(data stored in ACNUC1104 zone)

EMBL: CP000319

ID   CP000319; SV 1; circular; genomic DNA; STD; PRO; 4406967 BP.
XX
AC   CP000319; AAIS01000000-AAIS01000015;
XX
PR   Project:PRJNA13473;
XX
DT   14-APR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Nitrobacter hamburgensis X14, complete genome.
XX
KW   .
XX
OS   Nitrobacter hamburgensis X14
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Nitrobacter.
XX
RN   [1]
RP   1-4406967
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Ivanova N., Ward B., Arp D., Klotz M., Stein L.,
RA   O'Mullan G., Starkenburg S., Sayavedra L., Poret-Peterson A.T.,
RA   Gentry M.E., Bruce D., Richardson P.;
RT   "Complete sequence of chromosome of Nitrobacter hamburgensis X14";
RL   Unpublished.
XX
RN   [2]
RP   1-4406967
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Ivanova N., Ward B., Arp D., Klotz M., Stein L., O'Mullan G.,
RA   Starkenburg S., Sayavedra L., Poret-Peterson A.T., Gentry M.E.,
RA   Richardson P.;
RT   ;
RL   Submitted (28-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; bc34511d7df0caf7003ea7b0b70cffd2.
DR   BioSample; SAMN02598307.
DR   EnsemblGenomes-Gn; EBG00001106404.
DR   EnsemblGenomes-Gn; EBG00001106405.
DR   EnsemblGenomes-Gn; EBG00001106406.
DR   EnsemblGenomes-Gn; EBG00001106407.
DR   EnsemblGenomes-Gn; EBG00001106408.
DR   EnsemblGenomes-Gn; EBG00001106409.
DR   EnsemblGenomes-Gn; EBG00001106410.
DR   EnsemblGenomes-Gn; EBG00001106411.
DR   EnsemblGenomes-Gn; EBG00001106412.
DR   EnsemblGenomes-Gn; EBG00001106413.
DR   EnsemblGenomes-Gn; EBG00001106414.
DR   EnsemblGenomes-Gn; EBG00001106415.
DR   EnsemblGenomes-Gn; EBG00001106416.
DR   EnsemblGenomes-Gn; EBG00001106417.
DR   EnsemblGenomes-Gn; EBG00001106418.
DR   EnsemblGenomes-Gn; EBG00001106419.
DR   EnsemblGenomes-Gn; EBG00001106420.
DR   EnsemblGenomes-Gn; EBG00001106421.
DR   EnsemblGenomes-Gn; EBG00001106422.
DR   EnsemblGenomes-Gn; EBG00001106423.
DR   EnsemblGenomes-Gn; EBG00001106424.
DR   EnsemblGenomes-Gn; EBG00001106425.
DR   EnsemblGenomes-Gn; EBG00001106426.
DR   EnsemblGenomes-Gn; EBG00001106427.
DR   EnsemblGenomes-Gn; EBG00001106428.
DR   EnsemblGenomes-Gn; EBG00001106429.
DR   EnsemblGenomes-Gn; EBG00001106430.
DR   EnsemblGenomes-Gn; EBG00001106431.
DR   EnsemblGenomes-Gn; EBG00001106432.
DR   EnsemblGenomes-Gn; EBG00001106433.
DR   EnsemblGenomes-Gn; EBG00001106434.
DR   EnsemblGenomes-Gn; EBG00001106435.
DR   EnsemblGenomes-Gn; EBG00001106436.
DR   EnsemblGenomes-Gn; EBG00001106437.
DR   EnsemblGenomes-Gn; EBG00001106438.
DR   EnsemblGenomes-Gn; EBG00001106439.
DR   EnsemblGenomes-Gn; EBG00001106440.
DR   EnsemblGenomes-Gn; EBG00001106441.
DR   EnsemblGenomes-Gn; EBG00001106442.
DR   EnsemblGenomes-Gn; EBG00001106443.
DR   EnsemblGenomes-Gn; EBG00001106444.
DR   EnsemblGenomes-Gn; EBG00001106445.
DR   EnsemblGenomes-Gn; EBG00001106446.
DR   EnsemblGenomes-Gn; EBG00001106447.
DR   EnsemblGenomes-Gn; EBG00001106448.
DR   EnsemblGenomes-Gn; EBG00001106449.
DR   EnsemblGenomes-Gn; EBG00001106450.
DR   EnsemblGenomes-Gn; EBG00001106451.
DR   EnsemblGenomes-Gn; EBG00001106452.
DR   EnsemblGenomes-Gn; EBG00001106453.
DR   EnsemblGenomes-Gn; EBG00001106454.
DR   EnsemblGenomes-Gn; EBG00001106455.
DR   EnsemblGenomes-Gn; EBG00001106456.
DR   EnsemblGenomes-Gn; EBG00001106457.
DR   EnsemblGenomes-Gn; EBG00001106458.
DR   EnsemblGenomes-Gn; EBG00001106459.
DR   EnsemblGenomes-Gn; EBG00001106460.
DR   EnsemblGenomes-Gn; EBG00001106461.
DR   EnsemblGenomes-Gn; EBG00001106463.
DR   EnsemblGenomes-Gn; EBG00001106464.
DR   EnsemblGenomes-Gn; EBG00001106465.
DR   EnsemblGenomes-Gn; EBG00001106466.
DR   EnsemblGenomes-Gn; EBG00001106467.
DR   EnsemblGenomes-Gn; EBG00001106468.
DR   EnsemblGenomes-Gn; EBG00001106469.
DR   EnsemblGenomes-Gn; EBG00001106470.
DR   EnsemblGenomes-Gn; EBG00001106471.
DR   EnsemblGenomes-Gn; EBG00001106472.
DR   EnsemblGenomes-Gn; EBG00001106473.
DR   EnsemblGenomes-Gn; EBG00001106474.
DR   EnsemblGenomes-Gn; Nham_R0001.
DR   EnsemblGenomes-Gn; Nham_R0002.
DR   EnsemblGenomes-Gn; Nham_R0003.
DR   EnsemblGenomes-Gn; Nham_R0004.
DR   EnsemblGenomes-Gn; Nham_R0005.
DR   EnsemblGenomes-Gn; Nham_R0006.
DR   EnsemblGenomes-Gn; Nham_R0007.
DR   EnsemblGenomes-Gn; Nham_R0008.
DR   EnsemblGenomes-Gn; Nham_R0009.
DR   EnsemblGenomes-Gn; Nham_R0010.
DR   EnsemblGenomes-Gn; Nham_R0011.
DR   EnsemblGenomes-Gn; Nham_R0012.
DR   EnsemblGenomes-Gn; Nham_R0013.
DR   EnsemblGenomes-Gn; Nham_R0014.
DR   EnsemblGenomes-Gn; Nham_R0015.
DR   EnsemblGenomes-Gn; Nham_R0016.
DR   EnsemblGenomes-Gn; Nham_R0017.
DR   EnsemblGenomes-Gn; Nham_R0018.
DR   EnsemblGenomes-Gn; Nham_R0019.
DR   EnsemblGenomes-Gn; Nham_R0020.
DR   EnsemblGenomes-Gn; Nham_R0021.
DR   EnsemblGenomes-Gn; Nham_R0022.
DR   EnsemblGenomes-Gn; Nham_R0023.
