552207..553217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0553"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42513"
FT                   /db_xref="GOA:Q12G29"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G29"
FT                   /protein_id="ABE42513.1"
FT                   /translation="MNQPSRLPLITRLAAAAALTLASAMLPVAAQQKLQIAGNFASEHP
FT                   SSVAVEQVFKKEVARLTNNQLQVDVFPAMQLGGAKENVDAVRSGTLALTWVGAAFLSRI
FT                   APELEAVSLPFVFANRQSAFRVIDGPVGDAIDRKLGDKGFISLGWMELGMRNVTNSRGP
FT                   IKSMADLKGLKIRLQPNETHLATFRALGANPVAMDVKELYSALEQRVVDAQENPYTVIS
FT                   AARYSEVQKQLSNSGHFFDLIAVVASKKAFEQLKPEYQKAIREAMTATIAFQRKLAAED
FT                   EAKRLAELKGKMTYTEITPAALEEMRRATAPVIEDVKKRAGADLVNQVLAEAARR"
FT   sig_peptide     552207..552299
FT                   /locus_tag="Bpro_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.947 at
FT                   residue 31"
FT   gene            553244..553774
FT                   /locus_tag="Bpro_0554"
FT   CDS_pept        553244..553774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0554"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42514"
FT                   /db_xref="GOA:Q12G28"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G28"
FT                   /protein_id="ABE42514.1"
FT                   /translation="MTTETIALEPVVPAGWAGRALDGLNRLITGVLLATVAVMVSVVSA
FT                   QVALRYGLNRSIDWADEIGRLAFVWSIFLAIPLGVRQGAHIGIDIMVDKLPARWRGALK
FT                   RAGAALCAAMMFAIAWAAFRVAREQWDELMATVDWSVGWFIVPVGLGALLSALHLVRIV
FT                   IAGAPVQALGSAE"
FT   gene            553771..555051
FT                   /locus_tag="Bpro_0555"
FT   CDS_pept        553771..555051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0555"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42515"
FT                   /db_xref="GOA:Q12G27"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G27"
FT                   /protein_id="ABE42515.1"
FT                   /translation="MSLAVVIAFMLLALLGLPIAFAMGVAALGALWYSGVDFSMVPQRM
FT                   MHAVNSFPLMSIPFFMLAGELMIKAGIVERLIALANTMVGRVRGGMAHVTMLSGAGLAT
FT                   VSGAAVSDASALSSMLVPSLTKIYDKGFATAIVAAAANLGPIIPPSGAMIVYAFMAGSS
FT                   VSVGGMFMAGVVPGLLITFGFIALCSWIATRRGWAATGEPFRLATVLAELRRSLIVLAM
FT                   PVLVIGGIVGGAFTATEGSAIAVVYSTALGFFVTRTLKLADLPGIVVRAAITSAMVGAL
FT                   IAFASIITYLMTVDLLPQQLSELLRSLTTSPLVFLVLVSVLLFVVGMFLESNAAYIMLV
FT                   PLLHPIALQYGIDPLHFGFLFVLNLVIGMLTPPVGVVLFAVCGITGVRMRELVSNLWPF
FT                   IVLMYGVLVLCMLVPSFVTALPHALGY"
FT   sig_peptide     553771..553839
FT                   /locus_tag="Bpro_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.573 at
FT                   residue 23"
FT   gene            555110..556165
FT                   /locus_tag="Bpro_0556"
FT   CDS_pept        555110..556165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0556"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42516"
FT                   /db_xref="GOA:Q12G26"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G26"
FT                   /protein_id="ABE42516.1"
FT                   /translation="MSYRSRFKILAAVAALAATLVLPAHAQEKIKFKAIGQPLATGLIQ
FT                   KNKEQPFFENFAAKTGLPIEVDYKPIDTLGIKDTEQLRVMKAGLFDIVSLRVSQNSRDE
FT                   PTILGLDLVGASPDYATGRKVAKAYFDTVDARLQQQFNVKLLGVWPFGPQILFCKKPIA
FT                   KLADIKGMKVRVYDQNLAKFIELVGGTPVPVSFADTHQSLSLGVVDCAITGPSSANSAG
FT                   WPEVTTHQLPLGFQMALNGYAISLKAWNQLKPDQQVKLKAAFDKLTDEIWTYSEELFQD
FT                   ALNCNAGKDPCTTGKKFKLVNVAVTPADGELVRSAVTKVSLPTWAEVCDKSNPGCSQKW
FT                   HAQVAPVLGLK"
FT   sig_peptide     555110..555190
FT                   /locus_tag="Bpro_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            556162..556812
FT                   /locus_tag="Bpro_0557"
FT   CDS_pept        556162..556812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0557"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42517"
FT                   /db_xref="GOA:Q12G25"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G25"
FT                   /protein_id="ABE42517.1"
FT                   /translation="MSGSTILNRGRPAPAPQIKAVDMKDHIERVLAAVFGGIFLLLACV
FT                   VAVETISRKVFNVSLQGADELGGYALAVGSTIAFSLALMGRNHIRVDVFHERFPRAMQA
FT                   FLNWFSIVTLASFGTFVAWIATKVITDTLQYGSTAQTPWATPLIWPQAVWYAGLVIFAM
FT                   VSIGYALRASWLLLTKRVDTLNHDFHPKSAKEELKEELDDLAQRQSTEQGAQP"
FT   gene            556809..558101
FT                   /locus_tag="Bpro_0558"
FT   CDS_pept        556809..558101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0558"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42518"
FT                   /db_xref="GOA:Q12G24"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G24"
FT                   /protein_id="ABE42518.1"
FT                   /translation="MSIGLFGIAFVVMLGMMLVGIPIAVSMAAVGIVGGIAAYGIPFMD
FT                   SIAPVVWGVHNENLLTSIPLFILLGELLLRSGIADRMYIALSAWLGRLPGGLLHTNIGS
FT                   CALFAATSGSSVATAATVGTVALPSLQKRGYPMRASLGTLAAGGTLGILIPPSVNMIVY
FT                   GSLTNNSIGKLFIAGIIPGLMLTGCFMLYIAVSSLMSGNAMREPKVPMADKLRSLVHLV
FT                   PPMVVFGIVMGSLYFGIATTTESAALGVIAALGFVVHSGKMSRELLRTCFISTARVSGM
FT                   ILLIITAAFILNLTISLTGVAEAMTKWVAGLGLSATGLILALIVFYLILGMFMDVLSMQ
FT                   VATIPITYPIATALGVDPIWFGIFIVLMCELGLITPPVGMNLFVVHGIRPDKGGIEDAI
FT                   WGALPYALIMILFTLLIMVWPQIVTWLPAHM"
FT   sig_peptide     556809..556895
FT                   /locus_tag="Bpro_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.970 at
FT                   residue 29"
FT   gene            558115..559521
FT                   /locus_tag="Bpro_0559"
FT   CDS_pept        558115..559521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0559"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42519"
FT                   /db_xref="GOA:Q12G23"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G23"
FT                   /protein_id="ABE42519.1"
FT                   /translation="MIDKDLWRLGAVELGQRFRERSLTPLAVAQACLARLEAVNPRLNA
FT                   VIARRDEQFLAEAKAATERHARGQPLSALDGIPLTVKDSLYLADLPTTCGTAALREHRP
FT                   GHDELAAARARAGGALIIGKTNVPEFANDGYTANPLFGVTGNPWAPELTPGGSSGGAVA
FT                   AVAAGIAPLAIAQDGGGSIRRPASHTGLVGLKPSLSAWPREHALPGLLLDFDCIGPVAR
FT                   TVADARLLFEALRGPSPADRSSMAAAWAAAQPRPAGSLRVLYVERLNANPLDPQIAASC
FT                   LHAVQRLAALGHRVEPGELPLDVRFMTEAWPQIGQVGLAAMFDQHPDWEAQASPKYREA
FT                   AEAGRRVSGSRVWQIMEGVRRLRRESAALFERIDVVVMPAAAALPWPAHEPYPSVIDGQ
FT                   PVGPRGHAAYTGWVNAAGLPGLAVPCEPSREGLPIGMQMIGAYGADDQLLDLGASYEAA
FT                   HPWSGRWPAL"
FT   gene            559565..560542
FT                   /locus_tag="Bpro_0560"
FT   CDS_pept        559565..560542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0560"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42520"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G22"
FT                   /protein_id="ABE42520.1"
FT                   /translation="MQRRHFIQATGAGAAVLALPALRAQSWPSGPIRIVVGFPPGGGAD
FT                   ALARVVGLKLSALWNQPVVIENKAGASGTLAAEYVAQQASDGTTLLLTTINSHALAPAV
FT                   LPKLRYHPERDFVPVALLGLTPNLLIAGAVQPARTVKDLVALCKAKPGVVTFGSAGPGT
FT                   AQHFALELFKLRARVDALHVPYKGSGPLLTDLVGGQIQYSFETMTAATPHVKSGRAIAV
FT                   AQTRSKRVKAYPDVPTMQEQGFAGFETFNWYGISGSGKLPAPIASRMNKDINTVLAMAD
FT                   VREKFDAFGVEDGGGSPEKFAELVRSEIAKWAKVAQEANVRVDG"
FT   sig_peptide     559565..559645
FT                   /locus_tag="Bpro_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.548 at
FT                   residue 27"
FT   gene            complement(560609..561379)
FT                   /locus_tag="Bpro_0561"
FT   CDS_pept        complement(560609..561379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0561"
FT                   /product="2-keto-4-pentenoate hydratase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42521"
FT                   /db_xref="GOA:Q12G21"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G21"
FT                   /protein_id="ABE42521.1"
FT                   /translation="MSKPNQAAVAEAILQARRSHQPVDAQALADHLTTADDAYAVQALV
FT                   ARAMQGPAAPFPRYWKSGGPSRDATLTHAPLPPEGVWPSPAQAGAWHFNICLIEVEIAL
FT                   RIGRDVTATEAAGLTHAQAAALVDAMAVSIELVDSRWRQALDAPALLKLADLQSHSALV
FT                   LGEWVPFAPRDWDAQSCTIRIGARPVVERRGTHSMQDPAWVLPAWLRHATRDGQTVPAG
FT                   TVVTTGTWCGILPAAPGELVQASFDGVGEASVQL"
FT   gene            complement(561807..562700)
FT                   /locus_tag="Bpro_0562"
FT   CDS_pept        complement(561807..562700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0562"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42522"
FT                   /db_xref="GOA:Q12G20"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G20"
FT                   /protein_id="ABE42522.1"
FT                   /translation="MPANPDPQRPVVLVVDDAPSSLGMLCDSLEGEGYTVLVARDGDAA
FT                   LQRLELVAPDAILLDAVMPGLSGFDTCRRIKANPALAHIPVIFMTGLSETPHVLEGFAC
FT                   GGVDYVVKPLRAQEVVARLHTHTRNARMTRLAREAVDVAGFGVVLVDAKGRVAWRSPQA
FT                   ALWLQTPEGLAAAGELPDPVHAALGGKTDQVLMTLAGRQLSVRNMGRVGIGETMLLLEQ
FT                   RGANGMAPSRLANAALTPRETEVLSWLAKGKTNKDIGDILGMSHRTVNKHLEHIFEKLG
FT                   VETRAAAAALATAHVA"
FT   gene            complement(562684..566067)
FT                   /locus_tag="Bpro_0563"
FT   CDS_pept        complement(562684..566067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0563"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42523"
FT                   /db_xref="GOA:Q12G19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G19"
FT                   /protein_id="ABE42523.1"
FT                   /translation="MTLATQKIFRIRREYNAWVADESIEDYALRYTPRGFRKWSEWRVG
FT                   NTAFGAVSFLALEAIGGAIALNYGFTNALWAIVLVGLITFLTGLPISYYAARYGVDMDL
FT                   LTRGAGFGYLGSTITSLIYASFTFIFFALEAAIMALALQMYLEIPIVWCYVISALLIVP
FT                   LVVRGITLISRLQMWTQPLWGVLLLLPYLAVFWKNPQAFSDFTGLAGRTSGSSEFDPLM
FT                   FGAAATVAFSLVVQIGEQVDFLRFLPEKTHLNRKRWWTAVLVAGPGWIVPGMLKMLGGA
FT                   FLAFLVLQHELPASSAVEPTQMYLAGFAYVFTDPTWVLAATVVFVVVSQLKINLTNAYA
FT                   GSLAWSNFFARLTNSHPGRVVWLVFNVAIALLLMTLGVFSALEKVLGLYSNVAIAWVGA
FT                   LVADLVINKPLGLSPRGIEFKRAHLYDINPVGLGSMLLAAVVAVVAYTGAMGRQAEAFS
FT                   PFIALGTALVLSPLLAWLTNGRYYIARQPQASGISGQMVNCHVCENSFEAEDMATCPAY
FT                   GAPICSLCCTLESRCHDRCKTRSRAAEQAEQFLGSLLPKSLSSRVNFRVGHFTVVTLSL
FT                   CALIATVMGMVYLQETALSASTDAFDMLRSAFVKVFAVLLLIAAVCSWWVVLGSESRRM
FT                   AQDESNRQNQLLSREIEAHQRTDAALQTAKELAEAANQAKTRYVAGMTHELRTPLNSIL
FT                   GYSQILLKSEALANTPREAVQTIQRSGEHLLALVDGLLDLARIEAGRLRLEPTPLPLPD
FT                   FLDGLVNMVRPQAEAKDVDFIYTHSGRMPAWVQADAKRLRQIIINLLSNAVHFTDTGSV
FT                   TLHVDCRREVIRFDVVDTGIGIAPQDQQRIFLPFERGAAGRRRGEPGTGLGLTITGLLT
FT                   ALMGGDLSLQSEQGKGSTFSVRLYLREIDDPGPLADPPHQIAGFFGKRRTLLVVDDQPV
FT                   QRQMLAGMLTPLGFEVHEAASGMECIDSLKDELPDAILLDISMDDMDGWQTAAQIRDQG
FT                   YDTVPIIVVSANVFENQAALLKAAGCQAFVGKPVLESELMDALQRHLGLEWMTSGVLPV
FT                   LLSSSPAGEVLHLPDDARAELIRLVRLGHVHGLHRLLDRFTAEDPTLAASCARLRGFVS
FT                   RCELEALLDHLTEEEDACEP"
FT   gene            566276..567538
FT                   /locus_tag="Bpro_0564"
FT   CDS_pept        566276..567538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0564"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42524"
FT                   /db_xref="GOA:Q12G18"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G18"
FT                   /protein_id="ABE42524.1"
FT                   /translation="MSKDDRDTPSLINRRRLVQGMAAALPLTGLPLWAQAQQFPTAKVN
FT                   TTKLAITDTEVTVGQLHSSSGTMAISETGSIQAEQLAIDQINAMGGVLGRKIKVIKEDG
FT                   ASDWPTFAEKSKKLLVNDKVAAVFGCWTSASRKAVLPIFEKENGMLYYPTFYEGLEQSK
FT                   NVIYTGQEATQQILYGLDWAAKEKKAKTFFLVGSDYIWPRTSMKIGRKHIEGHLAGSKV
FT                   VGEEYYPLGHTNFNSLINKIKVAKPDCIFIAVVGGSNVAFYKQLKAAGVTADKQFLLTI
FT                   SVTEDEVLGIGGENMNGFYASMKYFQSLDNANNKAFVSAFKAKYGKDAVIGDVTQAGYL
FT                   GPWLWKATVEKAGSFDVDKIAAASTGIELKTAPEGYVKLHDNHHLWSKARIGQAQTDGQ
FT                   FKVVAESSALIEPNPFPKGYQ"
FT   sig_peptide     566276..566380
FT                   /locus_tag="Bpro_0564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.793 at
FT                   residue 35"
FT   gene            567658..568572
FT                   /locus_tag="Bpro_0565"
FT   CDS_pept        567658..568572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0565"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42525"
FT                   /db_xref="GOA:Q12G17"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G17"
FT                   /protein_id="ABE42525.1"
FT                   /translation="MTLSEMLNIGLMQGFAGLSLFSVLLLMGLGLAIIFGQMGVINMAH
FT                   GEFMTIGAYTIYLFSHLAEAYAPRLVQSYFLFAIVAAFLLAFAVGWLAEWAFIRHLYKR
FT                   PLDTLLATWGLSLGMQQIFRSSFGAKEVSPTLPDWLMGSWAPAPGLDIPINGMFVMALT
FT                   LVVTCGVLLALYRSRWGLRVRATVANRVMANATGINTRKTDRLTFAIGCGIAGVAGAAF
FT                   TTIGSTGPTSGSLYIVDAFLVVTFGGAASLLGTVVSAFGIAQTQSIAEFFMTGSMAKVL
FT                   TLMTIVTILMLRPQGLFAAKVRR"
FT   gene            568610..569845
FT                   /locus_tag="Bpro_0566"