DR   EnsemblGenomes-Gn; Nham_R0024.
DR   EnsemblGenomes-Gn; Nham_R0025.
DR   EnsemblGenomes-Gn; Nham_R0028.
DR   EnsemblGenomes-Gn; Nham_R0029.
DR   EnsemblGenomes-Gn; Nham_R0030.
DR   EnsemblGenomes-Gn; Nham_R0031.
DR   EnsemblGenomes-Gn; Nham_R0032.
DR   EnsemblGenomes-Gn; Nham_R0033.
DR   EnsemblGenomes-Gn; Nham_R0034.
DR   EnsemblGenomes-Gn; Nham_R0035.
DR   EnsemblGenomes-Gn; Nham_R0036.
DR   EnsemblGenomes-Gn; Nham_R0037.
DR   EnsemblGenomes-Gn; Nham_R0038.
DR   EnsemblGenomes-Gn; Nham_R0039.
DR   EnsemblGenomes-Gn; Nham_R0040.
DR   EnsemblGenomes-Gn; Nham_R0041.
DR   EnsemblGenomes-Gn; Nham_R0042.
DR   EnsemblGenomes-Gn; Nham_R0043.
DR   EnsemblGenomes-Gn; Nham_R0044.
DR   EnsemblGenomes-Gn; Nham_R0046.
DR   EnsemblGenomes-Gn; Nham_R0047.
DR   EnsemblGenomes-Gn; Nham_R0048.
DR   EnsemblGenomes-Gn; Nham_R0049.
DR   EnsemblGenomes-Gn; Nham_R0050.
DR   EnsemblGenomes-Gn; Nham_R0051.
DR   EnsemblGenomes-Gn; Nham_R0052.
DR   EnsemblGenomes-Gn; Nham_R0054.
DR   EnsemblGenomes-Gn; Nham_R0055.
DR   EnsemblGenomes-Gn; Nham_R0056.
DR   EnsemblGenomes-Gn; Nham_R0057.
DR   EnsemblGenomes-Gn; Nham_R0058.
DR   EnsemblGenomes-Gn; Nham_R0059.
DR   EnsemblGenomes-Gn; Nham_R0062.
DR   EnsemblGenomes-Gn; Nham_R0064.
DR   EnsemblGenomes-Gn; Nham_R0065.
DR   EnsemblGenomes-Gn; Nham_R0066.
DR   EnsemblGenomes-Gn; Nham_R0067.
DR   EnsemblGenomes-Gn; Nham_R0068.
DR   EnsemblGenomes-Tr; EBT00001698210.
DR   EnsemblGenomes-Tr; EBT00001698211.
DR   EnsemblGenomes-Tr; EBT00001698212.
DR   EnsemblGenomes-Tr; EBT00001698213.
DR   EnsemblGenomes-Tr; EBT00001698214.
DR   EnsemblGenomes-Tr; EBT00001698215.
DR   EnsemblGenomes-Tr; EBT00001698216.
DR   EnsemblGenomes-Tr; EBT00001698217.
DR   EnsemblGenomes-Tr; EBT00001698218.
DR   EnsemblGenomes-Tr; EBT00001698219.
DR   EnsemblGenomes-Tr; EBT00001698220.
DR   EnsemblGenomes-Tr; EBT00001698221.
DR   EnsemblGenomes-Tr; EBT00001698222.
DR   EnsemblGenomes-Tr; EBT00001698223.
DR   EnsemblGenomes-Tr; EBT00001698224.
DR   EnsemblGenomes-Tr; EBT00001698225.
DR   EnsemblGenomes-Tr; EBT00001698226.
DR   EnsemblGenomes-Tr; EBT00001698227.
DR   EnsemblGenomes-Tr; EBT00001698228.
DR   EnsemblGenomes-Tr; EBT00001698229.
DR   EnsemblGenomes-Tr; EBT00001698230.
DR   EnsemblGenomes-Tr; EBT00001698231.
DR   EnsemblGenomes-Tr; EBT00001698232.
DR   EnsemblGenomes-Tr; EBT00001698233.
DR   EnsemblGenomes-Tr; EBT00001698234.
DR   EnsemblGenomes-Tr; EBT00001698235.
DR   EnsemblGenomes-Tr; EBT00001698236.
DR   EnsemblGenomes-Tr; EBT00001698237.
DR   EnsemblGenomes-Tr; EBT00001698238.
DR   EnsemblGenomes-Tr; EBT00001698239.
DR   EnsemblGenomes-Tr; EBT00001698240.
DR   EnsemblGenomes-Tr; EBT00001698241.
DR   EnsemblGenomes-Tr; EBT00001698242.
DR   EnsemblGenomes-Tr; EBT00001698243.
DR   EnsemblGenomes-Tr; EBT00001698244.
DR   EnsemblGenomes-Tr; EBT00001698245.
DR   EnsemblGenomes-Tr; EBT00001698246.
DR   EnsemblGenomes-Tr; EBT00001698247.
DR   EnsemblGenomes-Tr; EBT00001698248.
DR   EnsemblGenomes-Tr; EBT00001698249.
DR   EnsemblGenomes-Tr; EBT00001698250.
DR   EnsemblGenomes-Tr; EBT00001698251.
DR   EnsemblGenomes-Tr; EBT00001698252.
DR   EnsemblGenomes-Tr; EBT00001698253.
DR   EnsemblGenomes-Tr; EBT00001698254.
DR   EnsemblGenomes-Tr; EBT00001698255.
DR   EnsemblGenomes-Tr; EBT00001698256.
DR   EnsemblGenomes-Tr; EBT00001698257.
DR   EnsemblGenomes-Tr; EBT00001698258.
DR   EnsemblGenomes-Tr; EBT00001698259.
DR   EnsemblGenomes-Tr; EBT00001698260.
DR   EnsemblGenomes-Tr; EBT00001698261.
DR   EnsemblGenomes-Tr; EBT00001698262.
DR   EnsemblGenomes-Tr; EBT00001698263.
DR   EnsemblGenomes-Tr; EBT00001698264.
DR   EnsemblGenomes-Tr; EBT00001698266.
DR   EnsemblGenomes-Tr; EBT00001698267.
DR   EnsemblGenomes-Tr; EBT00001698269.
DR   EnsemblGenomes-Tr; EBT00001698272.
DR   EnsemblGenomes-Tr; EBT00001698277.
DR   EnsemblGenomes-Tr; EBT00001698280.
DR   EnsemblGenomes-Tr; EBT00001698283.
DR   EnsemblGenomes-Tr; EBT00001698285.
DR   EnsemblGenomes-Tr; EBT00001698287.
DR   EnsemblGenomes-Tr; EBT00001698290.
DR   EnsemblGenomes-Tr; EBT00001698294.
DR   EnsemblGenomes-Tr; EBT00001698296.
DR   EnsemblGenomes-Tr; EBT00001698300.
DR   EnsemblGenomes-Tr; EBT00001698303.
DR   EnsemblGenomes-Tr; EBT00001698306.
DR   EnsemblGenomes-Tr; Nham_R0001-1.
DR   EnsemblGenomes-Tr; Nham_R0002-1.
DR   EnsemblGenomes-Tr; Nham_R0003-1.
DR   EnsemblGenomes-Tr; Nham_R0004-1.
DR   EnsemblGenomes-Tr; Nham_R0005-1.
DR   EnsemblGenomes-Tr; Nham_R0006-1.
DR   EnsemblGenomes-Tr; Nham_R0007-1.
DR   EnsemblGenomes-Tr; Nham_R0008-1.
DR   EnsemblGenomes-Tr; Nham_R0009-1.
DR   EnsemblGenomes-Tr; Nham_R0010-1.
DR   EnsemblGenomes-Tr; Nham_R0011-1.
DR   EnsemblGenomes-Tr; Nham_R0012-1.
DR   EnsemblGenomes-Tr; Nham_R0013-1.
DR   EnsemblGenomes-Tr; Nham_R0014-1.
DR   EnsemblGenomes-Tr; Nham_R0015-1.
DR   EnsemblGenomes-Tr; Nham_R0016-1.
DR   EnsemblGenomes-Tr; Nham_R0017-1.
DR   EnsemblGenomes-Tr; Nham_R0018-1.
DR   EnsemblGenomes-Tr; Nham_R0019-1.
DR   EnsemblGenomes-Tr; Nham_R0020-1.
DR   EnsemblGenomes-Tr; Nham_R0021-1.
DR   EnsemblGenomes-Tr; Nham_R0022-1.
DR   EnsemblGenomes-Tr; Nham_R0023-1.
DR   EnsemblGenomes-Tr; Nham_R0024-1.
DR   EnsemblGenomes-Tr; Nham_R0025-1.
DR   EnsemblGenomes-Tr; Nham_R0028-1.
DR   EnsemblGenomes-Tr; Nham_R0029-1.
DR   EnsemblGenomes-Tr; Nham_R0030-1.
DR   EnsemblGenomes-Tr; Nham_R0031-1.
DR   EnsemblGenomes-Tr; Nham_R0032-1.
DR   EnsemblGenomes-Tr; Nham_R0033-1.
DR   EnsemblGenomes-Tr; Nham_R0034-1.
DR   EnsemblGenomes-Tr; Nham_R0035-1.
DR   EnsemblGenomes-Tr; Nham_R0036-1.
DR   EnsemblGenomes-Tr; Nham_R0037-1.
DR   EnsemblGenomes-Tr; Nham_R0038-1.
DR   EnsemblGenomes-Tr; Nham_R0039-1.
DR   EnsemblGenomes-Tr; Nham_R0040-1.
DR   EnsemblGenomes-Tr; Nham_R0041-1.
DR   EnsemblGenomes-Tr; Nham_R0042-1.
DR   EnsemblGenomes-Tr; Nham_R0043-1.
DR   EnsemblGenomes-Tr; Nham_R0044-1.
DR   EnsemblGenomes-Tr; Nham_R0046-1.
DR   EnsemblGenomes-Tr; Nham_R0047-1.
DR   EnsemblGenomes-Tr; Nham_R0048-1.
DR   EnsemblGenomes-Tr; Nham_R0049-1.
DR   EnsemblGenomes-Tr; Nham_R0050-1.
DR   EnsemblGenomes-Tr; Nham_R0051-1.
DR   EnsemblGenomes-Tr; Nham_R0052-1.
DR   EnsemblGenomes-Tr; Nham_R0054-1.
DR   EnsemblGenomes-Tr; Nham_R0055-1.
DR   EnsemblGenomes-Tr; Nham_R0056-1.
DR   EnsemblGenomes-Tr; Nham_R0057-1.
DR   EnsemblGenomes-Tr; Nham_R0058-1.
DR   EnsemblGenomes-Tr; Nham_R0059-1.
DR   EnsemblGenomes-Tr; Nham_R0062-1.
DR   EnsemblGenomes-Tr; Nham_R0064-1.
DR   EnsemblGenomes-Tr; Nham_R0065-1.
DR   EnsemblGenomes-Tr; Nham_R0066-1.
DR   EnsemblGenomes-Tr; Nham_R0067-1.
DR   EnsemblGenomes-Tr; Nham_R0068-1.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2632904; 19056824.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000319.
DR   SILVA-SSU; CP000319.
DR   StrainInfo; 303234; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634489
CC   Source DNA and bacteria available from Dan Arp (arpd@bcc.orst.edu)
CC   Contacts: Dan Arp (arpd@bcc.orst.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4406967
FT                   /organism="Nitrobacter hamburgensis X14"
FT                   /strain="X14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:323097"
FT   gene            107..1534
FT                   /locus_tag="Nham_0001"
FT   CDS_pept        107..1534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60903"
FT                   /db_xref="GOA:Q1QS94"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS94"
FT                   /protein_id="ABE60903.1"
FT                   /translation="MSDIEQERWSRVKGRLRSTVGEDIYSSWFARMDLESVHGESVRMS
FT                   VPTRFLKSWIQAHYAERVLACWQAELPDVHRIDLMVRSAMRCAAPAKEAPAADPRRPEH
FT                   GDGRASTELKMVATAPASANHDALGGSPLDPRLTFASFVTGRSNTLAHAAARQVAEGRR
FT                   GDSIMFNPLYIHAGVGLGKTHLLQAVTWAGNAGTERKVLYLTAEKFMYGFVAALKSQTA
FT                   LAFKEALRGIDVLVIDDLQFLQGKSTQAEFCHTLNALIDAGRQVVVAADRPPSDLESLD
FT                   DRVRSRLAGGLVVEMGSLGEELRLGILKSRIEVARAHHASFSVPEPVLDYLAKAITHNG
FT                   RDLEGAINRLLAHSKLNAQPVTLEMAEREVRDLIRPQEPRRIKIEDIQRVVARQYNVSR
FT                   SDLLSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEALVSK
FT                   DTTLSDEVELLKRQLQE"
FT   gene            1738..2856
FT                   /locus_tag="Nham_0002"
FT   CDS_pept        1738..2856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60904"
FT                   /db_xref="GOA:Q1QS93"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS93"
FT                   /protein_id="ABE60904.1"
FT                   /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLK
FT                   ATDLDLEVTETLAAETATGGATTVPAHIFYDIVRKLPDGAQIVLEGDGDRSVLAIRAGR
FT                   SRFTLQTLPENDFPDLAAGEMTHSFKLAAADIKRLIDRTQFAISTEETRYYLNGIYLHS
FT                   AGSAKNATLRGVATDGHRLAQVDLALPNGAEGMPGVIIPRKTVGEVQRLIEDNEAEVGI
FT                   ELSQGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELIVDKKDFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASEPLDIGFNSRYLLDIAAQIEGE
FT                   GAVLKLADPGSPTLVHDKDSKGALYVLMPMRV"
FT   gene            3021..4160
FT                   /locus_tag="Nham_0003"
FT   CDS_pept        3021..4160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60905"
FT                   /db_xref="GOA:Q1QS92"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS92"
FT                   /protein_id="ABE60905.1"
FT                   /translation="MIPSRIRRLSLTHFRNYRAAALETRSDVVVLVGPNGAGKTNCLEA
FT                   ISLLSPGRGLRRATREEVADHRGDGSWAVSAEVEGALGLATLGTGIDAPGSDAASSGRR
FT                   CRIDREPAGSAAAFGDHLRMVWLTPSMDGLFGGAASERRRFFDRLVLAIDSDHSGRVSA
FT                   LERSLRSRNRLLETRNSDDHWCDAVERQTAELAVAVAAMRAQTVTRLAAALEARGAASA
FT                   FPSARIGLDGWMENALLTEPATAVEDRYREILRANRARDAAAGRTLDGPHLTDLEVIYA
FT                   PKSMPARDASTGEQKALLIGLVLAHAGLVAEMTGIAPLLLLDEVVAHLDPDRRGALFGE
FT                   LKGLGAQVWMSGADPAAFANVGAGSEIFDVDAGRIAQRQ"
FT   gene            4459..6900
FT                   /locus_tag="Nham_0004"
FT   CDS_pept        4459..6900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60906"
FT                   /db_xref="GOA:Q1QS91"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS91"
FT                   /protein_id="ABE60906.1"