FT   CDS_pept        568610..569845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0566"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42526"
FT                   /db_xref="GOA:Q12G16"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G16"
FT                   /protein_id="ABE42526.1"
FT                   /translation="MNSLKQWVERNRMGSVLLLAVVLLVIFPLSLDLFRLNLVGKYLSY
FT                   SFVALGLVMLWGYGGVLSLGQGVFFGLGGYGMAMFLKLEASDPVTTKIQSTPGIPDFMD
FT                   WNQITALPLWWEPFRSFPLTLLLILVVPTFLAFIIGYAMFKRRVGGVYFAIITQAVALI
FT                   LTVLIIGQQGYTGGVNGMTDLKTILGWDTRTDSAKYILYFVTAGLLLGAIVLCTWIQKS
FT                   KLGTLLLAMRDKEDRVRFSGYDVAMFRVFAFCFAAMLSAVGGAMFTLQVGFMSPSLVGI
FT                   VPSIEMVIFAAVGGRMSLVGAVYGALLVNFGKTYFSESFPDLWLFLMAAMFLGVVLAFP
FT                   DGLAGVYNNRIKPWLARRWAARQSIQAPPAGPTESPAMPVTAAGLSQPSPAAVSMAQPL
FT                   PVMPSGLSGQQT"
FT   gene            569862..570605
FT                   /locus_tag="Bpro_0567"
FT   CDS_pept        569862..570605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0567"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42527"
FT                   /db_xref="GOA:Q12G15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G15"
FT                   /protein_id="ABE42527.1"
FT                   /translation="MKNTDFVLSVEDLTVSFDGFKAIDSLNLYVDQNELRVIIGPNGAG
FT                   KTTLLDLICGKTRASAGRIKFKNDEMTRLPEYQIVRSGIGRKFQTPSIYENLSVFQNLE
FT                   VSFPRGRGVFGALFFKCSEEVKSRVQAVAMEIGLAAQLDTEAGLLSHGQKQWLEIGMLL
FT                   MQDPELLMLDEPIAGMSVRERELTAELLKRICKGRAMIVIEHDMEFVKRIADKVTVMHQ
FT                   GKILAEGSMEKVQADPRVIDVYLGH"
FT   gene            570625..571314
FT                   /locus_tag="Bpro_0568"
FT   CDS_pept        570625..571314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0568"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42528"
FT                   /db_xref="GOA:Q12G14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G14"
FT                   /protein_id="ABE42528.1"
FT                   /translation="MLNVNKLHVSYGQSEALHGITFSAKKNETVAIMGRNGMGKTTLFK
FT                   SLIGILPLKSGTIDIDGKDISRDESYQRVAKGVAYVPQGRMIFPTLTVEENIQTGLENA
FT                   RHKQIPEEIYALFPVLFDMRGRKGGNLSGGQQQQLAIARALVTNPKVLLLDEPTEGIQP
FT                   SIIKDIAKALNEIRKMREITIVVSEQVLSFAMDVADRLFVIEGGQLVHESTRAGTDTAR
FT                   IKQFLSV"
FT   gene            571383..572615
FT                   /locus_tag="Bpro_0569"
FT   CDS_pept        571383..572615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0569"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42529"
FT                   /db_xref="GOA:Q12G13"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G13"
FT                   /protein_id="ABE42529.1"
FT                   /translation="MTDTLIKVDLTKSPTENENIHNRWHPDIPMACWVNPGDDFILETF
FT                   DWTGGFIKNNNSADDVRDIDLTTVHYLSGPVGVKGAEPGDLLVVDLLDIGAKQDSLWGF
FT                   NGFFSRNNGGGFLVDHFPQAQKSIWDFKGMFTSSRHVPGVNFAGLIHPGLIGCLPDRPM
FT                   LDMWNKREMDFIATDPDRVPALAVPPSAGTAHMGNMTGAARDKAAAEGARTVPPREHGG
FT                   NCDIKDLSRGSKVFFPVYVDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVSLIKG
FT                   GMARYGIKNPIFKPSPITPHYNDYLIFEGISVDEKGKQHYLDVHVAYRQACLNAIEYLK
FT                   KFGYSGAQAYSILGTAPVQGHISGVVDIPNACATLWLPTQIFDFDINPNASGPVKHIDG
FT                   SIDMPLSPDLV"
FT   gene            572636..572977
FT                   /locus_tag="Bpro_0570"
FT   CDS_pept        572636..572977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0570"
FT                   /product="regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42530"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G12"
FT                   /protein_id="ABE42530.1"
FT                   /translation="MPTYDYACPRCGGFDALRPVAARNQAAACPVCGGVSPRVLASAPG
FT                   LALMEGSTRRALETNERARHEPKNSGDYARLRHPAGCGCCSTGKRGATVTAPNGNKAFP
FT                   SKRPWMISH"
FT   gene            573009..574046
FT                   /locus_tag="Bpro_0571"
FT   CDS_pept        573009..574046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0571"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42531"
FT                   /db_xref="GOA:Q12G11"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G11"
FT                   /protein_id="ABE42531.1"
FT                   /translation="MIHGDISSSKDTVGVAVVNYKMPRLHSQADVMENARNIARMVEGM
FT                   KQGLPGLDLVIFPEYSTHGIMYDSKEMHENAATVPGFETDIFAAACRKAKVWGVFSLTG
FT                   ERHEDHPRKAPYNTLILMNDRGEIVQKYRKIMPWTPVEGWYPGDRTYVSEGPKGLKVSL
FT                   IICDDGNYPEIWRDCAMRGAELIVRCQGYMYPAKEQQILISKAMAFANNTYVAVANAAG
FT                   FDGVYSYFGHSALIGFDGRTLGECGEEEMGIQYAALSKSLIRDFRRNGQSENHLFKLVH
FT                   RGYTGVINSGDGDKGVAACPYDFYANWLRDPEGTRKMVESFTRTTIGTDEAPIDGIPHQ
FT                   GTEVA"
FT   gene            complement(574131..575225)
FT                   /locus_tag="Bpro_0572"
FT   CDS_pept        complement(574131..575225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0572"
FT                   /product="protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42532"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G10"
FT                   /protein_id="ABE42532.1"
FT                   /translation="MENLDVMVLRTLRDWRTAGKRALLATVVRTWGSSPRPVGSIMALC
FT                   EDGAVVGSVSGGCIEDDLIYQYTRAYASAAAQPGGAGAGSQQIPSGPPAFIKYGITADE
FT                   AHRFGLPCGGTLELVLEYDPDVGHLAQLVEALEAGQLMQRSVHLADGSVTLAQATAPAA
FT                   LSVSATELVNTFGPEYRMLLIGAGQLTEYLATMALFSGFAVTVCDPREEYRSAWQVAGA
FT                   KVLSDMPDDVVVAFKPDRRSCVIALTHDPKLDDLALLEALGTDAFYVGAIGSRRNNEAR
FT                   HQRMIEHFGQTEATLSRLRGPIGIYIGSKTPPEIAVSVMAEVLAVKNGVTLPRDMEVAR
FT                   AKNERAVAANPEGDLVCGVDGSHS"
FT   gene            complement(575256..575849)
FT                   /locus_tag="Bpro_0573"
FT   CDS_pept        complement(575256..575849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0573"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42533"
FT                   /db_xref="GOA:Q12G09"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G09"
FT                   /protein_id="ABE42533.1"
FT                   /translation="MDMQGSRQLAVTQQQAWDALNDPAVLKTCIPGCDKVEAAGENQYA
FT                   IGMALKIGPVSAKFSGKITLSDITPPASYRLSFEGQGGPAGFGKGSAAVTLTPDADGCE
FT                   LSYTVNATVGGKIAQLGQRLIDGAAKSMAEDFFKRFDGEMQRQHPESYAAKMVMGDVDA
FT                   EPAGGAHNAGVPMWVWVGGAVVVVLLALVALWPR"
FT   gene            complement(575881..577065)
FT                   /locus_tag="Bpro_0574"
FT   CDS_pept        complement(575881..577065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0574"
FT                   /product="VWA containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42534"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G08"
FT                   /protein_id="ABE42534.1"
FT                   /translation="MLLGDARAGKLADNITGFGRALRRAGVKIDSQRIALAKEAALAVG
FT                   VADKEDLSAAFEAVMVSREQDRLVFRELFDVYFQDPKVANKLLAQLLPSAEGKAEPSKR
FT                   RPRVREALSPQKTFGQQAQPRAEDQKVEFDAAMTASDIERLQHADFNALSATEYRLVER
FT                   LARDIKLPLPMFASRRSRPATSGARIHWPGVMHRAAQTGGELMQLPRRQRREQALPLLV
FT                   LVDVSGSMERYARLLLAFLHAATRRHPHRDVFAFGMHLTDLTPAFRQSDTDEMLAHASL
FT                   AIEDFAGGTQLGASLASLREHHARRLVGRRTIVLVITDGLDTGEPADLAKELAWLRRRS
FT                   RRLLWLNPLLRFDGYAPLARGAAVLHAHAHGMLAVHNLAKLEELAASLAALMKT"
FT   gene            complement(577237..578223)
FT                   /locus_tag="Bpro_0575"
FT   CDS_pept        complement(577237..578223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0575"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42535"
FT                   /db_xref="GOA:Q12G07"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G07"
FT                   /protein_id="ABE42535.1"
FT                   /translation="MTPFPSIDALMQALQGAGYFADRRLATAVFLALRLQRPLLLEGEP
FT                   GVGKTELAKALAVALQRQLIRLQCYDGLEQREALYEWNYAAQLLHMRAVELRAPTLGTG
FT                   VSSLPPEGASAALGRPGGGGHDNAADVEREVYQDRYLIRRPLLQALQTPPPGAVLLIDE
FT                   VDRADEPFEAFLLEYLGEYQVSIPEIGTVRAEVTPVTILTSNRTRELNDAVKRRCLYHW
FT                   LDYPDRERELAIVRAQVPEAGEQLSAQVAGFVDRLRRSPFGNAFQRAPGIAESVEWARA
FT                   LVALDTLVVDPEVVADTAGILFKQREDVAALTHGMAVELLKPEEVAG"
FT   gene            complement(578450..579241)
FT                   /locus_tag="Bpro_0576"
FT   CDS_pept        complement(578450..579241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0576"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42536"
FT                   /db_xref="GOA:Q12G06"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G06"
FT                   /protein_id="ABE42536.1"
FT                   /translation="MYAFTLERPTTLADAAKLAAAGAKPLAGGQTLLASMKMRLSSPEQ
FT                   LADLSGIKELAGIKRDSNAFVIGAMTRHADVADNAELKAALPALADMAAHIGDRQVRAM
FT                   GTLGGSVANNDPAACYPSAVLGLGATIHTTARKIAADDFFLGMFATALNEGELITAISF
FT                   PIPKRAAYMKFKQPASRFALVGVFIAQFDAGVRVAITGAANGVFRHAGLEAALSKSFTP
FT                   EAAAAVKIDATDLNSDIHATAAYRANLISVQAQRGVAKALG"
FT   gene            complement(579264..581639)
FT                   /locus_tag="Bpro_0577"
FT   CDS_pept        complement(579264..581639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0577"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42537"
FT                   /db_xref="GOA:Q12G05"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G05"
FT                   /protein_id="ABE42537.1"
FT                   /translation="MGASDFINLPTIGTSVRRKEDYRFLTGGGQYTDDITLANQSYAVF
FT                   VRSPHAHARINSISTAQAKAAPGVLGVFVGEDVAADKINGLPCGWLITSTSGTPMKEPP
FT                   HPILAQGKVRYVGDHVAMVVAETLEQAKNAAELVEVDYDVLSAVVKVTDAAKATALHDA
FT                   APDNHCYKWAIGDKAQVDAAFAGAAHVTKLDLTNNRLVPNAMEPRAVIGSYSRATDEYT
FT                   LYVANQNPHVERLLLTAFVMGLPEHKVRVIAPDVGGGFGSKIYLYAEDVCLTWASKKLN
FT                   RNIKWTADRSEAFVSDAHGRDHSSHAEMALDKDGKFLALRVHTDANMGAYLSTFAPAIP
FT                   TILYATLLAGQYTTPQIYVEVDAWFTNTAPVDAYRGAGRPEATYLLERLVTRAGWELGL
FT                   AQDEIRRRNMVTQFPYQTPVALQYDVGDFRALLERANELADVAGFARRKTATEAKGKLR
FT                   GMGYSSYIEACGLAPSNIAGALGARAGLFECGEVRVHPTGSVTVFTGSHSHGQGHETTF
FT                   SQVVAARLGISVEQVDVVHGDTGRVPFGMGTYGSRSLAVGGTAIMKALDKIEAKAKKIA
FT                   AHLMEASDADVEFANGEFTIKGTDKKVTFGQVALTAYVPHNYPLDKLEPGLNETAFYDP
FT                   TNFTFPAGTYICEVEVDPATGEVRVDRFTAVDDFGNIINPMIVEGQVHGGLVQGIGQAL
FT                   MENCVYDEESGQLLTGSLMDYAMPRADDMPNFTLATLCTPCSHNPLGAKGCGEAGAIGS
FT                   PPAVINAVLDALKPLGVTDFDMPASPGRVWEAIQAAKH"
FT   gene            complement(581754..582221)
FT                   /locus_tag="Bpro_0578"
FT   CDS_pept        complement(581754..582221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0578"
FT                   /product="(2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42538"
FT                   /db_xref="GOA:Q12G04"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G04"
FT                   /protein_id="ABE42538.1"
FT                   /translation="MQVQLTVNGKSSSIEAPPNTLLVQVLREHLKLTGTHVGCDTAQCG
FT                   ACTVIMNGRAVKSCNILAAQAAGAEITTIEGLAKADGTMHPMQAAFKECHGLQCGFCTT
FT                   GMVMNAVDLCTHHPQATEAEIRELLEGNICRCTGYQNIVKAVQQGAVAMAT"
FT   gene            complement(582701..583693)
FT                   /locus_tag="Bpro_0579"
FT   CDS_pept        complement(582701..583693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0579"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42539"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G03"
FT                   /protein_id="ABE42539.1"
FT                   /translation="MIKLNTVKTALAACTAALALSASLPAFSQAFPDKPVTLVVPFAAG
FT                   GPTDVLARMIAIPMGKSLGQTVIVENTVGAGGTIAATRVARSTPNGYTLFIHHMGMATA
FT                   PALYKKLSFDPLKDFEYIGQVVDVPMTLLARKDFPANNFNELLAYVKTNKEKVSLANAG
FT                   LGAVSHLCGLLFMSQIGVELNTIPYKGTGPAINDLLGGQVDLLCDQTTQTVPMIKDGRV
FT                   KVFGVTSLKRLSALPNVPTLDEQGLKGFEVKVWHGIYAPKGTPAPVLDKINASLRAAMQ
FT                   DPTVKQRLAELSSDIVPLDKMTPAALKSHLEAEINKWSPVIKKAGVYAD"
FT   sig_peptide     complement(583607..583693)
FT                   /locus_tag="Bpro_0579"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.941 at
FT                   residue 29"
FT   gene            complement(583862..584755)
FT                   /locus_tag="Bpro_0580"
FT   CDS_pept        complement(583862..584755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0580"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42540"
FT                   /db_xref="GOA:Q12G02"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G02"
FT                   /protein_id="ABE42540.1"
FT                   /translation="MTTVPAPALATTIAIAPAVARAHALLFVPANRPERIAKALASGAG
FT                   AVIVDLEDAVPPDAKATARDQLVQVFSSLGAAERARLLVRINAGSTPWHAGDLALVGRL
FT                   AAQGLAAVMVPKAESAADLAQVAAAVGPACGLLPLVESAAGLAAADALAHSPQVVRLAF
FT                   GNLDFQADLGLACEPDEAELVSVRLALVLASRRAGLAAPVDGVTPDIGDLAALQATAAR
FT                   SRRGGFGAKLCIHPAQVAPVNAALAPSAAELDWARRVIEGNDSERGGVFVLDGRMVDAP
FT                   VVRRARQLLAQAPGNP"
FT   sig_peptide     complement(584687..584755)
FT                   /locus_tag="Bpro_0580"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.936 at
FT                   residue 23"
FT   gene            complement(584752..586140)
FT                   /locus_tag="Bpro_0581"
FT   CDS_pept        complement(584752..586140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0581"