FT                   /translation="MNESAGQQLADTEPAAPVEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHATRVEVILNADNSVTVRDDGRGIPVDIHKGEGIS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLILRIWRKDKEHLIEFAHG
FT                   DAVAPLKVVGEANGKRGTEVTFLASRETFTNVEYDFATLEHRLRELAFLNSGVNILLSD
FT                   LRRAVEKREQMMYDGGVVEFVKYLDRNKKAMVPEPIMIRADMNGLGVEAALWWNDSYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRGALTRQVNGYADAMARKERIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVINEALAAWFEEHPTEAKLIVGKVVEAAAAREA
FT                   ARKARELTRRKGALDVASLPGKLADCQERDPAKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLSSEQIGTLITALGTGIGREDFDLSKLRYHKIIVMTDADVD
FT                   GAHIRTLLLTFFFRQMPTLIEAGHLYIAQPPLYKVTRGKSEQYLKDERALEDYLIETGL
FT                   DDCVFKLATGEDRSGRDLQALVEDARVIRNVLHNMHGRYNRSVIEQAAIAGVLNPRVTA
FT                   DVATANAAADYIARRMDALADEVERGWIGRFTEGEGFSFERTVRGVKDIAMIDDALLGS
FT                   ADARKLDEYAAKLQEAYPRPGLLRRKDTETPIHGPVGLFEAVTDAGRKGVALQRYKGLG
FT                   EMNPDQLWETTLDASERSLLQVKIKEVDEADDIFTKLMGDVVEPRREFIQENSLSANVD
FT                   V"
FT   gene            complement(7095..8228)
FT                   /locus_tag="Nham_0005"
FT   CDS_pept        complement(7095..8228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60907"
FT                   /db_xref="GOA:Q1QS90"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS90"
FT                   /protein_id="ABE60907.1"
FT                   /translation="MISYLKRTATQLWSRKVELGLGVRVTAAAFAALVVAIALHLRLPL
FT                   WAVLTAIIVTQMSVGRSLKATRDYLIGTIGGALYGGAIAILIPHSGESGLLAVLVLAVA
FT                   PLAFLAAINPSLNVATVTAIIVLLLPTMGQMSPLESAIDRILEVTVGAITGMLVSFLVL
FT                   PSRAYGQIRVNAARVLNLLADALQELLAGLTRGRDNDALHALQDGIGHAISELNAIGIE
FT                   AERERSARLSHGPDTGPLLRTVLRLRHDVVMIGRATVTPLPINLQLRLAQPLARLSDTM
FT                   NNYLKASAEALRLGAPAPALLPVQTALEAYAAEIAAMRREGLTRGLPGDMTERFFALGF
FT                   SLEQMRQNLGDLERYIREWTDRPKSSAGNDEGAAGTG"
FT   sig_peptide     complement(8118..8228)
FT                   /locus_tag="Nham_0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.649) with cleavage site probability 0.327 at
FT                   residue 37"
FT   gene            8563..9120
FT                   /locus_tag="Nham_0006"
FT   CDS_pept        8563..9120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS89"
FT                   /protein_id="ABE60908.1"
FT                   /translation="MPVFRYFLVMGCCLLGLLFVADWIWPGNAGTDAHPATVASAGSAG
FT                   LKSEDLVPKDSVPKDPASTDLGAASAVLSSIDDWRRSEKRFERSKHDPQPIVYPDIATL
FT                   APTADRLQWERQLRYLPANHVYEARAEMPKAEAPKVAEKTRPPRKHIAHARSRARVIAN
FT                   VERPPPPRYARNTGWNPFGLFD"
FT   gene            complement(9150..9896)
FT                   /locus_tag="Nham_0007"
FT   CDS_pept        complement(9150..9896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60909"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS88"
FT                   /protein_id="ABE60909.1"
FT                   /translation="MMKHDSLATYPPLNTLKRVADDVWIVDGPTIAFGQPLLKMPFSTR
FT                   MTIIRIGGDLLIHSPTPLTAELKTEVEGRGRPRWIVGPNRIHYWWIPDWHTAFPDTEVY
FT                   LAPRIREQAAGRIDFDCQALDRDRGYSWDKDVATLPVEGSYMTEVVFFHRKSRTLVLTD
FT                   LIENFEPRKLGSLLTRVLTWLGGVQHPDGSMPRDMRLSYRDKAGLRGAVETMIGWNPER
FT                   IVLAHGRWYDRNGTDELRRAFRWLLG"
FT   gene            complement(9957..10241)
FT                   /locus_tag="Nham_0008"
FT   CDS_pept        complement(9957..10241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0008"
FT                   /product="protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60910"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS87"
FT                   /protein_id="ABE60910.1"
FT                   /translation="MAKGYWVVRVSVHDSERYPDYLAAAQPAFEKFRANFIVGGGPFDS
FT                   MEGTSRARNVVVEFKDLATAKACYQSPEYQAAKAIRQTCSEADFIIIEG"
FT   gene            10492..11412
FT                   /locus_tag="Nham_0009"
FT   CDS_pept        10492..11412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0009"
FT                   /product="Pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60911"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS86"
FT                   /protein_id="ABE60911.1"
FT                   /translation="MSWFPSNDPVLGDPLTCDALELVIVPRIRDLGDGFAVRRALPHGK
FT                   RQMVGPFIFFDHFGPVQFVSGKGMDVRPHPHIGLATVTYLFDGSIMHRDSEGNIQEIQP
FT                   GAMNLMTAGRGIAHSERTPDTQRASGQKMLGLQSWIALPAGREEIAPSFQHYGADSLPT
FT                   VQDKGFRARVIAGNSFGAASPVEMVSPWFYVEVSLDAGMSAPLDADHEERAIYVVDGEI
FT                   EIAGDRHEAPQLLIFRPGDRITVRATKPTRMMFLGGDALEGPRHIWWNFVSSSKERIEQ
FT                   AKEDWKTGRFAPVPNEHEFIPLPEN"
FT   gene            complement(11419..12420)
FT                   /locus_tag="Nham_0010"
FT   CDS_pept        complement(11419..12420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0010"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60912"
FT                   /db_xref="GOA:Q1QS85"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS85"
FT                   /protein_id="ABE60912.1"
FT                   /translation="MTSAKYDVLGIGNAIFDVLVRTDEGFLAAHGMVKGGMALIDEARA
FT                   ASIYADMGPATEMSGGSAANTIVGLAGFGARAAYVGKVKDDQIGRLYTHDIRAAKVAFD
FT                   TPPASGGPATGCSYILVTPDGERTMNTYLGAAQDLSPADIDAETVAAASILYLEGYLWD
FT                   PKAAKDAFLKASQIAHGANRQVALTLSDAFCVDRYRDEFLQLMRSDAVDLVFANETELR
FT                   SLYQTSDFDTALAQLRKDVALGVVTRSEKGCVVATKDDVVAVPACPIDGLVDTTGAGDL
FT                   FAAGFLFGLVRGTSHENAGRLGALAAAEVIQHIGARPQVSLKELAQANGLPA"
FT   gene            12511..14100
FT                   /locus_tag="Nham_0011"
FT   CDS_pept        12511..14100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0011"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60913"