FT                   /product="MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42541"
FT                   /db_xref="GOA:Q12G01"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G01"
FT                   /protein_id="ABE42541.1"
FT                   /translation="MSSPTAQLAAFAASLTFEAIPAPVVRKAEDLLVDWFGSALAGKGA
FT                   RPVETIARFAAQMGPQPTRSGSALPAGASEVLINRSCTSPYLAAMVNAAASHVAEQDDV
FT                   HNGSVFHPATVVFPAALAVAQALGASGRQLLTASVAGYEVGIRVGEFLGRSHYKVFHTT
FT                   GTAGTLAAAAAVSHLLGLTAQQMRHAFGLAGTQSAGLWEFLRTAADSKQLHTAHAAAAG
FT                   LMSAYLAQGGFTGAAQIFEGPQGMAAGMSSDADPARLTAGLGTRWATAETSFKYHASCR
FT                   HTHPAADALLQVMQTHHLRPDDLASVVTHVHQGALDVLGPVTHPATVHQSKFSMGTVLA
FT                   LVARFKHAGLAEFDQHFDDAATQSLRDRVSMVLDAEVDRAYPQRWIGKVTVTTTDGRVL
FT                   QGRVDEPKGDPGNTLSREEITAKALRLAAYSSAAAPADMQAAIDGLWAVAQCPRLGPLL
FT                   GGVA"
FT   gene            complement(586183..587373)
FT                   /locus_tag="Bpro_0582"
FT   CDS_pept        complement(586183..587373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0582"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42542"
FT                   /db_xref="GOA:Q12G00"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q12G00"
FT                   /protein_id="ABE42542.1"
FT                   /translation="MTRPLDGITVVSLEHAIAAPFCTRQLADLGARVIKIERPGVGDFA
FT                   RAYDQRVRGQASHFVWTNRSKESLTLDLKQPAALAVLKALLAKADVLVQNLAPGATARM
FT                   GLGYEALRQDHPGLIVCDISGYGEDGPYRDKKAYDLLIQSEAGLLSITGTAEEPSKAGN
FT                   SMADIAAGMYAYTSVLAALLLRDKRGGTGKGSHIDVSMLESLAEWMGYPLYYAFEGAPP
FT                   PPRTAASHASIYPYGPFQAGDGGTVMLGLQNEREWKVFCEVVLRNAPLATDPRFDSNAR
FT                   RNENRDALKAIILATFAQLGTAQVVARLDEAQIANARMNSMAEVWAHPQLKARERWQNV
FT                   GSPAGDIPALLPPGRNSSFDYRMDAIPAVGQHTDTILRELGRDEAAIAQLYAAQAV"
FT   gene            complement(587389..588552)
FT                   /locus_tag="Bpro_0583"
FT   CDS_pept        complement(587389..588552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0583"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42543"
FT                   /db_xref="GOA:Q12FZ9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ9"
FT                   /protein_id="ABE42543.1"
FT                   /translation="MIKTATDQYQDIRDAVRALCAEFPDEYHRKIDEQRAYPEAFVDAL
FT                   TKAGWLAALIPGEYGGSGLGLAEASVIMEEINRSGGNSGACHGQMYNMGTLLRHGSTAQ
FT                   KELYLPKIASGEWRLQSMGVTEPSTGTDTTKIKTTAIKKGDRYVINGQKVWISRVQHSD
FT                   WMILLARTTALAEVKKKSEGMSIFMVDLRQAEKSGMTVRPIPNMVNHETNELFFENLEI
FT                   PEENLIGQEGLGFKYILDGLNAERTLIAAECIGDGYWFLDRVTKYVGERVVFGRPIGQN
FT                   QGVQFPIAEAYIEVEAANLMRYKACALFDAGQPCGAEANMAKYLAAKASWEAANACIQF
FT                   HGGFGFANEYDVERKFRETRLYQVAPISTNLILSYVAEHLLGLPRSF"
FT   gene            complement(588585..589469)
FT                   /locus_tag="Bpro_0584"
FT   CDS_pept        complement(588585..589469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42544"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ8"
FT                   /protein_id="ABE42544.1"
FT                   /translation="MSTDIRTLDAATLAHLQGWVGKTETLADDITAAPVRALSATLDRD
FT                   DAPPVPGTALPPLWHWLYFLPQHRQSEIGPDGHAKRGGFLPPVPLPRRMWAGGRLNWQP
FT                   GNPLVVGDAARRVSRIESVTHKAGRTGDLLFVLVRHELHNTHGLALTEEHDIVYRANPL
FT                   PGDSVPPPAAAEQGAAWQREIVPDDVLLFRYSALTFNGHRIHYDRRYVTEVEGYPGLIV
FT                   HGPLIATLLVDLVRRHVPGAFVKSFSFKAVLPTFDLHPFRLHGQPSADGKTVKLWAADH
FT                   EGWLTMQGTAELA"
FT   gene            complement(589530..590555)
FT                   /locus_tag="Bpro_0585"
FT   CDS_pept        complement(589530..590555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0585"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42545"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ7"
FT                   /protein_id="ABE42545.1"
FT                   /translation="MPDGVCHRISVRRFFIAAAATAAAGLLAVGTSALAQSPYPNRPIV
FT                   MIVPQAAGGTNDIVGRLVSQKLGEVLNTPAVVENRPGAGGNIGTQAAAKAPKDGYTLLM
FT                   TISSSQAINPALYKNAGFDPVRDFKPVSLIGAVPNVLLVHPSFPAKSVAELAALANKGK
FT                   PGQYQYASAGNGTLNHLLGEMLGSMAGINLQHVPYKGVAPALNDVLGGQLPMLFASLPS
FT                   ALSHIKAGKLRALAVSGANRSPVLPDVPTIAETVPGYNGTLWIGLFAPAGVPPDVLARL
FT                   QDGMAKALAAKDLRDKLEQQGVELAGPPERPVTPEQFAAVLNDDIAKWARIVKSSGASV
FT                   D"
FT   sig_peptide     complement(590448..590555)
FT                   /locus_tag="Bpro_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            590676..591569
FT                   /locus_tag="Bpro_0586"
FT   CDS_pept        590676..591569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0586"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42546"
FT                   /db_xref="GOA:Q12FZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ6"
FT                   /protein_id="ABE42546.1"
FT                   /translation="MKFDLTDLRLFVLVADEGSLTRAAQRQHLSLAAASSRIKSLETQA
FT                   GQPLLYREARGVRLTPPGEAFLHHARGVLRQVDQLRVDLQEYGGGLRGHVRVFANTTAV
FT                   TDFLPEILPGFLADNPRVNVDLQEKPNAEIARGVLDGRADIGIVAGRVDTLGLQAIHFS
FT                   TDRLVLVTSRQHRFAGRKTIAFAETLDEDAVGMHHGSTLQTFLATVTESLGKPLKLRIQ
FT                   LASFDAMCRMIGSGVGVGIVPESAARRNRDTMNLALIELTDEWSVRERYILVRDQAALP
FT                   AYALALIDTLCAHYQA"
FT   gene            complement(591604..591999)
FT                   /locus_tag="Bpro_0587"
FT   CDS_pept        complement(591604..591999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0587"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42547"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ5"
FT                   /protein_id="ABE42547.1"
FT                   /translation="MITKIQPPDWAEPRGYANGILARGALLFVGGQIGWNARQEFESDD
FT                   FVAQTRQTLQNIADVLKAGGAGPEHMVRMTWYVVDRDEYVASLRELGGVYREIMGKNFP
FT                   AMTCVQVAGLVEARARVEIEVTAVLPD"
FT   gene            complement(591996..592433)
FT                   /locus_tag="Bpro_0588"
FT   CDS_pept        complement(591996..592433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0588"
FT                   /product="thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42548"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ4"
FT                   /protein_id="ABE42548.1"
FT                   /translation="MKFTTQKQVRFHHCDPAGIVFYPQFFYLLHEVQEDFLNHIGFPEH
FT                   VLIAGGAGVPIVDLKTEFLGMCRHGDQLTMTLELTKVGNASVGMHYEIHGEPSAHGGSS
FT                   LRVRAHGVVVYSEVPHGKPVPIPDALRDALLPYLKTPPETT"
FT   gene            complement(592430..594073)
FT                   /locus_tag="Bpro_0589"
FT   CDS_pept        complement(592430..594073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0589"
FT                   /product="Benzoate-CoA ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42549"
FT                   /db_xref="GOA:Q12FZ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ3"
FT                   /protein_id="ABE42549.1"
FT                   /translation="MNTPTHAPASKAPSAQTDCFVHDRLPTPDQWPKLVYPPELRIPDQ
FT                   ANLVDVLFSRARAQGHADKPFLRSDRITLSYADALERVNRIAQVLTEDFHLVPGNRVLL
FT                   RGGNSIGMALAWLGVVQAGLVAVATMPLLRAKELGEIIDKARPSLALCDASLLQELQAA
FT                   RDQGGLLGTIVPFNLMNEPGSLAVLSAQKDGHFTPCPTAADDIAMMAFTSGTTGKPKAA
FT                   VHTHRDVLAACEAWPRHVLKARPDDIVMGSPPLAFTFGLGGMLIFPMWAGASVYYPSVA
FT                   YTPEVMVKLMNQVGATLCYTAPTFYRQMAPFAKQLGVPSLRICVSAGEGLPDATRQLWK
FT                   DATGIEMIDGIGATEMFHIFISSAGAEVRRGAIGKVVPGYTARVVDDQGAEVPHGTVGK
FT                   LAVMGPTGCKYLDDARQANYVKGGWNYPGDAFVQDDDGYFFYQARADDMIITSGYNVGG
FT                   PEVEDALLKHPAVAECGVIGLPDEERGMIVKAFVVLRPGHEAGEALVKSLQDHVKATLA
FT                   PFKYPRQIEFVGSLPRTETGKLQRFKLRQS"
FT   gene            complement(594070..595314)
FT                   /locus_tag="Bpro_0590"
FT   CDS_pept        complement(594070..595314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0590"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42550"
FT                   /db_xref="GOA:Q12FZ2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ2"
FT                   /protein_id="ABE42550.1"
FT                   /translation="MNPTTAHLALPFFDGVHRDLGQRLAEWIPHQHIDERDDRQACREW
FT                   VRLLGAHQWLRYCVPAGKDGVLGGALDQLDSRALVILREMLAFHSPLADFAFAMQGLGS
FT                   GAITLAGSPEQQAAYLPQVARGEKIAAFALSEADAGSDVGAMQTSATHTGDGWALNGSK
FT                   TWISNGGIADFYVTFAKTEPDAGTRGITAFIVDAPTQGLDSGEAIAVISPHPLATLKFT
FT                   HCRLADSTQLGTLHGGFKLAMQTLDIFRASVAGAALGMARRALAEAVQFAQARKMFGQT
FT                   LADFQLTQAKLGEMAALVDAAALLTYRAAWMRDHHNAPGEHPDNAATTATTAITATTEA
FT                   EGRRDRTVAAAMAKMTATENAQRVIDMALQMHGGQGVKVGSKVESLYRDIRSLRIYEGA
FT                   TEVQQLIIGKAVLQS"
FT   gene            complement(595354..596208)
FT                   /locus_tag="Bpro_0591"
FT   CDS_pept        complement(595354..596208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0591"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42551"
FT                   /db_xref="GOA:Q12FZ1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ1"
FT                   /protein_id="ABE42551.1"
FT                   /translation="MKHYIVPANPMHAQFDALATYHARHFAYAFDAGVATLTLNRPERK
FT                   NPLTFDSYAELRDLFRALNYATDVKAVVLTGAGGNFCSGGDVHEIIGPLTKMSMPELLE
FT                   FTRMTGDLIKAMRLCPQPVIAAIDGICAGAGAMMALAADMRLGTAQAKTAFLFTRVGLA
FT                   GADMGACALLPRLIGQGRASELLFTGRAMNAQEGLQWGFFNALHEPGEVLAQAHKLAHE
FT                   LASGPTFAHGMTKTMLHQEWAMTLDQAIEAEAQAQAICMQTGDFTRAYEAFAAKQKPVF
FT                   QGD"
FT   gene            complement(596205..596690)
FT                   /locus_tag="Bpro_0592"
FT   CDS_pept        complement(596205..596690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0592"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42552"
FT                   /db_xref="GOA:Q12FZ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FZ0"
FT                   /protein_id="ABE42552.1"
FT                   /translation="MDMEARGHSEHPEALRLWLRLLTCTQLVEKQVRTQLREQFDTTLP
FT                   RFDLMAQLERSPEGLKMNELSRRMMVTGGNVTGITDQLVTEGLVERVDVEGDRRAYRVR
FT                   LTPRGRKLFDEMARQHEAWIVAAFESLSPREVESLHKLLGKVKHHHMQQNETKLETA"
FT   gene            complement(596741..599074)
FT                   /locus_tag="Bpro_0593"
FT   CDS_pept        complement(596741..599074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0593"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42553"
FT                   /db_xref="GOA:Q12FY9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY9"
FT                   /protein_id="ABE42553.1"
FT                   /translation="MHILCLGGGPAGLYFALLMKLQNPAHQVTVVERNRPFDTFGWGVV
FT                   LSDQTLGNLRVADPVSAQLIGDAFNHWDDVEVFFKGRSVRSGGHGFCGIGRKRLLNILQ
FT                   ERCLALGVELVFETDVQDDQAIAAQYQADLVVASDGLNSRIRNRYAETFKPDVELRACR
FT                   FVWLGTRKTFDAFTFAFEKTEHGWFAAHAYKFDENTSTFIVETPEAVWKAHGLDQMSQE
FT                   EGIAFCERLFAKYLDGNALMNNATHVRGSAIWIRFPRVVCERWVHHETVEGKRVPIVLM
FT                   GDAAHTAHFSIGSGTKLALEDAIDLANEFSASAEEFNTGHGMDEVLQAYEARRSVEVLK
FT                   IQNAARNSTEWFENVNRYSGMEIEQFAYSLLTRSQRISHENLRLRDAKWIESYESWLSG
FT                   GPVIPPMLTPFKVRGTELKNRIVCSPMATYSAIDGVPQDFHLVHLGARALGGAAMVMVE
FT                   MTSPNPEGRITPACTGLWNDEQTAAFKRIVDFVHGQSTAKIGMQLGHSGPKGSTQVGWE
FT                   EMDEPLPAGGAHANWPVVSASAVPYGERNQTPQAMTHSHMETLKQQFVDATRRAAAAGF
FT                   DWLELHCAHGYLLSAFITPLTNLRSDEYGGNIENRCRYPLEVFRAMRAVWPAHLPMSVR
FT                   ISAHDWAPGGNTPDDAIVVARLFKDAGCDVIDVSSGQTTRQAKPVYGRMYQTPFADRIR
FT                   NEVGIQTIAVGAISEVDHVNSIIAAGRADLCALARPHLADPAWTLHEAAKLQSQAVDWP
FT                   KQYLSGRDQLYREISKQQALAAQS"
FT   gene            complement(599253..600002)
FT                   /locus_tag="Bpro_0594"
FT   CDS_pept        complement(599253..600002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42554"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY8"
FT                   /protein_id="ABE42554.1"
FT                   /translation="MFNIATVQKPADQALRQDGLSLLYPAGLTTSLHLDSPAWRQGWQQ
FT                   LTDSWNRLPPDAHLKDGGHYRKRRHACFVQELPGGALTQAPHRAHWQPTDYNALHGGFE
FT                   RWFEPVEPAVAEAPAWTDLLASLGKLFAQVRPVPRWYIEAHQFRIDTAGGVGRPTPEGA
FT                   HRDGVDFVVVLLVARHGVKGGETRVFDANGPDGVRFVMQEPLTTLLLDDARVIHETTPI
FT                   LPGDGPAEDGYRDTLVLTYRAGGFQAP"
FT   gene            600233..600529
FT                   /locus_tag="Bpro_0595"
FT   CDS_pept        600233..600529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42555"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY7"
FT                   /protein_id="ABE42555.1"
FT                   /translation="MLYKFKSKDAGNVIMLEPNGRRVLEIIGKDAGPKGIILPEEMPAA
FT                   IEALKAAIALEYAGDEQVGTVPGDGLGLHQRALPFIDMLERNHKAGHEVVWGV"
FT   gene            complement(600636..601646)
FT                   /locus_tag="Bpro_0596"
FT   CDS_pept        complement(600636..601646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0596"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42556"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY6"
FT                   /protein_id="ABE42556.1"
FT                   /translation="MNLSFKQNRRLALASCALSAIVLAAPAAWAQSTWPAKPVKIVVPF
FT                   APGGTTDILARAMAPELSKAFGQPFVVENRAGAGGNIGADLVAKSPADGYTLLMGTVGT
FT                   HSINKALYSKMPFDSQKDFAPITLVAGVPNVMVMNADKAAALNIHNVADFVKYAKANPG
FT                   KLSMASSGNGTSIHLAGELFKSMTGTFMPHIPYRGSGPAMLDLVGGNVDVMFDNLPSAL
FT                   PQIKAGKLKAFAVTSAQRSAALPDTPTVAEAGPLRGFDASSWFGLLAPAGTPPDIVNRI
FT                   QQEVAKSLNTPAIKEKLLAQGAIPGGNTPQQFTAFIDAEHKKWAQVVKASGAKID"
FT   sig_peptide     complement(601554..601646)
FT                   /locus_tag="Bpro_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT   gene            complement(601792..602778)
FT                   /locus_tag="Bpro_0597"
FT   CDS_pept        complement(601792..602778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0597"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42557"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY5"
FT                   /protein_id="ABE42557.1"
FT                   /translation="MKRLLVLAVAATALFANAQTFPGSKPISFVVPFAAGGPTDRVARD
FT                   LAEAMRKSMGGGANFVVENVNGAGGTIGAAKVAKAAPDGHTLLLHHIGMASAPALYRKL
FT                   SYKPLDDFEYVGMINEVPMTLIGKPQLPANNYRDFENYIKANAGKLNIAHAGLGSASHL
FT                   CGLMWQSAIKANDAMTTIPFGGTAPAMNALVGGQVDLMCDQTTNTTGQIEAGRVKAFAV
FT                   TTAKPLSGNKLLKDYPTLQDMGLKGFDLTIWHGLYAPKGTPPAVLAQLNTALKLALKDP
FT                   DFIKKQEGLGAIVVADKRVEPAAHKAFVADQIAKLKPVIEAAGKFAD"
FT   sig_peptide     complement(602722..602778)
FT                   /locus_tag="Bpro_0597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 19"
FT   gene            complement(602955..604223)
FT                   /locus_tag="Bpro_0598"
FT   CDS_pept        complement(602955..604223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0598"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42558"
FT                   /db_xref="GOA:Q12FY4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY4"
FT                   /protein_id="ABE42558.1"
FT                   /translation="MTTHYDALEVQPPSQREAALMAALPQQIAHAQSHAPAFAGILRGV
FT                   DASTVTSRAALAHLPVTRKHELLALQQAERLTTGSGDPFGGFSALRYGPHMPHVFASPG
FT                   TIYEPEGTRKDYWRLARALFAAGFRPGELIHNCFSYHFVPAGSMMESGAHALGCTVFPG
FT                   GTGQTEQQVQAMAELKPAGYIGTPSFLKIIVDKAAEMGVALPTVTKALVSAEAFPPSLR
FT                   DWLAGHGIAGYQCYASADLGLIAYETEAREGLVLDEGVIVEIVRPGTGTPVAEGEVGEL
FT                   VVTTLNPDYPLIRFGTGDLSAVLPGRCPTGRTNTRIKGWMGRADQTVKVRGMFVHPGQI
FT                   ADITRRFPEVSKARLVVNGEMANDSMTLQVEIAGGAAAQAGLDQRISEAIRDVTKLRGT
FT                   VQLMDPGSLPNDGKVIEDARSYQ"
FT   gene            complement(604824..605633)
FT                   /locus_tag="Bpro_0599"
FT   CDS_pept        complement(604824..605633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0599"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42559"
FT                   /db_xref="GOA:Q12FY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY3"
FT                   /protein_id="ABE42559.1"
FT                   /translation="MDSNNIVLNVNGIEVIYNHVILVLKGVSLQVPQGRIVALLGGNGA
FT                   GKTTTLRAISNLLKGERGEVTKGSIELRGERIENLSTSDLVQRGVVQVMEGRHCFAHLT
FT                   IEENLLTGAYTRKSKAEVAANLEKVYNYFPRLKTRRTSQAAYTSGGEQQMCAIGRALMA
FT                   SPSMVLLDEPSMGLAPQIVEEVFNIVKDLNQKEKVTFLLAEQNTNMALKYADYGYIMES
FT                   GRVVMDGLAADLASNEDVKEFYLGVGGGERKSFKDVKSYKRRKRWLA"
FT   gene            complement(605815..607149)
FT                   /locus_tag="Bpro_0600"
FT   CDS_pept        complement(605815..607149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0600"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42560"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY2"
FT                   /protein_id="ABE42560.1"
FT                   /translation="MKVRNLILAVAAVAAGASSLVSTGALAQAKEQFIPVLSYRTGPYA
FT                   PNGAPWANGYVDYLKLVNARGGLNGVKLSFEECETGYDTARSVECYERLKGKNGGAALV
FT                   QPLSTGATFAITEKAPADKISVVTVGYGRSESADGTTFKWNFPLAGTYWVASDTILQAI
FT                   GKKEGGLDKLKGKKIALVYHDSPYGKEPIALLQERSRQLGFDLQLLPVTAPGVEQKATW
FT                   LQIRQARPDYTLLWGWGVMNSTAIKEAQATGYAREKMYGVWWAGAEPDVKDVADGAKGY
FT                   NAVTLQHGAEPQSKVVKDMLAMVHGKGQGTGPKDEVGQVLYMRGAMSAMLGVEGIRAAQ
FT                   DRFGKGKVMTGEQVRWGLENLNLTQAKLDALGFAGVMRPISTSCTDHMGAAWARIHTWD
FT                   GKQWKFTSDWLQADEQIIKPLVKSTAARYAAEKKLTPRTPADCQS"
FT   sig_peptide     complement(607066..607149)
FT                   /locus_tag="Bpro_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.853 at
FT                   residue 28"
FT   gene            complement(607262..608338)
FT                   /locus_tag="Bpro_0601"
FT   CDS_pept        complement(607262..608338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0601"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42561"
FT                   /db_xref="GOA:Q12FY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY1"
FT                   /protein_id="ABE42561.1"
FT                   /translation="MLYRENGQFKTTYRADQQIFPIAQDRLVVALFLLFAFIAVPMLAS
FT                   DYLFRAILIPFLIISLAALGVNILVGYCGQISLGSGAFMAVGAYGAYNFFVRLPGLPLI
FT                   PALILGGLCATFFGILFGLPSLRVKGLYLAVATLAAQFFADWMFLRIKWFTLDSPSGSV
FT                   SVSNLQVFGFPIESAHSKYWLCLSILVVMALLAKNLVRGAIGREWMAIRDMDVAAAVIG
FT                   IRPMYAKLSAFAVSSFIVGMSGALWGFVYLGAWEPAAFSVDQSFRLLFMVIIGGMGSIL
FT                   GGFLGAAFITVLPIALNQFLPVLAQLLGFEISTAGISHAELMIFGGLIVWFLIVEPHGL
FT                   AKLWSIGKQKLRLWPFPH"
FT   gene            complement(608679..609608)
FT                   /locus_tag="Bpro_0602"
FT   CDS_pept        complement(608679..609608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0602"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42562"
FT                   /db_xref="GOA:Q12FY0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FY0"
FT                   /protein_id="ABE42562.1"
FT                   /translation="MAFFLETLFGGLMAGMLYSLVALGFVLIFKASGVFNFAQGAMVLF
FT                   AALAMARFSEWIPQWTGIDNLILANAAAFVIAGLIMFAVAWLIERLVLRHLVNQEGATL
FT                   LMATLGIAYFMEGLGQTLFGSNIYKIDIGMPKEPIFVADGMFPGGILINKEDLIAAVIA
FT                   AALVALLSLFFQKTATGRALRAVADDHQAAQSIGIPLNRIWVIVWCVAGVVALVAGMIW
FT                   GSKLGVQFSLTTVALRALPVVILGGLTSVPGAIIGGLIIGVGEKLSEVYLGPFVGGGIE
FT                   IWFAYVLALGFLLFRPQGLFGEKIIDRV"
FT   sig_peptide     complement(609534..609608)
FT                   /locus_tag="Bpro_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.815) with cleavage site probability 0.785 at
FT                   residue 25"
FT   gene            complement(609831..610613)
FT                   /locus_tag="Bpro_0603"
FT   CDS_pept        complement(609831..610613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0603"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42563"
FT                   /db_xref="GOA:Q12FX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX9"
FT                   /protein_id="ABE42563.1"
FT                   /translation="MHKKIGDVILDVSNISLSFGGVKALSDISFNVKEHEIRAIIGPNG
FT                   AGKSSMLNCINGVYSPQQGAITFRGQTFKHMNSHQVAVMGVARTFQNLALFKGMSVLDN
FT                   IMSGRNLKIKSNLLLQALRIGPAEKEEIMHREAVEKIIDFLEIQAFRKTPVGQLPYGLQ
FT                   KRVDLGRALAMEPQVLLLDEPMAGMNVEEKQDMCRFVLDVNDEFGTTVVLIEHDMGVVM
FT                   DISDRVVVLDYGKKIGDGTPDEVRNNPDVIRAYLGVEH"
FT   gene            complement(610744..612690)
FT                   /locus_tag="Bpro_0604"
FT   CDS_pept        complement(610744..612690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0604"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42564"
FT                   /db_xref="GOA:Q12FX8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX8"
FT                   /protein_id="ABE42564.1"
FT                   /translation="MQTTFPRLLLKHAAERPGAAAMREKEYGIWQAHSWAGMAELVEHI
FT                   ACGLHEAGLGRGEHMALIGANRPRLYATMLAAQSLGAIPIPLYQDAVGAECVFPITNAD
FT                   VRFAMVEDQEQVDKLLEIRDRCPDLAHIIFDDPRGLRNYEEPGLTSLDRLIESGQALAV
FT                   SQPGWFRMEVDKASPDDVAAMFFTSGTTGNPKGVVHTHATLLDRAQAGAEFDKLTSAEE
FT                   VLAYLPPAWIGQNIFSYAQWLACGYVVNCPESASTVMIDLKEVGPTYYFAPPRVFEGML
FT                   TTVMIRMEDAGRLKRGMFNYFMGVARQVGPALMDGKPVNFIQTLLYGLGNLMVYGPLRN
FT                   NLGFSRVRVAYTAGEAIGPDLFTFYRSIGINLKQLYGSTETAVFVCLQPDNEARADTVG
FT                   VPIQGVQIRVADNGEVLVKSAGLLKEYYKNPAATAEVLTADGWYHTSDAGFLNASGHLK
FT                   IIDRVKDVGRIKGGANDGALFAPKYVENKLKFFPHIKEVVAYGDGREKVCVMINIDFDA
FT                   VGNWAERRNLPYAGYTDLAQKPEVYQLIKECVEKVNADLSVDALLAGSQISRFLILHKE
FT                   LDADDGELTRTNKVRRGFIAEKYQPLVDALYGGKTEQFIETVVKFEDGRSGSVSATLKI
FT                   SDTQTFAPVKAAA"
FT   gene            613052..613810
FT                   /locus_tag="Bpro_0605"
FT   CDS_pept        613052..613810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0605"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42565"
FT                   /db_xref="GOA:Q12FX7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX7"
FT                   /protein_id="ABE42565.1"
FT                   /translation="MFRYFWVGVLVRTMSTDTSLHQRRRTPTADELQGIPWLRLLQPPE
FT                   RARAVAQLQVGDAAPGDYVCRIGRPVTYWFGVVEGLLKMSTDNAQGTTITFAGLPPGGW
FT                   FGEGTALKREPYRYNIQALRKSVVAGLPIDSFHWLLDHSIGFNRFVMNQLNERLGQFIA
FT                   AREIDRMNNPDLRVARSLAALFNPVLYPGVGDILRITQQEMAYLVGLSRQRVNEALSAL
FT                   QAQGFIRVEYGGLRVLDLAALRSSIASDKK"
FT   gene            613910..614710
FT                   /locus_tag="Bpro_0606"
FT   CDS_pept        613910..614710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0606"
FT                   /product="ribosomal large subunit pseudouridine synthase F"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42566"
FT                   /db_xref="GOA:Q12FX6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX6"
FT                   /protein_id="ABE42566.1"
FT                   /translation="MRIPKAAAPAATASASSTVRLNKRMAELGLCSRREADDWIARGWV
FT                   LVNGAPAVMGQPVAPDARIEVDRQAEQQQRQQVTILINKPVGYVSGQAEDGHEPAVVLV
FT                   QPQNRWRECNSRMRWGPEQLRGLAPAGRLDIDSIGLLVLTQDGRVARQLIGENSEIEKE
FT                   YLVRVSYGAETSNVQAVFPREKLALLRHGLSLDGQALRPAQVDWQNPEQLRFVLKEGKK
FT                   RQIRRMCEQVGLFVTGLKRVRIGRVNLGHLPVGQWRYLAAHESF"
FT   sig_peptide     613910..613975
FT                   /locus_tag="Bpro_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.289 at
FT                   residue 22"
FT   gene            614981..615370
FT                   /locus_tag="Bpro_0607"
FT   CDS_pept        614981..615370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0607"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42567"
FT                   /db_xref="GOA:Q12FX5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX5"
FT                   /protein_id="ABE42567.1"
FT                   /translation="MPLITYLAEDNETVLENLIETLQEICALKVNGFGATEAEAHRWLT
FT                   SHNGDWHLAIVDLFLKEGSGLGVLAGCRNREAFQKVVMLTNYATPEIRRRATALGADAV
FT                   FDKSGELDDLFAYCIKQTEQQEQRR"
FT   gene            complement(615449..615820)
FT                   /locus_tag="Bpro_0608"
FT   CDS_pept        complement(615449..615820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42568"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX4"
FT                   /protein_id="ABE42568.1"
FT                   /translation="MRTFTTAFAVLTLQCLLAMFSPAHAQSSSSGTFGVTIVLRTFSEE
FT                   ATADHRCTHRGQAEGQAGTLRISCPATVDVQAIASASTRKTAQYPQNAAAGQADRTQLA
FT                   VVAGQPMNSLNPIELTISW"
FT   sig_peptide     complement(615743..615820)
FT                   /locus_tag="Bpro_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(616354..617328)
FT                   /locus_tag="Bpro_0609"
FT   CDS_pept        complement(616354..617328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0609"
FT                   /product="Spore coat U"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42569"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX3"
FT                   /protein_id="ABE42569.1"
FT                   /translation="MDRSHPLRNIMLPIMIVMCKKVSEATHRDAVPDRGSAAVTLHHFL
FT                   LAAATWGVLLAAGTAHATISCSVSGNGFTSVYDPISTVPNDNVSSVTINCSRASGDPTT
FT                   TTYSLASTNGLYPQGQNNRAYYPTNKYLKYDIYKDAAYSSRWGPGGSAPFTGTLNFGSG
FT                   TSASLTLPYYNRVAAQQSAVAADYTDTMTATLTYSVTSGVNATATPATMPVIITTNPQC
FT                   QFSTPPGTMSFSYTSFQSTAATGSTQFATRCTSGLPYTMSLGATGGTLLGLAYSLSLSA
FT                   ASGTGTGAAQTYLVNGNIAANQAGICATSACSASAPQTITISY"
FT   gene            complement(617471..619867)
FT                   /locus_tag="Bpro_0610"
FT   CDS_pept        complement(617471..619867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0610"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42570"
FT                   /db_xref="GOA:Q12FX2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX2"
FT                   /protein_id="ABE42570.1"
FT                   /translation="MTRGRCRLLHVRACLVMASLCAGAAAQGQTTPPSNVPATARSAND
FT                   RLLPLEVFINNTKGGVWTLLERNGILYAPSDAFDEWRLNHQPSAQDIQFQGQQWYPLSA
FT                   IPGFEARLNFATQSVDLVFSPAAFNAVRLTQEAALRPPLSPTIPAVFANYDLNYTTSRS
FT                   RVTGSDDLRTKDLGALTELGFSGQWGLVTSSYVGRNLVSQDPTLNASWRRLETTYTRNF
FT                   LDSNSTLRLGDSITRTGISGRSVYFGGFQFAKNFALQPGFVTQPIPTVTGLSAAPSTVE
FT                   LYVNDALRQTSRVPSGPFSIDNFPALTGAGEARVVVRDILGRETVITQSFFSNANLLEE
FT                   NLTDWSFELGAVRNNLGTDNANYGPRFIAGLWRKGLSKSLTVEGNGEWSSSLSRAGAGV
FT                   SYALPFQMLGQTALAVSRSDTVGNGHNWLVGVERSGLRHGVAFSAQGASRGYRQLGIDT