FT                   /db_xref="GOA:Q1QS84"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS84"
FT                   /protein_id="ABE60913.1"
FT                   /translation="MPSSAAPDIAMIRSVLTVSSGTLASRLLGFARDALTAALLGAGPV
FT                   ADAFLMAFQLINVIRRMLSEGALNAALVPAWMRMRDGSGLAAASAFAGAVLGTVSATLI
FT                   ALAVIVGVAMPLLMTLLAPGFAGRDSLQLAVTDARLMLPYLAFAGPAAVIMSLMNARHR
FT                   FAITSFSPLLFNVALILVISVLLLLHQDSHSAAMMMAATVGAAGLLQLLVLSIPGRRDN
FT                   IASPLRLSFDTGMRDFARKAVPGMIANSGPQLLIVAGAIVASVSPSAVAWLYFANRLIE
FT                   LPLGMVGVAIGTVLVPEMSRALNKGDRLALVHAESRGIELAAALALPATFGLIVLSEPI
FT                   VRVLFEHGAFTAADTQATALALGCLGLGLPAYVLIKALSPAFFARGNTMTPLLAALTGI
FT                   AVAIVLALVFGRLFGIGGIAVAVAVGAWSNAASLARSVAATFGFSIDAEARRRLPRIVL
FT                   AALLMGGLLWLAVRLLPPMPDAHELLQAAMLVVLIVAGIAVYGLLLLAFRVIVWSDMQA
FT                   ALAQSRSSDLHT"
FT   gene            14196..15239
FT                   /locus_tag="Nham_0012"
FT   CDS_pept        14196..15239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0012"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60914"
FT                   /db_xref="GOA:Q1QS83"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS83"
FT                   /protein_id="ABE60914.1"
FT                   /translation="MTTRVFSGVQPTGNLHLGNYLGAIVNFVKLQADHQCLYCVVDLHA
FT                   ITVPVAVWGGPDELRRNTREVTAAFIASGIDPKQHIIFNQSQVAGHAELTWVFNCVARL
FT                   GWLNRMTQFKEKAGKDRENASIGLYDYPVLMASDILLYRATHVPVGEDQKQHLELSRDI
FT                   AQKFNNDFSASIAGNGHGDGFFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINL
FT                   TDDADTIAQKIRKAKTDPEPLPSEEKGLESRPEADNLVGIYAALSGKPKPEVLAQFGGA
FT                   QFSGFKSNLVDLAVAKLSPIAAEMKRLTDDPAYVEGILIEGADRARAIASETMNAVKDI
FT                   VGFIRKR"
FT   gene            15511..15861
FT                   /locus_tag="Nham_0013"
FT   CDS_pept        15511..15861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0013"
FT                   /product="ISGsu3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60915"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QKG0"
FT                   /protein_id="ABE60915.1"
FT                   /translation="MRGSDERSGSLFSYVDLEARIRSDHPLRTIRQIANAALNDLSRDF
FT                   DKLYTAFGRPSIAPEKLLRAMLLQAFYGIRSERQLMERLEFDLLLRWFVGLGVDDPVWG
FT                   PLDLLEEPRPIA"
FT   gene            15896..16621
FT                   /locus_tag="Nham_0014"
FT   CDS_pept        15896..16621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0014"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60916"
FT                   /db_xref="GOA:Q1QKF9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QKF9"
FT                   /protein_id="ABE60916.1"
FT                   /translation="MGQHQVKRLLSSEHFSVDGTLIEAWASIKSFRRKDGGDQDSDGPG
FT                   RNAERSFHNEKRCNETHQSTTDPEARLYKKGGGQPAKLCYIGHALMENRNGLAVLGGVS
FT                   RATGTAERDQALALIDCHRGQSERRITLGADKAYDVTAFVEDLRRRSVTPHIAIDGHLS
FT                   KTGKPRKTAIDQRTLRHAGYAVSQRCRKRIEEVFGWIKASAGLAKIKLRGRDRVNATFT
FT                   LALAAYNLIRLPKLLAAAA"
FT   gene            16865..17359
FT                   /locus_tag="Nham_0015"
FT   CDS_pept        16865..17359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0015"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60917"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS80"
FT                   /protein_id="ABE60917.1"
FT                   /translation="MSAQRRSYETGHKPKYLVVVDDSAEWDRAVYYASRRAIRVGGGIV
FT                   MLRVIETEDRNQEWLGVAEVMRAEAYEGANAALDRAAGRANGIAAITPERVIREGNPLE
FT                   QILDVIVQDVDISMLVLAAAGGPEGPGPIITTLAKTAGNFPIPVTIVPGSLTDDEVDAL
FT                   S"
FT   gene            17538..18113
FT                   /locus_tag="Nham_0016"
FT   CDS_pept        17538..18113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0016"
FT                   /product="nitrogen-fixing NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60918"
FT                   /db_xref="GOA:Q1QS79"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS79"
FT                   /protein_id="ABE60918.1"
FT                   /translation="MFIQTEVTPNPATLKFLPGRTVLGKGTMEFNGPDTAGRSQLAVRL
FT                   FAVHGVTGVFYGSDFITVTKDASDWQHLKPAILGVIMEHYMSGAPLLADGETAGNDEAN
FT                   KDEAVEFFDEADAETVTLIKDLIETRVRPGVADDGGDITFRGFKDGVVYVNMKGSCSGC
FT                   PSSTVTLRNGIQNLLKHFVPEVVEVRPV"
FT   gene            complement(18143..19273)
FT                   /locus_tag="Nham_0017"
FT   CDS_pept        complement(18143..19273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60919"
FT                   /db_xref="GOA:Q1QS78"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS78"
FT                   /protein_id="ABE60919.1"
FT                   /translation="MTDVTGTRYYDGAVYSAGSPRKAVPQNILGAAALGCIALACAWTL
FT                   YANVSGGDPELVTASLPPATSIRSVEPADRIAAAYEALREMPAPQAVQGTTEARTAAAA
FT                   SIDDPAARARTALLYGPRFLGPPPGTFRLSAEPAQAAREVASLPAQAGPETLPLPRAPQ
FT                   LVAVVVPMPAPRPAELRQVQVAAGPSRREVAQASAAAALEPEPKKPSIFERLFGKPASG
FT                   GLQLAFAAPDGGVTSEGESLTLGRIPQYDQFTAVYDISARTVYLPDGTKLEAHSGLGKM
FT                   MDDPRYADRKMRGVTPPHTYELSLRERPFHGVEAIRLKPVGGEDKIYGRTGLLAHTYML
FT                   GPNGDSNGCVSFRNYNAFLRAYKSGRVKRMVVVAKL"
FT   gene            19577..20275
FT                   /locus_tag="Nham_0018"
FT   CDS_pept        19577..20275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0018"
FT                   /product="peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60920"
FT                   /db_xref="GOA:Q1QS77"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS77"
FT                   /protein_id="ABE60920.1"
FT                   /translation="MLVLAIDTALDACAAGVLDTKAGRLIAHESLPMKRGHAEALMPLI