FT                   ASPRLQTTASYSYSSDKFGALNLSYAGFDNYELGKLNTVSLSYTIRLGQRSALTLSATR
FT                   LSGVSSGNSLGAFLIVPLDNRITIASGATRRSGSTDSYVNASRALSAETGWGWRTALGS
FT                   RVDGGYAEGGAYYQGTKGLFSADVSGAKNQQNVRLGLLGGVVMADGQVFATRRVQDSFA
FT                   IVEVPGYANVGVGFQGSTLTRTNSSGVALLPRLLPFQRNSVRLDPTELPISAELDSIEQ
FT                   EAVPALRSAVKITFPVRSGRGALIRIEFDDGEPAPAGAEIELVGDKKEFFVARRGEAFV
FT                   TGLQSANRLRLKWNGNSCTFDVALPPGNLEDITRVGPVRCIGVKR"
FT   sig_peptide     complement(619781..619867)
FT                   /locus_tag="Bpro_0610"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.855 at
FT                   residue 29"
FT   gene            complement(619879..620616)
FT                   /locus_tag="Bpro_0611"
FT   CDS_pept        complement(619879..620616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0611"
FT                   /product="chaperone protein PmfD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42571"
FT                   /db_xref="GOA:Q12FX1"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX1"
FT                   /protein_id="ABE42571.1"
FT                   /translation="MNVLQRRSHLHLVSFLLLLSLMAPWAPAAAGVFSVTPVRLYMKPR
FT                   DRAIAVTLTNEADTEVVLQADINTWSQKPDGTDELVLTEDLILAPPIIKLAPKARQVVR
FT                   LALLKPADASRQLTYRMIIREVPEALPASGIQVPIALALSMPVFITPPAAKRQMNCNTG
FT                   RADAKTISLQCSNSGTAYAQIREAAVMRGDQALARFEGGSYILPGASKTISLRSEKAVT
FT                   AGPAQLVVTFDDGQSLTTSITLP"
FT   sig_peptide     complement(620524..620616)
FT                   /locus_tag="Bpro_0611"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.798 at
FT                   residue 31"
FT   gene            complement(620619..621152)
FT                   /locus_tag="Bpro_0612"
FT   CDS_pept        complement(620619..621152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42572"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FX0"
FT                   /protein_id="ABE42572.1"
FT                   /translation="MLAAASSLAGGASGQFSVQITLNSAGSNSCTSASDSGTASSSVQV
FT                   RCTTNVFVEIAARTTTSTSTSTTSTSTSRFMPGYRPARDSLLPDYCRSELSRADRVAGL
FT                   TCRLDDRRQFAAAGDEGDEGWAFESRLYAVNTEDTPLQMQARSRVEDDHGTLTSIRLAS
FT                   ADGRSGPVEMLVSF"
FT   gene            complement(621257..621802)
FT                   /locus_tag="Bpro_0613"
FT   CDS_pept        complement(621257..621802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42573"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW9"
FT                   /protein_id="ABE42573.1"
FT                   /translation="MNWKIVKCLVTVQSHTDSTLSYFRFIQPEILMKKLLALLALALVS
FT                   VATLPVQAATASGQFDVSISLTGTCKYVKTSDVAFTYTSLQTGAQAQTTAGGFTVQCTK
FT                   DLVYTLALDSTSVTDDAVDLAYTLALSGSGATGSGAAQAYSVTGSIAANQAGKCATAGG
FT                   ACTNSAATNKTRTLTITY"
FT   sig_peptide     complement(621641..621802)
FT                   /locus_tag="Bpro_0613"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 54"
FT   gene            621985..623865
FT                   /locus_tag="Bpro_0614"
FT   CDS_pept        621985..623865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0614"
FT                   /product="heat shock protein Hsp90"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42574"
FT                   /db_xref="GOA:Q12FW8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12FW8"
FT                   /protein_id="ABE42574.1"
FT                   /translation="MHKQTLSFQAEVAQLLNLVTHSLYSNPDIFLRELISNASDACDKL
FT                   RFEALNDAALYEGDSELQVRLRYNKTANTLTITDNGIGLSEREAIENLGTIAKSGTRDF
FT                   MAKLSGDQKNDAQLIGQFGVGFYSGFIVADRITVESRRAGLPATQGVRWSSEGTGEFEV
FT                   SEMERAERGTSIILHLKDDARDYLNAWKLKGIINKYSDHISLPILMQKEEWKEGENGQP
FT                   GEMVVTGEWETVNQAAALWTRAKKDITPEQYDEFYKQISYDSQAPLATTHNRVEGGTEY
FT                   TQLLFIPAKAPMDLFNRDKAAGVKLYVRRVFIMDDAQALMPTYLRFVKGVVDSADLPLN
FT                   VSRELLQESRAVKAIREGNTRRVLSMIEDLAANDADKFKAFYAEFGAVLKEGLGEDFAN
FT                   RERLAKLLRFASSTTDTVSVGFADYKARMKEGQDAIYYVTADTLAAAKSSPQLEIFRKK
FT                   GIEVLLMADRVDEWALNYLHEFDGTPLQSVAKGAVDLGKLQDEDEKKAAEEAQTHFKPI
FT                   LDKLKEALKDKAKDVRATTRLVDSPACLVVQDGDMSTQLARMLKQAGQAVPEVKPILEV
FT                   NAQHPLVKKLEAGEHFDDLAHILFDQALLAEGGMPEDPAAYVKRVNALLV"
FT   gene            623934..624136
FT                   /pseudo
FT                   /locus_tag="Bpro_0615"
FT   gene            624498..624767
FT                   /locus_tag="Bpro_0616"
FT   CDS_pept        624498..624767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0616"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42575"
FT                   /db_xref="GOA:Q12FW7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW7"
FT                   /protein_id="ABE42575.1"
FT                   /translation="MQLKVQNLSELAQGLIVERKRQGLSREQAAAVCNVSESFIRDAES
FT                   DPGRCSLTKLLQLTQGLGLTLTLTGWQIGGTTSDSHPNTKVSTS"
FT   gene            624764..626014
FT                   /locus_tag="Bpro_0617"
FT   CDS_pept        624764..626014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0617"
FT                   /product="HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42576"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW6"
FT                   /protein_id="ABE42576.1"
FT                   /translation="MIRLRVWANVRPMGWFGHEAGEYFFEYDAQWLEQPGAYVLAPQFT
FT                   LVGTRFTGPLVRSFFENLLPEGTALDDVIAALALRDPSPFELLGQLGKELPGVLSLLPE
FT                   DGQSAMLQQYRPLPYEELSERIRGQKPLLVSNEQTTMSLAGAQEKMGLRFDKRTNQLSE
FT                   SVGTSHTTHILKPDTRQKRYQPSALNEYACMKLARALKLPVNDVWFLRVPEPVYLVERY
FT                   DRVNLAGNIVGLHQFDGCQLLGHGSGWKYERQGGLASVPKLVAALRALPVRGSDLLKLQ
FT                   QWVMFNYLIGNADAHAKNLSVLVDEKGFRLAPFYDLLCVRAYGDTGLALHIGDEDAFDA
FT                   VGAHSWEALCKDCGFRLPETLKGFRKMAQDLLPAWQKTKAAIIKDVAPEKRELELLEKM
FT                   TDVFEMHSAHAISMTGG"
FT   gene            complement(626251..626946)
FT                   /locus_tag="Bpro_0618"
FT   CDS_pept        complement(626251..626946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42577"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW5"
FT                   /protein_id="ABE42577.1"
FT                   /translation="MTILHLLSGGAAQGLVTQLEQRFETQHQVSIDACFGAVGMMRDNL
FT                   LAGTPCDVLILTEALIAQLMASGEVVPGSALTLGVVKTGIAVKNGEDVPDVDNPAALKT
FT                   ALRAARGIYFPDPVKATAGIHVMNVLKQLGLDTELADRLRVFPNGATAMRAMADTNEPG
FT                   LLGCTQITEIIYTPGVMLVAPLPKALELATTYTAALCARARQPQAARDLISLLASPEAA
FT                   SARQLCGFE"
FT   gene            complement(627025..628002)
FT                   /locus_tag="Bpro_0619"
FT   CDS_pept        complement(627025..628002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0619"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42578"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW4"
FT                   /protein_id="ABE42578.1"
FT                   /translation="MRRDFIRFLALGIGLASAVATAPLLAQTYPAKPVRIVVPFAAGGP
FT                   ADVYGRFMAQRLQDALGQSFVVDNRPGAGSVIGTDTVAKSAPDGYTLLLMSNAHTVNES
FT                   LIPNKPFQLMRDFVAIAPLNYSDLVLVAHPALPASTLQALLRDAKARPGKLNYASSGPG
FT                   TPYHMAGELFKSMAGVYLVHIPYRGSSGARTDVIGGQVDVMFDAVTTMSEQVKAGKVKA
FT                   LATTGRQRSEVLPDVPTLNEAGVPGYEATIWLGLMAPRGTPRAVVDQLNGAISKIVGQP
FT                   EIRQLWGKQGAVPLVMTPEAFDKYARDDIAKWAGVIKSANIKVD"
FT   sig_peptide     complement(627922..628002)
FT                   /locus_tag="Bpro_0619"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            complement(628105..629073)
FT                   /locus_tag="Bpro_0620"
FT   CDS_pept        complement(628105..629073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0620"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42579"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW3"
FT                   /protein_id="ABE42579.1"
FT                   /translation="MKRRSLLLASLLMSAAGWCAAQGAWPAKPITMIVPFPPGGLADLV
FT                   ARPVAEAMSRELGQPVVIENKAGAGGGIGMGMAAKAKPDGYTVLLALSSLTVIPEADTL
FT                   LGRPAMFALPDLRPIARFTADPTVLAVRADAPWKTAQQFIDDAKKRPGAINYGSSGNYG
FT                   TMHVPMEILAQTAGIKMTHVPFTGAGPAVVALLGGQIDAVSSGPATVLQQVKAGKLRVL
FT                   AHWGNGALSTLPEVPSLKDAGFNAEYAQWSGLFIPQATPEPIAQRLRAAAKAAAQDARV
FT                   KEVILGAGSPVLYQDSPDFEMYVKEDAKRMAEVVKRIGKVE"
FT   sig_peptide     complement(629002..629073)
FT                   /locus_tag="Bpro_0620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.860 at
FT                   residue 24"
FT   gene            complement(629186..630259)
FT                   /locus_tag="Bpro_0621"
FT   CDS_pept        complement(629186..630259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0621"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42580"
FT                   /db_xref="GOA:Q12FW2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW2"
FT                   /protein_id="ABE42580.1"
FT                   /translation="MTEKSKATAPAALHAYEPLTPDLVLDALASVGLAGDGRLMALSSY
FT                   ENRVYQVHLENTVGSDDLAGDIVVVKFYRPGRWSDAQIVEEHTFAAELMAAEIPVVGPL
FT                   VLEGATLHRFGGFSFSVSPSRGGRRPELDNLEVLEWIGRFLARIHTVGSAQPFVHRPAL
FT                   NLQTFGYASRDILLAGGAHGSHGSHGYLPLDMESRWRKAFEEAMLVAQTVFESVGDARS
FT                   LRLHGDCHPGNILWTPEGLPLAGPHFVDLDDARSGPAVQDLWMLLSGDRAQCTRQLGAL
FT                   VDGYEEFREFDRRELALIEPLRTLRLVHYSAWLAQRWHDPIFPINFPWFGSSDYWKGQV
FT                   DMLEEQTEAMQETPLMI"
FT   gene            complement(630451..630876)
FT                   /locus_tag="Bpro_0622"
FT   CDS_pept        complement(630451..630876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0622"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42581"
FT                   /db_xref="GOA:Q12FW1"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW1"
FT                   /protein_id="ABE42581.1"
FT                   /translation="MTKPEKIVYTAHASATGGREGQARSSDGLLDVKLVLPKEMGGAGG
FT                   GVNPEQLFAAGYSACFLGALKFVAGQEKITVPADATVEGAVGIGPIPTGFNIAVQLSVH
FT                   IPGMDHAAAQALVEKAHVVCPYSNATRGNIDVTLKVV"
FT   gene            complement(631146..631601)
FT                   /locus_tag="Bpro_0623"
FT   CDS_pept        complement(631146..631601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0623"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42582"
FT                   /db_xref="GOA:Q12FW0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FW0"
FT                   /protein_id="ABE42582.1"
FT                   /translation="MPNKTAPPSADAMLLLDNQLCFALYSTSLAMTRLYKPLLDELGLT
FT                   YPQYLTMLVLWEQDGLTVSELGQRLYLDSGTLTPLLKRLETSGFISRIRAVEDERRVHI
FT                   TLTAAGRKLKAQAAKIPGCILSASQCSIPELMALTQQMQALRQRLVA"
FT   gene            complement(631859..632263)
FT                   /locus_tag="Bpro_0624"
FT   CDS_pept        complement(631859..632263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0624"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42583"
FT                   /db_xref="GOA:Q12FV9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV9"
FT                   /protein_id="ABE42583.1"
FT                   /translation="MGNKLYVGNLPYTVRDEDLQQSFGAFGSITSAKVMMERDTGRSKG
FT                   FGFVEMGSDAEAQAAIAGMNGQSLGGRSITVNEARPMEARPPRTGGFGGGGGYGGGGDR
FT                   SGGGGYGGGGGGRSGGGGYGGGSGGGRGGY"
FT   gene            632552..633502
FT                   /locus_tag="Bpro_0625"
FT   CDS_pept        632552..633502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42584"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV8"
FT                   /protein_id="ABE42584.1"
FT                   /translation="MQIPSTARTAKPSKGTGKPAPAAQVIEELRPGQSIELLKELHILT
FT                   REGKLNQDTRRKLKQVYHLYQFIEPLLNEVSANNPAPTLADHGAGKSYLGFILYDLFFN
FT                   VAHQGRKDAGHIYGIETRTELVDKSRALAARLGFERMSFLNLSVQQATASADLPERIDI
FT                   VTALHACDTATDDAIAFGLAKQARHMVLVPCCQAEVAGVLRKSRALNLAKTPLAELWRH
FT                   PLHTREFGSQITNVLRCLQLEASGYQVTVTELVGWEHSMKNELILASRPATPSAAKTRA
FT                   AQARLQEVLQTLGLDELTARFAVTPVTPPDAAVSA"
FT   gene            complement(633523..634500)
FT                   /locus_tag="Bpro_0626"
FT   CDS_pept        complement(633523..634500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0626"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42585"
FT                   /db_xref="GOA:Q12FV7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV7"
FT                   /protein_id="ABE42585.1"
FT                   /translation="MIDERIKFRHLQCFLAVAQHGSLQKAAGVLSITQPAVSKTLKELE
FT                   ALLAVRLFERGRRGAVLTRSGDAFARHAGASVSALREAVASVAPTRPHGSEVVTLGVLP
FT                   TVAPQLIPALLLQLDAGNGASRPAGLADLAISLRIHTAPNPALLTQLRQRELDLVIGRF
FT                   AEPVHMVGLTFEHLYADPLVLAVRPDHPLLRDAALSSDALAHLPAFTAILPTLGTAIRH
FT                   TADSFLLTRGLGPLVRTVETLSVTGARNYTVRSDAVWFAPRGAVQQDLDSGLLAALPVS
FT                   MAGTEELVGMSLRADMAPTVAQAEVIGALRLLAAAHRGLDAAAG"
FT   gene            634602..635315
FT                   /locus_tag="Bpro_0627"
FT   CDS_pept        634602..635315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0627"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42586"
FT                   /db_xref="GOA:Q12FV6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV6"
FT                   /protein_id="ABE42586.1"
FT                   /translation="MSTELDSSYLAPRDWTGHPSHIYPYYKSTMLRGPKQPLVPIKQAL
FT                   AQLNAPVYGSDQLGPLDHDLTKNAVKNGEPLGERIIVTGRVSDEDGRPVRNTLVEVWQA
FT                   NAAGRYVHKVDQHHAPLDPNFLGAGRCMTDSDGRYTFMTIKPGAYPWGNHPNAWRPQHI
FT                   HFSLFGDYFASRLVTQMYFPGDPLFAYDPMYQGVPPDSRELMVAKFSLDVTQPDFALGY
FT                   VFDIVLRGPKATRFE"
FT   gene            635348..635938
FT                   /locus_tag="Bpro_0628"
FT   CDS_pept        635348..635938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0628"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42587"
FT                   /db_xref="GOA:Q12FV5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV5"
FT                   /protein_id="ABE42587.1"
FT                   /translation="MTQLKQTPSQTVGPYFAYGLTPTQYGYDLKSLFTPVLAQPHAQGE
FT                   HIRITGQVFDGAGQSVLDALVEISQPDASGQPVTSVADAQAKGFTGFGRCGTGTLADHH
FT                   FAFDTVKPGVAAPGQAPFINVCVTMRGLLVHTFSRIYFDDEAAANSKDAVLNSVPAERR
FT                   NTLIARRTMTGAGPVYRFDIHMQGDKETVFFDL"
FT   gene            636210..636944
FT                   /locus_tag="Bpro_0629"
FT   CDS_pept        636210..636944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42588"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV4"
FT                   /protein_id="ABE42588.1"
FT                   /translation="MNINSQEMQQVAAQEAPRLDLYAGIHKALRALMADTLLALGRTDT
FT                   DDALELAQASQRVMELLDFCASHLQHENDFIHAAMEARAPGASEVIAHEHEEHERHIGE
FT                   LGGLACALLKLEAKQRAGATLELYRQLALFIASNFQHMHVEETAHNAVLWSRYTDAELA
FT                   ELHAALVASIPPQEMMYVVRWLVPFMNPAERIAMMADMRAHAPAPAFAAALDTVRPHLS
FT                   GQEWAKLTRGLGLPAVPGLVQA"
FT   gene            complement(636960..638381)
FT                   /locus_tag="Bpro_0630"
FT   CDS_pept        complement(636960..638381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0630"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42589"
FT                   /db_xref="GOA:Q12FV3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV3"
FT                   /protein_id="ABE42589.1"
FT                   /translation="MNAAQSAQLSQLAQLAPEPCLADIRPCLEGAIPAVMATCAMDGTP
FT                   NVAYISQVFYVDERHVALSFQFFNKTRKNILANPYATVLVLHPVTAAFFRMHIRYLRTE
FT                   TEGPVFEGMKAQLAGIASHSGMAGVFRLQGSDIYEVQAIECIAGEPLPAAPPRASMLTG
FT                   LRRGSERLSRCTGLGELLNAALATLTDFVGIQHAMVLMLDPATQRLYTVASCGYATSGV
FT                   GSEIEMGQGVIGVAARERTPVRIVHMSSAYAYNRAIKTSLGASAPELMLETDIPYPGLA
FT                   EPHSQVAVPIVSVGRLLGVLFAESPNDLQFGFEEEDALVALAGHLGAAIDLMQAGPEAA
FT                   ELADAAPPAAAVNRQAEGPGAKAGGAALQLRRFTSNDSVFVNDSYLIKGVAGAIFWKLV
FT                   TDHVRQGRTEFSNRELRLDPAIHLPDVTDNLEARLLLLQRRLAERGPHIRIEKTGRGRF
FT                   RLAVQRPLVLADVAA"
FT   gene            complement(638378..638899)
FT                   /locus_tag="Bpro_0631"
FT   CDS_pept        complement(638378..638899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42590"
FT                   /db_xref="GOA:Q12FV2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV2"
FT                   /protein_id="ABE42590.1"
FT                   /translation="MNAAMPDTPAPLLPPELVTMMGKGVSVIVSACSLDMRPSIMRAVG
FT                   CTIAPRGHSITVYLSRQQSRQLIQDIASTGRIAVVFSEPSSHRTVQVKAARARIRCAEA
FT                   SDEPALECYVASMEEEIQRVGYAPVFTRAMLARRLDDLVAISFEPAQAFDQTPGPQAGA
FT                   PLPHGPGSPS"
FT   gene            complement(638939..639763)
FT                   /locus_tag="Bpro_0632"
FT   CDS_pept        complement(638939..639763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0632"
FT                   /product="ABC-2 type transporter, NodJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42591"
FT                   /db_xref="GOA:Q12FV1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005981"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV1"
FT                   /protein_id="ABE42591.1"
FT                   /translation="MSAVPHTPTRGQALFRPPQIGLRWLPVFRRNLLVWRKLAIPSLVG
FT                   NIAEPLITLVAFGYGLGALVGQVQLNGTTVPYILFLASGSICMSAMNAASFEALYSAFS
FT                   RMQVQRTWDGIMNAPVRLDDVVFAEMLWAAFKSLFTTSIILVVMLALGISHSPMLLLAW
FT                   PLLGLVGITFSSIALIFNALAKGYDFFTYYFTLFLTPTMFLSGVFFPRDQLPGVMRVIS
FT                   DWLPLTAAVELVRPLFLGQWPTQGLSHLALLVGYAVAGFWVALVLTRKRFRN"
FT   gene            complement(639763..640707)
FT                   /locus_tag="Bpro_0633"
FT   CDS_pept        complement(639763..640707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0633"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42592"
FT                   /db_xref="GOA:Q12FV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FV0"
FT                   /protein_id="ABE42592.1"
FT                   /translation="MSKPLFEVAGLSKHYGDAIVVNQLSFNIAPGECLGVIGPNGAGKT
FT                   TTIRMCLGLTAPDAGSVSYYSNGHAAGTLQMPQDALAIKARLGIVSQFDSLDPDFSCAE
FT                   NLLVFGRYFGLKDAVIRERIPRLLEFAALTHKANAKLSELSGGMKRRLSLARALVNDPQ
FT                   LLMLDEPTTGLDPQARHLMWERLQRLVQQGKSILLTTHFMDEAERLCNRLLVLDHGKKM
FT                   TEGTPRELIAQNLEPDVVEVYGNGALALADSPLKALAARTEVSGETVFFYTLDAKRLLN
FT                   ALTDFPQLRTLHRPANLEDLFLKLTGRQIREDA"
FT   gene            complement(640960..641784)
FT                   /locus_tag="Bpro_0634"
FT   CDS_pept        complement(640960..641784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0634"
FT                   /product="FAD-binding 9, siderophore-interacting"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42593"
FT                   /db_xref="GOA:Q12FU9"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU9"
FT                   /protein_id="ABE42593.1"
FT                   /translation="MSTTPTSPSTPAAPVSEAAPRKRRPPRRVQVTRVQTLSPLMRRIT
FT                   LQGAELEGFEVGDPASYMKLIFPEPGQTEPERPLPDGPKPKSMRTYTPLAVRADVHEVD
FT                   VDFVLHGDGPASTWVAQAQTGQVLFLMGPGPGYKLALDAPVHVLIGDDSALPAFETILA
FT                   SLPASAQAEVLVEVVDAAEERPLQSAAKVDARWVARGADNTRAGQALEAALRKAGAPAA
FT                   DARIYLACEAAAMRRIRQLLIEELGVERSRIVGRGYWKLGTVNHPDHDYGED"
FT   gene            642029..643237
FT                   /locus_tag="Bpro_0635"
FT   CDS_pept        642029..643237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0635"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42594"
FT                   /db_xref="GOA:Q12FU8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12FU8"
FT                   /protein_id="ABE42594.1"
FT                   /translation="MTTFGTPLSPHATKVMLLGSGELGKEVLIALQRLGVETIATDRYD
FT                   NAPGQQVAHHARTITMSDPAQLKSLIEKERPHLVVPEIEAIATAMLEELEAAGTVRVIP
FT                   TARAARLTMDREGIRRLAAETLGLPTSPYVFCDSLQELQAAIDTNIGYPCIVKPVMSSS
FT                   GKGQSKIAGPADVKTAWDYAMAGGRVSHGRVIVEGFIDFDYEITQLTVRALGADGQVET
FT                   HFCEPIGHIQVSGDYVESWQPHPMREAALQKSRAIAKAVTDDLGGQGLFGVELFVKGDE
FT                   VWFSEVSPRPHDTGMVTMCTQWQNEFELHARAILGLPVNTALKSSGASAVIYGGVDAKG
FT                   IVFDGVADALRVPNTDIRLFGKPESFVKRRMGVALAFDADVEVARANAKLAASRVKPRV
FT                   AKG"
FT   gene            643273..644367
FT                   /locus_tag="Bpro_0636"
FT   CDS_pept        643273..644367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0636"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42595"
FT                   /db_xref="GOA:Q12FU7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU7"
FT                   /protein_id="ABE42595.1"
FT                   /translation="MNLSELVAWMDDSSLRIVLAAGVSVVLALVVARIGAAIVLRVTRS
FT                   MPVLAKVAEQCRSPAQFLLPLIALQAVWHSAPDAFPLIGGIRHANGLLLLATLTWAGMR
FT                   AARGAALGVIGLHPVDVADNLNARRIHTQTRMLARTLMFVVLLAGLALMLMTFPGARQF
FT                   GASLLASAGVAGLVVGIAARPVFSNLIAGLQIALAQPIRIDDVLIVQGEWGRVEEITGA
FT                   YVVLKIWDERRMIVPLQWFIENPFQNWTRSSAQIIGTVLLWVDYRMPMEPLRHAALRAC
FT                   EAAPEWDKRLCLLQVVEAGEHSMQLRLLVTSANSSLNWDLRCKVREALVDFMQREYPQY
FT                   LPRMRAELAQAPQPGQNAAGGLAG"
FT   gene            644804..645736
FT                   /locus_tag="Bpro_0637"
FT   CDS_pept        644804..645736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0637"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42596"
FT                   /db_xref="GOA:Q12FU6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU6"
FT                   /protein_id="ABE42596.1"
FT                   /translation="MELRQLRYLVRVIELGSISRAALDMDLVQSALSQQISRLESELST
FT                   RLLQRSPKGVTPTEAGMAFFREAQLVLRHAEQAARAAQQSRLSGSVSVGMAPTTAAVLG
FT                   LPLLRAMRERYPDVRLHMVESLSGHLTTMLNARQLDLAMLFNTQAGRRWSVMPLLEEKL
FT                   FLIRSRRTLAGQPADRIRVAQLAGLPLILPTGTHGLRSTIESAFARAKCKPTLVAEIDS
FT                   LAMLMDAVDSGLGCTLQPWAAVSRFSDAAQRFHLAQITDTLARRVNSLCSLSDDELSPA
FT                   ALAARVVLADCATEAVRSGRWLGARLVDA"
FT   gene            645955..646947
FT                   /locus_tag="Bpro_0638"
FT   CDS_pept        645955..646947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0638"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42597"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU5"
FT                   /protein_id="ABE42597.1"
FT                   /translation="MMSPSISRRMLLQVAGLGASALALPHALGQSTWPSRPVRFVVPFA
FT                   PGGTSEIVARSVAAELSKQLGQSVYVENKPGGAGTVAMQEVAKSPADGHTIILGHVGTL
FT                   AVNPYMLKNQPYDVNKDFIPVTLLAKVPNVFVIHPDVPAKNFQEFVAYVKKNPGQLNYG
FT                   SAGNASAGHLAMEYLKLVTGMFITHIPYRGTGPQLTDLISGRTQASSAGLPALSAHIKS
FT                   GKLRAIAVGTAQRISGLPDVPTVAEMGFKNFETSQWYGILAPAGTPADVVRHLQEESLK
FT                   ALKSSAVTARFATDNAVGGGGPSSEFAAFIASEQKIWSDIVKRAGIHAD"
FT   sig_peptide     645955..646044
FT                   /locus_tag="Bpro_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.893 at
FT                   residue 30"
FT   gene            646937..648376
FT                   /locus_tag="Bpro_0639"
FT   CDS_pept        646937..648376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0639"
FT                   /product="Precorrin 3B synthase CobZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42598"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU4"
FT                   /protein_id="ABE42598.1"
FT                   /translation="MLIKRQRESQETLDVLVIGGGNAALCAALMAREAGASVLVLESAP
FT                   REWRGGNSSHTRNLRCMHESPQDVLTDAYPEEEYWQDLLKVTGGQTNEQLARLAIRESS
FT                   RCRDWMRRHGVRFQPSLSGTLHLSRTNAFFMGGGKALMNAYYRSAGRLGVQVRYDAPAD
FT                   RLELRDGRFVAAHCGAERIEARACVVASGGFESNREWLREAWGQNEAGEWPADNFAIRG
FT                   TRFNQGVLLRDLMAQGADTIGDPTQSHSVAIDARAPLYDGGICTRVDCVSLGVVVNKHA
FT                   QRFYDEGEDFWPKRYAIWGRLVAMQPGQLAYSVIDAKAVGRFMPPVFPGEKADSLEQLA
FT                   RQLGLEVQAFMRTVNDYNAACHVGSFDHAVLDDCHTEGLSPAKTHWARPLDTAPFYGYA
FT                   LKPGITFTYLGMKVNEQAAVHFGGQPSPNLFAAGEIMAGNVLGKGYTAGVGMTIGTAFG
FT                   RIAGTQAARAALNHGARHAAA"
FT   gene            648363..649550
FT                   /locus_tag="Bpro_0640"
FT   CDS_pept        648363..649550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0640"
FT                   /product="Citrate utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42599"
FT                   /db_xref="GOA:Q12FU3"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU3"
FT                   /protein_id="ABE42599.1"
FT                   /translation="MQQLEALTREACALAVGDLPLTPVEAEVGRQMQICNACRYCEGFC
FT                   AVFPAMTRRLEFGKADIHYLANLCHNCGACLHACQYAPPHEFAVNVPQAMAQVRAQTYA
FT                   DYAWPPALGALYKRNGLTLALALATGLALFLVLALVMKGTLLHEPLAGNFYAIFPHKLL
FT                   VSMFAPIFLFAALALGLGVRRFWRDVSPGDASGATAVDAMTREAAVEAATDALRLKYLD
FT                   GGHGEGCNETDDAFTLWRRRFHHLTFYGFMLCFAATCVATLYHYLLGLQAPYALNSLPV
FT                   LLGTVGGVGLLLGPAGLLWLNLRRHPMHGDGAQKPMDRGFIALLFLTSLTGLALLAWRD
FT                   TSAMALLLAVHLGAVMALFATLPYGKFAHGVYRCAALLKWATEKRLPTGLRLGED"
FT   gene            649752..650978
FT                   /locus_tag="Bpro_0641"
FT   CDS_pept        649752..650978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0641"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42600"
FT                   /db_xref="GOA:Q12FU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU2"
FT                   /protein_id="ABE42600.1"
FT                   /translation="MRDIVQPMTDAVPRHVLPVLVLAQFAGTSLWFAVNAVMPDLQREL
FT                   GWPASAVGTLTSSLQLGFIVGTLVFAVLAVADRFPARRVFLVCSLSGALCTVGAWWMVR
FT                   EFTALLVWRTATGFFLAGIYPVGMKIAAQWYTRGLGGALGLLIGALVLGSASAHALRGL
FT                   SGELPWPSVMLGVAALAATGGVLLYGLLPEPPAGPVRRSTLEWRALATLWTDWRVRSSV
FT                   LGYFGHMWELYTMWVLVPLILASRLNGAALSLAAFGVVGAGAIGCMGGGWVAQRVGSAR
FT                   VACGQLAVSGLCCLLAPWLFDAPAVWFALWLLVWGITVAGDSPQFSALTASNAPRQAVG
FT                   SVLTLTNSIGFAISIVSIELFTGLSQRHALASLLPWLGLGPVLGLLAMRPLLRRQPVPV
FT                   TETPPRQSS"
FT   gene            complement(650947..652443)
FT                   /locus_tag="Bpro_0642"
FT   CDS_pept        complement(650947..652443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0642"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42601"
FT                   /db_xref="GOA:Q12FU1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU1"
FT                   /protein_id="ABE42601.1"
FT                   /translation="MPYLPPFIAPTRYSDPAAALAQVCAIYDQQIAHLRDAMQRYVAGE
FT                   TLPGHVRACYPFVRVHTDTVARTPAAPDSARLSYGFVAGPGRFETTLTRPDLYGDYYLE
FT                   QFRLLLQNHRVELEIGTSTQPIPVHFSFAEHDHIEGNLSVARRMLMRDVFDLPDLAAMD
FT                   DGIANGTHEPKPGEPQPLSLFTAARVDYSLQRLRHYTGTSPDWFQNFVLFTNYQFYIDE
FT                   FVRLGHEEMAKPDSEYIAFVEPGNVVTRRTGLPVEAGDALGTPPPRLPQMPGYHLMRAD