FT                   ARVVESAGIAFAALDRIAVTTGPGSFTGLRVGLSAARGIALAANKPAVGVTTLMAYAAP
FT                   VVGENREAPVISAIDARHDHVYFQAVSGNGSTLVRPHVAPVEEALAASRFGAPHLVGNA
FT                   AKLLADRWPAHAPPPVAVDPQAAPDIAWVAWLGAAVSPDTAPPRPYYLRAPDAKPAGDL
FT                   LRKTAKPAAS"
FT   gene            20272..20754
FT                   /locus_tag="Nham_0019"
FT   CDS_pept        20272..20754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0019"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60921"
FT                   /db_xref="GOA:Q1QS76"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS76"
FT                   /protein_id="ABE60921.1"
FT                   /translation="MMTWFTGKERATPVVEAASPHDAARLAAIHGASFHRGWGEGEFEL
FT                   MIAERNTLVQRLRLRTTVIGFAVSRIGADEAEILSIAIDAGHRGQRFSRDLLFTHLGYL
FT                   AGRGVRTVFLEVEENNQPARRLYERAGFAVTGRRERYYREAGGQELNALVMRRDLS"
FT   gene            20911..21360
FT                   /locus_tag="Nham_0020"
FT   CDS_pept        20911..21360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0020"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60922"
FT                   /db_xref="GOA:Q1QS75"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS75"
FT                   /protein_id="ABE60922.1"
FT                   /translation="MTALKPTSAQTSTTIEARCAATGMRMTEQRRVIARVLAEASDHPD
FT                   VEELYRRCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRARYETMRDSHHDHLINL
FT                   RDGTVIEFTSDEIEKLQAEIARKLGYRLVDHRLELYCVPMDDDKS"
FT   gene            21543..22964
FT                   /locus_tag="Nham_0021"
FT   CDS_pept        21543..22964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0021"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60923"
FT                   /db_xref="GOA:Q1QS74"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS74"
FT                   /protein_id="ABE60923.1"
FT                   /translation="MTPPRKLHIKSYGCQMNVYDAQRMVDTLAAEGFVETASAEEADLV
FT                   ILNTCHIREKASEKVYSELGRLRAAKDQAARDGREMSVVVAGCVAQAEGDEIIRRAPVV
FT                   DVVVGPQSYHHLPQLLARAKADGRALETEFPVEDKFGFLPQPSRQAIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEVSRPVAKIVEDVQRLADNGVREITLIGQNVNAYHGDGPDG
FT                   RPWPFGKLLHRLADIPGIVRLRYSTSHPRDVEDSLIEAHRDLGALMPFVHLPVQSGSDR
FT                   ILEAMNRRHTADDYRRVVDRFRHVRQDIAFSSDFIVGFPGETEQDFTATLALVTQIGYA
FT                   GAYSFKYSPRPGTPAAEMKETVSTADMDERLVRLQNLIDSQQSAFNRAAVGTTVDVLFE
FT                   RAARNPGQIVGRTAYLQPAHVVASADIIGQILPVTVASLERYSLLGSLASAPASRASAD
FT                   DAPPVGASSPAIMGV"
FT   gene            22969..24018
FT                   /locus_tag="Nham_0022"
FT   CDS_pept        22969..24018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0022"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60924"
FT                   /db_xref="GOA:Q1QS73"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS73"
FT                   /protein_id="ABE60924.1"
FT                   /translation="MPKSASDSPSLAPSRKLDMQAPPETQVVIDFDDNRAVSALVGPYG
FT                   QNLAQLERRLGVVVDSRGNHITIAGSRDGCDAGRRVLETLYTQAAQGHDLSQGEVEGAI
FT                   RAVIAQGSLFEYDAKAPRSTFEAINLRKRPVRARTAAQDLYIRALKRHELVFGIGPAGT
FT                   GKTWLAVAQAAQLFERKEVDRIILTRPAVEAGERLGFLPGDLREKVDPYLRPIYDALYD
FT                   LMDSRIVERALQSGEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGENSR
FT                   MIVTGDPSQVDLPNGQTSGLAEATRLLDGVEGVAQVKFTAGDVIRHELVARIVAAYEGL
FT                   PPRPAAGKP"
FT   gene            24020..24592
FT                   /locus_tag="Nham_0023"
FT   CDS_pept        24020..24592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0023"
FT                   /product="protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60925"
FT                   /db_xref="GOA:Q1QS72"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS72"
FT                   /protein_id="ABE60925.1"
FT                   /translation="MDVENDRPPRRGAAGERNSGTMIYPALPATEVLVVAECWRAEAGA
FT                   EAIIHRAVETAAGMVDTDTGDAELAIMLTDDAGIRTLNANWRGIDKPTNVLSFPALQPT
FT                   GAPSPDDAPRMLGDIAIAYETLRREACDEHKPFDHHLSHLTIHGFLHLIGYDHETDEEA
FT                   GEMENLERKILARLGIPDPYAPQERMA"
FT   gene            24593..25717
FT                   /locus_tag="Nham_0024"
FT   CDS_pept        24593..25717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0024"
FT                   /product="CBS:transporter-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60926"
FT                   /db_xref="GOA:Q1QS71"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS71"
FT                   /protein_id="ABE60926.1"
FT                   /translation="MSPEEEPSDIRPPQDNRNLPVPVHNGEVLRPASERWLMRAIRSLF
FT                   GWKAGSVRADLQVVLDASTPDETSFTAVERAMLRNILNLHERRIADVMVHRADIVAVKR
FT                   DIPLGELINLFESAAHSRLVVYHENLDDPEGIVHIRDLLAFMAARARTAMPSKAKRKKA
FT                   PPAGLDLRAIDLALPLCEANITRKLLYVPPSMPAIDLLAQMQATRIHLALVVDEYGGTD
FT                   GLVSLEDIVEQIVGEIDDEHDGDEPPSIVRQADHSFIADARASLEDVRAMIGDEFVIGE
FT                   AGEDVDTLGGFLVTHVGRLPVRGEVISGPGPFEIEVLDADPRRVKRLRIGLRKERPAVR
FT                   PRDGRRREAAPDAPSQPQGDPASPSLPDDGGETP"
FT   gene            25714..27339
FT                   /locus_tag="Nham_0025"
FT   CDS_pept        25714..27339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0025"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60927"
FT                   /db_xref="GOA:Q1QS70"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS70"
FT                   /protein_id="ABE60927.1"
FT                   /translation="MSLSLAGSARTTGLAVTLSWGWKRAVIALLAGAASSLAMEPFNAW
FT                   PLLFVTFPIAIWLIDGAGAGRIGGVPAAALAGWLFGFGYFVPGLYWIGNAFLVDAQTFA
FT                   WLMPFAVIGLPAYLALFTALGFALARLIWTRDASRILALAVALTVGEWLRGHVLTGFPW