FT                   RSGITMVNIGVGPANAKTITDHIAVLRPHTWIMLGHCAGLRNSQQLGDYVLAHGYVRED
FT                   HVLDEELPLWVPIPALAEIQVALERAVADVTQVKGSALKSIMRTGTVASTDNRNWELLP
FT                   ANQPQRRFSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEIKLPGMANHFY
FT                   RERVDQHLRIGIRAVELLRGEGIDQLHSRKLRSFAEVAFQ"
FT   gene            complement(652495..653874)
FT                   /locus_tag="Bpro_0643"
FT   CDS_pept        complement(652495..653874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0643"
FT                   /product="NADPH-glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42602"
FT                   /db_xref="GOA:Q12FU0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FU0"
FT                   /protein_id="ABE42602.1"
FT                   /translation="MQTFDFDLFVIGGGSGGVRAARMSAQRGARVALAEVAAMGGTCVN
FT                   VGCIPKKLYSYAAHYGDSFEESHGFGWVGEAPTFDWDLLKANRAREISRLNGVYVQLLT
FT                   SAEVTIIEGWARLLDAHTVEVDGRRFTAKNVLVSTGGTPTVPAITGREHVVTSDQMFDL
FT                   SPFPKRLLVVGGGYIACEFASIFNGLGSQVTQVHRRDKLLTGFDDDVRRFIAGEMSKTG
FT                   INLQLGTHISAITKTDDGLQVEVKDSQDKPASFLVDSVLYATGRVPNASGIGLETVGVA
FT                   VNRVGAIQVNAQYQTSVPSIYALGDVTARLQLTPVALGEAMVVVDHLFGPTDGKKPRGM
FT                   SYDFVPTAVFTHPNIGTVGYSEADAREQFGAIRVYRTDFKALKHTLSGSTERTLMKLLV
FT                   EDATDRVVGLHMVGPDAGEIVQGFAVAMKAGATKAVFDSTIGIHPTAAEEFVTMREPVK
FT                   A"
FT   gene            complement(653897..654787)
FT                   /locus_tag="Bpro_0644"
FT   CDS_pept        complement(653897..654787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0644"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42603"
FT                   /db_xref="GOA:Q12FT9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT9"
FT                   /protein_id="ABE42603.1"
FT                   /translation="MDKLRAMQAFIHIAEEGSLTAAARVMESSLPAMVRTLAGFEAQLG
FT                   VRLFNRTTRRISLTEEGRRHLESCRQLLAALDDAEAALTAEAGEPTGHLTITAPVLFGQ
FT                   MHVAPAVTRFVQQYEKMRCSMVLLDRVVNLLEEGIDVGIRIGEPEDSTLVAQTVGHIRR
FT                   LVVASPDWLKRHGTPRHPKDLLKANCVRVTEHALTWGPFNDQGRPLRLAVSGNLEFNQN
FT                   APAVAACVAGAGLGMFLSYQVAPFLQSKQLCTVLEDFEPAVRPINVVYPHARLLPMRTR
FT                   VFIEWIKKELKDFQS"
FT   gene            654938..655615
FT                   /locus_tag="Bpro_0645"
FT   CDS_pept        654938..655615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0645"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42604"
FT                   /db_xref="GOA:Q12FT8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT8"
FT                   /protein_id="ABE42604.1"
FT                   /translation="MNAVAASTPNASLKALPAQPIKLYRVAISGHAHRVELFLSLLGLP
FT                   FERVEIDLAAKAHKTPEFLAMNAFGQVPVIQDGDVTLADSNAILVYLARRYAQDADAWM
FT                   PTEPVAAAAVQRWLSVAAGPLAFGPAAARVIQLFKRPDSPDAAIARAHALFAVMEQQLG
FT                   QSAFLAGNTPTLADIANYSYTAHAPEGNVSLEPYPRLRAWLARIEALPRFVPMVKTPTG
FT                   LAA"
FT   gene            655612..656562
FT                   /locus_tag="Bpro_0646"
FT   CDS_pept        655612..656562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0646"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42605"
FT                   /db_xref="GOA:Q12FT7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT7"
FT                   /protein_id="ABE42605.1"
FT                   /translation="MSVSAFHEGERAVQARVGVQERMAQLGPRVIRDFMPDQHREFFGQ
FT                   LPFVIAGTADASGQPWASVLAAPPGFIHSPHPQRLVLQAQPLPGDPLQDTLAEGAAIGL
FT                   LGMEPHTRRRNRMNGVVQGLGAAGFSVQVSQSFGNCPKYIQAREPVYDAGLAPVPPVVH
FT                   QAGQLDDAARAMIAAADTLFIATAYMGDGDDAGRAGGVDVSHRGGKPGFVRVGADGTLT
FT                   VPDFMGNFFFNTLGNIAVNPRAGLLFIDFDNGDLLYLAVTADIIWDGPEVQAFAEAQRL
FT                   LRFKVGSMRLVKGSLPLRWGEAELSPVLETTGTWA"
FT   gene            complement(656583..657506)
FT                   /locus_tag="Bpro_0647"
FT   CDS_pept        complement(656583..657506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0647"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42606"
FT                   /db_xref="GOA:Q12FT6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT6"
FT                   /protein_id="ABE42606.1"
FT                   /translation="MLNSSSSSALRAMSLDAIRGFEAAARHLSFTAAAEELFITQSAVS
FT                   KQVKSLEDALGAALFLRGGKGLSLTPEGRQLYEAARASLAQLASAVDRLLAVDRVSVSI
FT                   TTTPSFAALWLAPKLAKFQLLEPAIDVRVDASEAKVNLEREGIDLAVRLSPPPPGGEGP
FT                   PPLLQEQALLVAAPAVAARISAVADILHTPLLVYYDPATRFSWMSWTAWYERLELKQST
FT                   QQPCLYFSQYEHVLTAAVQGAGIAIGRTPLVLPLLGSGQLKVVLPGQTVEGMAYRIVTS
FT                   AHSADRPAVQKFRAWLERELALEAIG"
FT   gene            657602..657880
FT                   /locus_tag="Bpro_0648"
FT   CDS_pept        657602..657880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42607"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT5"
FT                   /protein_id="ABE42607.1"
FT                   /translation="MHALQTPLKLGPIPKPLRLRRGQALTCTEGCLWITSDALAGRGRD
FT                   SDVVLESGQSFVTPQAATYFVGAPRGCGVLSFLSPDTPARNPLEATC"
FT   gene            657874..658659
FT                   /locus_tag="Bpro_0649"
FT   CDS_pept        657874..658659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0649"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42608"
FT                   /db_xref="GOA:Q12FT4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT4"
FT                   /protein_id="ABE42608.1"
FT                   /translation="MLIEAERRGQHVVLTLNRPEKLNALSYELIDELMDRLDALERDES
FT                   VRCLVLTGRGDKAFSAGADIAGFAPDVAASPETAARRFVARGQAMTRRVENYPKPIIAA
FT                   VNGIAFGGGCETMEACSLAIAAEHATFAKPEIRLGFPPPFGGTQRLPRHIGRKRANEMI
FT                   LTGEAISAEEALLIGLINHVVPASDLLPACLRMADLIAANSAVAVTASLRAVTRGLNVS
FT                   IDEGLAIEAAQFMIAAASPDAKEGTAAFVEKRQPVFCHR"
FT   gene            658752..660158
FT                   /locus_tag="Bpro_0650"
FT   CDS_pept        658752..660158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0650"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42609"
FT                   /db_xref="GOA:Q12FT3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT3"
FT                   /protein_id="ABE42609.1"
FT                   /translation="MTSSSSDFSALSLPAHVLANLQQLGYLSMTPIQAASLPVALLGKD
FT                   LIAQAKTGSGKTAAFGLALLANLNARRFAVQAMVLCPTRELADQVATEIRRLARAEENI
FT                   KVVTLCGGVPLRNQVSSLQNGAHIVVGTPGRIMDHLERETLDVDALNTLVLDEADRMLD
FT                   MGFYNDIATVAKQCPDERQTLLFSATYPEGIAKLSQQFMKEPQTITVQAQHEKSKIRQR
FT                   WYEVPESDRDEARLNAVALLLNHYRPASTLAFCNTKSQCRALVAYLKNKGFSALALYGE
FT                   LEQRERDQVLVQFSNRSCSVLVATDVAARGLDISQLEMVINVDVTPDAEVHIHRIGRTG
FT                   RADEEGWAISLASMDEMGSVGKIEQLQNAESEWHKLTELTPTSTEPLLPPMVTLQIVGG
FT                   RKEKIRAGDVLGALTGEAGFTREQVGKINVNEFSTYVAVDRAIASQAQQKLASGRVKGK
FT                   SVKVRFMDET"
FT   gene            660585..661217
FT                   /locus_tag="Bpro_0651"
FT   CDS_pept        660585..661217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42610"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT2"
FT                   /protein_id="ABE42610.1"
FT                   /translation="MKAAVKAILTGEDQARLLDLLAHMNGSLRKCYVLSLSSNSSSTYL
FT                   ANTYGPSNLELRENFPIDLTYSARHCVPDGDGFLLHHFSQLYEAVEGYVVYDEDEQLRI
FT                   AGKAIAAVQELAHANADVGDLFHMRQLLIACITLFKQKHYEQEEEYRIVLHRLGEIEVP
FT                   DFDEQRVTNGRTISYIRAQVPWFERDCVVAVHAATSNAHHPVISADQ"
FT   gene            complement(661450..663573)
FT                   /locus_tag="Bpro_0652"
FT   CDS_pept        complement(661450..663573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0652"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42611"
FT                   /db_xref="GOA:Q12FT1"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT1"
FT                   /protein_id="ABE42611.1"
FT                   /translation="MLYKKNFNAAFFAAAYATLSLSLLVPAAAQNTSSNGNGSNGDNLI
FT                   LEMNKAFRRSDKGRLAQMLPQARGHALEPWAAYWELKTRLGEASAQEVQDFLARYAGTY
FT                   QEDRLRNDWLLLLGQRRDWAAFAAEYPNYRMNDDREVRCYALLVEHLKNPALDARLSDE
FT                   VRKNWYAQRDADDGCTAAADRLVGAQNLTTQDVWQKARIATEANRPRAAAGAVQIIAPE
FT                   AMDLLTELNSSPIRFLAGKHLALRKVRKEIITLALIKMATTDVEGAAFQLESKWAVQLN
FT                   AEERNWVWGVIGKQAATRLGTVPGSDALQYFARVNNDSDLTDDMLAWKARAALRAGTQA
FT                   QWPQVLAAINAMSEEARKDPAWSYWKARALLATAPPNIPTAVSTPQGVTQTISIAPQRA
FT                   EALAMLQALASPRGFYEQLALEELGQKITVPAQPAPLTAAEKEAARLNPGLNRAAYAIT
FT                   IGLRPEGVREWNYSTNLHKRNGEGERAGMGDRELLAAAQFACDRQIWDRCINTSERTRT
FT                   ETDFDQRFPVPFREAVVKRSREVGLDPAYVYGLIRQESRFIMDARSGPGASGLMQIMPA
FT                   TARETARRIGLAGFTPDQINDRDTNITIGTGYLKLALDAFEGSMAMAAAAYNAGPGRPR
FT                   VWRGQPGSPVLDAAIWAENVPFGETRDYVKKVLSNTTNYAAILTGQPQSLKARLGMVGP
FT                   RDASLPEVNKDLP"
FT   sig_peptide     complement(663484..663573)
FT                   /locus_tag="Bpro_0652"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.929 at
FT                   residue 30"
FT   gene            663583..664221
FT                   /locus_tag="Bpro_0653"
FT   CDS_pept        663583..664221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0653"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42612"
FT                   /db_xref="GOA:Q12FT0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FT0"
FT                   /protein_id="ABE42612.1"
FT                   /translation="MDKLSTRKALVQARLDMPDRLQRADLLQRVMRIWLVGSPHEVIGA
FT                   YWPIKGEFDPLPALYRWQEDAILSRDSQSNQGSDLEEPAQIATESIASRSPRKIGLPVV
FT                   NKLHKTLTFHAWYPGCPMEEDAYGIPKPKDTEVIVPTLLFVPCVGYGPGGYRLGYGGGF
FT                   YDRTLATLQPRPVTVGLGFTNGWLPDMEPEAHDIPLDAILNDNGVVWPV"
FT   gene            664825..665811
FT                   /locus_tag="Bpro_0654"
FT   CDS_pept        664825..665811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0654"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42613"
FT                   /db_xref="GOA:Q127P2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q127P2"
FT                   /protein_id="ABE42613.1"
FT                   /translation="MSATSEQIFIGIDVSKATLDLAVRGQAKAQQFVNTDAGVGALIDS
FT                   LATRKDSVAVVLMEATGGLERLAATALCLAGYAVMVVNPRQAHDFAKALGFLSKTDKSD
FT                   AQALAQFAHTLYSSDKRDKLLLKLPTVQQDMLAAMVTRRSQLVVMRVAEGNRLASSHPT
FT                   QKKSIQAVLKVIDRQVKELDADIAGSLGKHFKEKLDLLKGMKGVGISTQAALMASLPEL
FT                   GSLSAREIGKLVGVAPLNCDSGTMKGKRVTWGGRADMRSALYMASLSAVRHDPLIKAFY
FT                   QRLRAAGKPAKVALVACMHKLLTIMNAIIKSGKPWQAGYGCPQAGDA"
FT   gene            complement(666170..666562)
FT                   /locus_tag="Bpro_0655"
FT   CDS_pept        complement(666170..666562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0655"
FT                   /product="YjgF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42614"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS8"
FT                   /protein_id="ABE42614.1"
FT                   /translation="MSALEYFGNPPMASDHQPRPFSPAVRAGDFVYVSGQVPADEKGEI
FT                   VQGGIEVQTRQVMKNLSAALALAGCTLDDVCKTTVWLQDARDFGSFNRVYMSYFGDKKP
FT                   ARSTTEARLMVDARVEIDVVAYKPRG"
FT   gene            666788..668353
FT                   /locus_tag="Bpro_0656"
FT   CDS_pept        666788..668353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0656"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42615"
FT                   /db_xref="GOA:Q12FS7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS7"
FT                   /protein_id="ABE42615.1"
FT                   /translation="MLQKFWISRRKAVALALVVGGSALLPMGMGAQAQALSKAPLNLAM
FT                   IAEPQTLDPMASTADLVGTIMQHVYEPLYTFDANWKMVPMLAESLPKVSADGKRYSITL
FT                   RKGVQLHNGRELNADDVVASLKRWMDVSPRGKALSKEIADLSANGSHGVEITLKAPYAP
FT                   LLPQLAMPSGMAAIMAKESIATPLKEYVGTGPYKFKERRPDQYVLLTRFDQYSARKEAP
FT                   SGYGGKKTAIADELRFIPVPNANTRVEGSLAGQYHFADLLPTEALNRLEKSAGKTVPIL
FT                   TPSFGFPYFVFNTKEGVMASLPVRKAVQTSFGEGEMLAAGFGDTRFFVAEPNHFPKGTP
FT                   FYSAAGSASYNERDAAKAKGQAAQAGYKGETIRILTSRQYDFHYNMALIMAEQLKRAGF
FT                   KAELNVVDWATLVQRRNDAKLWDIYITHSGQFPEPMLSPPQLGDGAPGWWSSPAKQAAL
FT                   AALNQETNPAKRGALWGAVQQVVYDEVPYINVGKFNSLSAKSPALQGYVPSTWPFFWNT
FT                   GLKN"
FT   sig_peptide     666788..666889
FT                   /locus_tag="Bpro_0656"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.830 at
FT                   residue 34"
FT   gene            668626..669567
FT                   /locus_tag="Bpro_0657"
FT   CDS_pept        668626..669567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0657"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42616"
FT                   /db_xref="GOA:Q12FS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS6"
FT                   /protein_id="ABE42616.1"
FT                   /translation="MTRYLLSRIMGMLVVMALVAVLVFVLTRAASGDPVTVLLGDQATA
FT                   EDIARVQKEYGLDKPLPVQFGYWLKELSQGNLGQSIFLQRPVTQALWERAEPTTLLALL
FT                   SLFIAAAIGVPCGIVSAVFRGKFIDQLLTGFAMLGASIPSFWFGLVLMQIFAVSMGWFP
FT                   VSGYGDPGATLMARIHYLVLPSVVLGVLNSALIIRFTRASMLDVLGEDYVRTARAKGLS
FT                   EKVVVLKHALRNALVPIVTVLGLTVALLIGGAVVTETVFGLPGVGNLVVSAVLRRDYPV
FT                   IQGALLVVSMIYVVINFLTDLLYMVVDPRVKY"
FT   sig_peptide     668626..668724