FT                   NAFGYALTEPLALAQTASLIGLWGLTFLSVAIFASPAVLIDGRSRSQRPWIAPVTAVSL
FT                   LLAMGVYGAVRLSRHPTEFTDNVKLRIMQPNLAQDVRFNYSAKAAVMHKYLTLSDRATG
FT                   PHSTGVSSATILIWPESAFPFFLTREADAMAEIADLLPKGTILITGAVRAPDLPPGVRI
FT                   TRAYNSIYVIDDDGTILSTYDKLHLVPFGEFLPFQGLMEKLGFVQLTKVQGGFIPGTGR
FT                   RTIALPNAPSVLPLICYEAIFPGDIESRGGRPGWIVNLTNDGWFGISTGPHQHLQQARM
FT                   RAIEEGLPLVRAANTGISVVTDPVGRIVAQLDLGVEGVLDSRLPVAIAPTPYARAGDIP
FT                   AAIMVTIALVVVIRRRREHERRRV"
FT   sig_peptide     25714..25830
FT                   /locus_tag="Nham_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.798) with cleavage site probability 0.780 at
FT                   residue 39"
FT   gene            27538..27957
FT                   /locus_tag="Nham_0026"
FT   CDS_pept        27538..27957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0026"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60928"
FT                   /db_xref="GOA:Q1QS69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS69"
FT                   /protein_id="ABE60928.1"
FT                   /translation="MSTKAPNPVDKHVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQKY
FT                   EKGTNRVGASRIQQISDILQVPVSFLFEGSPGTGIAVAGGLSEAPSPAYVSDFLATSEG
FT                   LALTRAFTRITDAKLRRSIVDLVEQIAAREPPDRR"
FT   gene            27995..28762
FT                   /locus_tag="Nham_0027"
FT   CDS_pept        27995..28762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0027"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60929"
FT                   /db_xref="GOA:Q1QS68"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS68"
FT                   /protein_id="ABE60929.1"
FT                   /translation="MTAAASDPHNPRSSADDTASPRCESGQGSFFGRRKGHKLRPHQNG
FT                   LIEHLLPRLSLDPGASGPSDPATLFGRPVKEMRIEIGFGGGEHLVAEALAFPRTGFIGC
FT                   EPYVNGMAKILSQIEAHDIGNIRLLAGDASELLAWLPRASLARIDLIHPDPWPKRRHWK
FT                   RRFVQDATVAEMARVLRPGGEFRFVSDIADYCAWTLSHLARSPGFLWLAERATDWHNPW
FT                   PDYTMTRYGRKAEREGRRAAYLRFRRESDAAQA"
FT   gene            29091..29882
FT                   /locus_tag="Nham_0028"
FT   CDS_pept        29091..29882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0028"
FT                   /product="protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60930"
FT                   /db_xref="GOA:Q1QS67"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS67"
FT                   /protein_id="ABE60930.1"
FT                   /translation="MTDPVDQIPDHELLDEPRLVVEPGVAARVSSVVAPVLQGMGYRLV
FT                   RIKVSGEYGCTVQIMAERPDGSMQIEDCEAISKALSPVLDVADPIDKAYRLEISSPGID
FT                   RPLVRRSDFERHAGHLVKVEMAVAHQGRKRFRGILQGVKDNAIRLHRDDVQNVDESEVL
FT                   LVMEDIADARLVLTDELIAESMRRGKIAEREMKRDLGILPPPPPHAKNDPARSPARRNA
FT                   PKPKLKSTAKAHEKKPPKNTKEHRLAAERLRRGEIDPIEGE"
FT   gene            29886..31496
FT                   /locus_tag="Nham_0029"
FT   CDS_pept        29886..31496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0029"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60931"
FT                   /db_xref="GOA:Q1QS66"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS66"
FT                   /protein_id="ABE60931.1"
FT                   /translation="MAAVSANKLELLQIADAVAREKSIDRGIVIAAMEDAIAKAARARY
FT                   GSETDVHAEIHPKTGQLQLTRHMLVVDEIENAANQISLKDAQRANPGAQIGDTIADTLP
FT                   PLEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGIVKRVEYGSVIVDLGRG
FT                   EAVVRRDEMLPREVFRNGDRVRAYIFDVRRETRGPQIFLSRTHPQFMVKLFTQEVPEIY
FT                   DGIVEIKAVARDPGSRAKIGVISRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPW
FT                   SPDIATFVVNALAPAEVAKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTG
FT                   WDIDILTEQEESERRQADFENATRMFMEALNVDEVVGQLLASEGFMSVEELTLVETREL
FT                   AGIEGFDDETANELQSRAREYLEQLEAELDNRRKELGVDDALKTVPGVTSKMLVKLGEN
FT                   EVRTVEDLAGCATDDLVGWTERKDGEAVKHAGYLDGIEVSREDAEAIIMQARLIAGWIT
FT                   EADLAKSAEEAPAAEDQPA"
FT   gene            31572..32237
FT                   /locus_tag="Nham_0030"
FT   CDS_pept        31572..32237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0030"
FT                   /product="protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60932"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS65"
FT                   /protein_id="ABE60932.1"
FT                   /translation="MLAIADPADLDDGPRTNRPATTRMCAVTREVRPIGELIRFVVSPS
FT                   GEVIADLKRKLPGRGLWISASHATVAEAARRHHFSKGFKRDVRVSASLADETGQSLARS
FT                   AIDALAVVAKAGQVVAGFAKVEDALLRRQAVALLHAADGAADGIRKLDAIVKKTAAESR
FT                   ETREIPVISALASAELDLALCRSNVIHAAVLAGPAGRTFLSRSQTLVRYRDGGQRQGS"
FT   gene            32305..34911
FT                   /locus_tag="Nham_0031"
FT   CDS_pept        32305..34911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0031"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60933"
FT                   /db_xref="GOA:Q1QS64"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS64"
FT                   /protein_id="ABE60933.1"
FT                   /translation="MVDTKNPGDKTLSVGPSKTLTLKPRVEQGTVRQSFSHGRTKQVVV
FT                   EKRGKRRIGGDAPAAEPVAASEPTVARAPRIPVRPAPPAASRANSGVVLRTLTEDERTA
FT                   RASALAEAKIRAEEERRIAEAEAARRNSKEGIEQAEREAAEARRKAEEERHRQEEEAKR
FT                   KAELEAKRRFGESETKAAPAKTTTTTTRAAPPARPAAVAADGSDEEEAPRLVRRPGGGP
FT                   ARPVVAPKPAAKPAPAKQRGRLTLVTALSADDVRERSIASFRRRTQRLKGHASNEPKEK
FT                   LIREVIVPEAITIQELANRMAERAVDVIRMLMKQGAMHKITDVIDADTAQLIAEELGHT
FT                   VKRVAASDVEEGLFDADDDSTVVEPRSPVVTVMGHVDHGKTSLLDAVRHANVVSGEAGG
FT                   ITQHIGAYQVTSPDGKKITFIDTPGHAAFTAMRARGAKVTDIVVLVVAADDGVMPQTVE