FT                   /locus_tag="Bpro_0657"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.606 at
FT                   residue 33"
FT   gene            669573..670412
FT                   /locus_tag="Bpro_0658"
FT   CDS_pept        669573..670412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0658"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42617"
FT                   /db_xref="GOA:Q12FS5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS5"
FT                   /protein_id="ABE42617.1"
FT                   /translation="MKIPLTLKKLFRRRIVLAAGICLLVVVAVALLANVITGYDPNETA
FT                   VRERLSVPTVSHLMGTDELGRDLFARIAFGGRYSLTIAALTAMGAIVFGTLFGLVAGFF
FT                   RRLDAPIMRVVDAMMSLPDILLAIALVAILGPSMLNVVLALVLVYSPRVARVVRASTLV
FT                   VRELLFVEAARAVGVSTPRILWRHILPNLMSPILVQASFIFAYAILAEAALSFLGVGVP
FT                   PEIPTWGTMVAGSQQYAHEALWIVLFPGLAIILTALSLQLLGDGVRDLLDPRLKKSL"
FT   sig_peptide     669573..669674
FT                   /locus_tag="Bpro_0658"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.885 at
FT                   residue 34"
FT   gene            670433..671527
FT                   /locus_tag="Bpro_0659"
FT   CDS_pept        670433..671527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0659"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42618"
FT                   /db_xref="GOA:Q12FS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS4"
FT                   /protein_id="ABE42618.1"
FT                   /translation="MNSPITSSNAPSTASITPRLDVRHLSTFFDTDEGLIRSVADVSFS
FT                   IRPGKTTALVGESGSGKSVTSLTLMRLLSRTAATQVSGQALFTNRAGETLDLLALPEPA
FT                   MRRIRGNEIAMIFQEPMTSLNPVFTVGEQIAESVRLHMGLDRSAALAHALRMLELVEIP
FT                   AAAQRLHEYPHQLSGGMRQRVMIALAMACNPTLLIADEPTTALDVTIQAQILELMRRLQ
FT                   AETGMSILFITHNLGVVAHHADDVAVMYAGRIVESAPVRELFALPRHPYTQGLLACLPA
FT                   QQRKRELAAGEVGSRRRLYAIRGQVSSPLAPPPGCAFEPRCDHALAACREAMPALESAG
FT                   PHRSARCILVREPATVPTLPVETA"
FT   gene            671524..672504
FT                   /locus_tag="Bpro_0660"
FT   CDS_pept        671524..672504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0660"
FT                   /product="Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42619"
FT                   /db_xref="GOA:Q12FS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS3"
FT                   /protein_id="ABE42619.1"
FT                   /translation="MSAPLIEVKNLHRYFGAPAKPVRAVDDVSFTIQPGETLGLVGESG
FT                   SGKSTIGRTLLRLIESTSGQVLYRGEDLGAASSSRMRTLRSKLQMIFQDPYASLNPKMR
FT                   VKDILGEALQVHGLAKGKAARERRIAELLALVGLRAEHADRYPHEFSGGQRQRIGVARA
FT                   LAVEPEFIVADEPLSALDVSIQAQVVNLLCDLRDRLSLTMLFISHDLDVVEYLCDRVVV
FT                   LYLGRVMEVAPTAELFARPLHPYTQALLAASPKPDPEHKSERVALKGDIPSPVNPPSGC
FT                   VFRTRCPHAIEACAGARPELRDMGQGRFKACIRDDIVINASLMAA"
FT   gene            672521..673819
FT                   /locus_tag="Bpro_0661"
FT   CDS_pept        672521..673819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0661"
FT                   /product="D-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42620"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS2"
FT                   /protein_id="ABE42620.1"
FT                   /translation="MTTLQDILDPQIDRSFKGFPHTSPALRRSQIAAQHWRVLDGDLPL
FT                   PVALVKQQALQHNLSWMQRFATDRGIDMAPHGKTTMSPQLLKRQLDAGAWGLTFATVAQ
FT                   LRAGVLAGARRCMIANQVFTAADLAGIQDMQREYAGLRIAFLVDSAAQLELIEAWHASQ
FT                   QDAQTPVRPFEVLLEIGVEGGRTGCRNQHDALTLAQRVHASPACRLVGIECYEGLGATG
FT                   QSDPDEAYAGALMQRVCDIAIACDQQHFFDNEEVLVSAGGSAIFDLVANRLKPELSQPV
FT                   RGLLRSGCYVTHDHGFYKRMVSTVNSRLGCGDGLQAALEVWAAVQSCPEPGLAILAVGK
FT                   RDISYDLDLPVPLGFCKPGDRGVTGAPADWKIGGLNDQHAYLRGTGPEHAALKVGDLVA
FT                   LGISHPCTTFDKWRWMPVVDENYTVCDALVTCF"
FT   gene            673873..674784
FT                   /locus_tag="Bpro_0662"
FT   CDS_pept        673873..674784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0662"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42621"
FT                   /db_xref="GOA:Q12FS1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS1"
FT                   /protein_id="ABE42621.1"
FT                   /translation="MTSKVLAKIAEVIAIAPTSRRKVLALILQDPQRVLDESFEQLAQR
FT                   AGSSVPTVMRTCRDLGYPGLREFKLALAQEMAVSGSPLHRRVQLHDDAEEVISKVIKGA
FT                   ATAVSGVQAQLSVAAVEAAADAIVRASRVDCYSVGVTSSFMASDMQARLFRLGLVSNAY
FT                   LDIHLQLVSAATIGKQGVVFAISHVGGMPSLLEAVDVARSQGATVIALTQQGTALAERA
FT                   DIVLGIHVPEDPVMHVGTEAYLVHLTVIEIVTVLVAQRLGDLAVKRLGGVRDVLSTRGV
FT                   DMRHYPRLDWDTVTAVKESKLK"
FT   gene            674781..676262
FT                   /locus_tag="Bpro_0663"
FT   CDS_pept        674781..676262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0663"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42622"
FT                   /db_xref="GOA:Q12FS0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FS0"
FT                   /protein_id="ABE42622.1"
FT                   /translation="MTRATLLESGLVIDGTGAEGWIGDVLLMDGRIAALGKNLSDQLPE
FT                   GLKPEEVARIDCTGLAIAPGFIDVHTHDDAIVLKQPDMLPKVSQGITTVITGNCGISLL
FT                   PFIVDNPEPPLNLLGADSFRFDSVQSYERAIIQAQPAVNVAVLIGHTTLRFACMGDLTR
FT                   AASASELDAMCALLTQCMESGATGMSSGLFYEPAFAAPAQEVVRLAQVVSRFGGVYSTH
FT                   LRDEMATIVEALHEAGDTAFSAGVPLIVSHHKCAGPANWGRTQQTLPLIESLARRQPVA
FT                   MDVYPYVAGSTVLREDLVDGVIDVLVSWSTPHPEMTGRTLASIAAEWGVDQKAVCRRLQ
FT                   PGGACYFQMHEDDVRRVVAHPLTMIGSDGLPHDQHPHPRLWGAFPRVLARYWREEKLFS
FT                   LETAIYKMTGLSARNFRLHQRGQLQPGWHADVVVLDPARVRDVATYENPIALSEGIEKV
FT                   FVNGELAYVAGSADAANAKVQARAGRLLKRHVTQP"
FT   gene            complement(676470..677447)
FT                   /locus_tag="Bpro_0664"
FT   CDS_pept        complement(676470..677447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0664"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42623"
FT                   /db_xref="GOA:Q12FR9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR9"
FT                   /protein_id="ABE42623.1"
FT                   /translation="MLHSQTHLRSRPISAGQLRAFEAVARHLNFRAASEELALTQSAVS
FT                   RQIQALEEDVGVSLFHRHTRAVELTGAGGTLLRAVTPSLERIDGAVRQIRQSAGRKSVA
FT                   LTTFASFASMWLIPRLEVFQRENPDIDIRIDASDVAVDLDVSDLDLALRYAPASHMPPH
FT                   AIRLFGEQITPVISPWLLKSGPRLKKPDDLAHFTLIEAGDAHRTHFEWLTWRRWMDQHA
FT                   TPKLEAKRWLYFNYAYQMVQAALTGQGVVLARLPLIAESLASGDLVEPLPHLRMESPMA
FT                   YWLIIGPRNVARPEVLAFCEWLKAQGAQTRKAIGDVPDADTVEK"
FT   gene            complement(677981..678496)
FT                   /locus_tag="Bpro_0665"
FT   CDS_pept        complement(677981..678496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0665"
FT                   /product="TfoX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42624"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR8"
FT                   /protein_id="ABE42624.1"
FT                   /translation="MATPKDDFAIYCCELLSGVGPCVARRMFGGYGISTSGLTLALVAD
FT                   LGGGEKLWLKADADTRGRFEAAGCERFTYDITRNGERLAHSLNYYSAPEEAMESAQLML
FT                   QWARVSLDCALKARSAKSPRARVARKTTAKPVSATSTAAATPPARPRASRPTAPPTRPS
FT                   ARRKSSRG"
FT   gene            678707..679696
FT                   /locus_tag="Bpro_0666"
FT   CDS_pept        678707..679696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0666"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42625"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR7"
FT                   /protein_id="ABE42625.1"
FT                   /translation="MSKAFASQSDLTDKTITFEQLSAHCWAYTAEGDPNSGVIIGDKFI
FT                   MVSDATATPAMAQDLIARIRTISDKPIKYVLLTHYHAVRVLGASAYFAEGATEVIASQG
FT                   TCELIAERGAQDMQSEMERFPRLFRNAESVPGLTWPTLVIAGGNPAKGEVPGRLVLDLG
FT                   GVKVQIWHPGPGHTRGDTIAWVEEEKVLFSGDLVEYEAGVYTGDAQLEEWPATLEALRA
FT                   LKAEAIVPGRGEAMKGAANVNKALDYTRRWVETLYQAGKEAAAAGMDLKAAMDHTRRSM
FT                   DPVFGHVFIYEHCLPFDVSRAFDEASGIKNPRIWTAERDREMWAALQG"
FT   gene            complement(679750..680157)
FT                   /locus_tag="Bpro_0667"
FT   CDS_pept        complement(679750..680157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0667"
FT                   /product="Sensors of blue-light using FAD"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42626"
FT                   /db_xref="GOA:Q12FR6"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR6"
FT                   /protein_id="ABE42626.1"
FT                   /translation="MMQKPAPLHEVLFVSTIAPEAPISIVAQIAGKARIANKARDITGL
FT                   LIFDGIRFCEQLEGLEEDTLALLERIRQDPRHTSIKLLHHGPLSERRFKSFSMGYAPVE
FT                   DVEVLGRLEQLEGQAAVDAFVEILSTLDLDS"
FT   gene            680235..680507
FT                   /pseudo
FT                   /locus_tag="Bpro_0668"
FT   gene            680539..680823
FT                   /locus_tag="Bpro_0669"
FT   CDS_pept        680539..680823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42627"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR5"
FT                   /protein_id="ABE42627.1"
FT                   /translation="MVDDNLLTAGRRNATERVAMLLMHLYRRLDRIGLAQGGCACSTPG
FT                   RWSALQITTTRRPVKYRCCRRGLAARAKVDADVKSDAKAARRATPEEAA"
FT   gene            complement(680905..681747)
FT                   /locus_tag="Bpro_0670"
FT   CDS_pept        complement(680905..681747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42628"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR4"
FT                   /protein_id="ABE42628.1"
FT                   /translation="MLALACLLPACSALKIFYNQAPDFAYWYLDGYIDFTGAQSLQVKD
FT                   DLGKLQAWHRQTQLPAYIDTLRKLRQRMPADMDAAQACAVFADVRSKLVAVSHRAEPVA
FT                   VALVGTLQTSQLTQLERQWAKGNADYRDTFLDGPPQKGRDKRYKQAVSRAERLYGTLEE
FT                   KQLAVIGQRIDQSRFDAALFYAEKLRRQQDVLQTLRVLVAERPSAEKTRLAVRGLLERW
FT                   LHSPIPAHRDHLEGLTREGCQTFAALHNSTTPAQRAQAVETLDAYEQDLRALSSVQKS"
FT   gene            681833..683275
FT                   /locus_tag="Bpro_0671"
FT   CDS_pept        681833..683275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0671"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42629"
FT                   /db_xref="GOA:Q12FR3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12FR3"
FT                   /protein_id="ABE42629.1"
FT                   /translation="MATPIDVVIMAAGKGTRMKSALPKVLHQLGGRALLAHVIDCAARL
FT                   SARQAVVIAGHGAADVEAACAHLTRAAGDARQDLSLKFARQEPQLGTGHAVQQALPLLA
FT                   DDGVTLVLSGDVPLTQPATLRALLEQCDGQRLALLTLNMADPTGYGRIVRAGTQATAQA
FT                   SSQVRAIVEHKDATEAQRGIHEIYSGIMAVPTRLLRGWIHRLDNKNVQSEYYLTDIVKF
FT                   AVADGVAVVAHQITDAAQVAGVNSPVQLAELERVYQLRQATALMEQGVRLADPARFDVR
FT                   GTLQCGQDVEIDVNCVFAGQVSLGEGVRIGANCVIANATIAAGAVIHPFTHIDGEKLGV
FT                   QVGEGALIGPFARLRPGAQLGAEVHIGNFVEVKNSTLAKGAKANHLAYLGDATVGERVN
FT                   YGAGSITANYDGANKHRTVIEADVHIGSNCVLVAPVTIGQGGTVGGGSTITKDTPPGAL
FT                   SVARGKQVSLPNWKRPVKVSKG"
FT   gene            complement(684003..684980)
FT                   /locus_tag="Bpro_0672"
FT   CDS_pept        complement(684003..684980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0672"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42630"
FT                   /db_xref="GOA:Q12FR2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR2"
FT                   /protein_id="ABE42630.1"
FT                   /translation="MTTATTPPTVASTAAAIAQPAATSGAVPAGTRLLGIYLRLTCVPI
FT                   LWGGTFIAGRVISAHLPPATAGFVRFVFATLALLVALHFTQGLRAITQVTRGQLLGTLA
FT                   LGATGIFIYNLLFFTALSVLPAGRTSLIIALNPVVTLLLAAALLGDRLSAVRWLGVGLA
FT                   LLGVWVVVTRGDLSQIMQSLGKGELSMFGAVCAWAVYTLLGRKLLQSLSPLLATLWAAI
FT                   WGTLLLGLLALRDISSVHAGSFTPEVWAGLVFLGVLGTAVAFVWYYEGIRQLGAARTVV
FT                   FNNLVPVFGVLLGWLILGEPLSASLLAGGGLAIFGVFLVNRVKE"
FT   sig_peptide     complement(684903..684980)
FT                   /locus_tag="Bpro_0672"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.310 at
FT                   residue 26"
FT   gene            685083..685952
FT                   /locus_tag="Bpro_0673"
FT   CDS_pept        685083..685952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0673"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42631"
FT                   /db_xref="GOA:Q12FR1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR1"
FT                   /protein_id="ABE42631.1"
FT                   /translation="MTLAQLEVLITLDECRSFSRAAMRLGTTQSAVSHALRALETQFGV
FT                   KLAQRDASGVAMTDAGERLLLRAREMTALAATMTQELGDARELKTGTLRIGSFGPTSTV
FT                   NLLPPLLAAFKKRHPGAQVRIEEESDEVVDDWLLQKRVELGFVVVPDERFEVQPLVQDE
FT                   FVAILPTGHPLAKHKAVPISALTGLDFVLTEAGCGPVIVPILQKNIALPKVLYHFTQVI
FT                   SILQFVQRGLAVSVAARLALPDAPKGVVYRPLLPAQPRTVGLACLDAARLSPLARAFWD
FT                   LAKAQTKA"
FT   gene            complement(686188..686685)
FT                   /locus_tag="Bpro_0674"
FT   CDS_pept        complement(686188..686685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bpro_0674"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bpro_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABE42632"
FT                   /db_xref="GOA:Q12FR0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q12FR0"
FT                   /protein_id="ABE42632.1"
FT