FT                   AINHAKAAKVPMIIAINKIDKPDAKPERVRTELLQHEVQVESMGGQVIDVEVSAKNKTN
FT                   LDKLLEMISLQADLLDLKTNASRPAEGTVIEAKLDRGRGPVATVLVQRGTLRVGDIIVA
FT                   GAEMGRVRALISDQGETVDEAGPSVPVEVLGFNGPPEAGDRLAVVENEARARQVTSYRA
FT                   HQKRENAAASSSGMRGSLEQMMSQLKTAGRKDFPLVIKADVQGSLEAILGSLEKLGTEE
FT                   VAARILHAGVGGISESDVTLAEGFNAAIIGFSVRANKEAAAAAKRNGIEIRYYNIIYDL
FT                   VDDVKKAMSGLLAPTLRETMLGNAEILEVFNISKVGKVAGCRVTDGNVERGANVRLIRE
FT                   NVVVHEGKLSTLKRFKDEVKEVQSGQECGMAFESYHDMRVGDVIECYRVETIQRSL"
FT   gene            35047..35460
FT                   /locus_tag="Nham_0032"
FT   CDS_pept        35047..35460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0032"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60934"
FT                   /db_xref="GOA:Q1QS63"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS63"
FT                   /protein_id="ABE60934.1"
FT                   /translation="MPRHNKKDSTSGASQRQLRVAETVRHAIADILAQGHVHDPVLEGH
FT                   LITVPEVRMSADLKLATIYVMPLGGRDTTDVIDALDHNRKFLRGEIARRVNLKFAPDIR
FT                   FRADERFDEAERIEKLLRTPAVQRDLAPDSDES"
FT   gene            35466..36704
FT                   /locus_tag="Nham_0033"
FT   CDS_pept        35466..36704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0033"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60935"
FT                   /db_xref="GOA:Q1QS62"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS62"
FT                   /protein_id="ABE60935.1"
FT                   /translation="MTTQNSAFDSPIAEPDAPEKNNSDRGNNFSDTPPHHEDGSLSRLQ
FT                   AETSGGGSERVEVEGFSSQTNQASAHPASEARHPPPRQAGEGRKKQNNQPRRDKRDVHG
FT                   WVVLDKPVGMTSTHAVAVVKRLFSAKRAGHAGTLDPLASGGLPIALGEATKTVPFVMDG
FT                   RKRYRFTVQWGEERDTDDTEGRVTATSESRPAADAVRALLPRFTGVIEQIPPQYSAIKI
FT                   QGERAYDLARDGETVALQPRPVEIHHFTLVEHTDDGRSLFEAECGKGTYVRALARDIGR
FT                   ILGCYGHISALRRTLVGPFDEADMIPLEELEALCNRAASGEGSLADALLPVETALDDIP
FT                   ALAVTRADAARLHRGQAVLLRGRDAPQSSGTVYVTVAGRLLALAELGHGELIPKRVFNL
FT                   TGLTASSGRNERA"
FT   gene            36707..36976
FT                   /locus_tag="Nham_0034"
FT   CDS_pept        36707..36976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0034"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60936"
FT                   /db_xref="GOA:Q1QS61"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS61"
FT                   /protein_id="ABE60936.1"
FT                   /translation="MSITAERKAEVIKTNARKSGDTGSPEVQVAILSERIVNLTNHFKS
FT                   HGKDNHSRRGLLKLVSTRRSLLDYVKKKDEARYRALLEKHNIRR"
FT   gene            37219..39465
FT                   /locus_tag="Nham_0035"
FT   CDS_pept        37219..39465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0035"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60937"
FT                   /db_xref="GOA:Q1QS60"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS60"
FT                   /protein_id="ABE60937.1"
FT                   /translation="MWPASGNLAHGFCVWRPCFCEPQKDNNKMFNKHSVEIDWGGRPLK
FT                   LETGKIARQADGAVVATYGETVVLATVVAAKTPREGVDFLPLTVDYQEKTYAAGRIPGG
FT                   YFKREGRPSEKETLVSRLIDRPVRPLFADGWRNETQVIVTVLSHDMENDPDVLAMVAAS
FT                   AALTLSGAPFRGPIGAARVGFMNDEYVLNPTLDEMVDTQLELVVAGTADAVLMVESEAK
FT                   ELSEDIMLGAVMFGHRHFQPVINAIIELAEKAAKEPREVSQADDSALEKEMLGLIEGEL
FT                   RPAYAIADKQQRQNAVAAAKAKVIAHYFPEGQEPKYDKLRIAAVFKHLEAKIVRWNILD
FT                   TGKRIDGRDAKTVRNILAEVGVLPRAHGSALFTRGETQAMVVTTLGTGEDEQYIDALSG
FT                   TYKETFLLHYNFPPYSVGETGRLGSTKRREIGHGKLAWRAIHPVLPPHHEFPYTIRVVS
FT                   EITESNGSSSMASVCGASLSLMDAGVPLKRPTAGIAMGLILEGSRYAVLSDILGDEDHL
FT                   GDMDFKVAGTEVGISSLQMDIKIAGITEEIMKVALAQAREGRIHILGEMAKALTNARAE
FT                   LGEYAPRIETFKIPTDKIREVIGTGGKVIREIVEKTGAKINIEDDGTVKVASNDGEAMK
FT                   AAIKWIKSIASDPEVGQIYEGTVVKVMEFGAFVNFFGAKDGLVHISQLAANRVQKSSDI
FT                   VKEGDKVKVKLLGFDDRGKTRLSMKAVDQQTGEDLEAAGHKAEKADAPREAAGE"
FT   gene            complement(39679..40584)
FT                   /locus_tag="Nham_0036"
FT   CDS_pept        complement(39679..40584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0036"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60938"
FT                   /db_xref="GOA:Q1QS59"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS59"
FT                   /protein_id="ABE60938.1"
FT                   /translation="MVTLKQLRYLAALARHGHFGRAAEACAISQPALSMQIRELEQFLG
FT                   VTLVERRPGEVMLTEIGREISRRAEDVLASARDLADFARHRSRPLTGRLTLGIIPSLAP
FT                   YLLPRMLPALQSQFPDLQLELRETQTRLLVEEVKGGALDAAMLALPLGEPDIDTMELFD
FT                   DLFLLAVPASDPRPCERRVAARDIDQSRLILLEDGHCLRDQALAFCATIPRTPAPGSTG
FT                   MTFGASSLATVMQMVAGGYGVTLIPQIAADVEARDDRIKVLRLEEPQPGRSIGLAFRRT
FT                   SPRKADFAALGEVVKGCTKT"
FT   gene            40839..43028
FT                   /locus_tag="Nham_0037"
FT   CDS_pept        40839..43028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0037"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60939"
FT                   /db_xref="GOA:Q1QS58"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS58"
FT                   /protein_id="ABE60939.1"
FT                   /translation="MDAKTNDKSAGKCPFTSGRSHRIRDWWPGQLDVQVLHHNSNLSDP
FT                   MDEDFDYAREFESLDLNAVIKDLTALMTDSQDWWPADFGHYGGLMIRLAWHSAGTYRIT
FT                   DGRGGAGAGQQRFAPLNSWPDNVLLDRGRRLLWPIKQKYGRKISWADLLVLSGNVALES
FT                   MGFKTFGFAGGRADVWEPEELYWGPEGTWLGDERYSGERQLAEPLAAVQMGLIYVNPEG
FT                   PNGKPDPIAAATDIRETFFRMAMNDEETVALIAGGHTFGKTHGAGDASLVGPAPESAPI
FT                   EDQGLGWNSKFGTGKGGDSIGSGLEVTWTQTPTTWDNNFFDTLFKYEWELTKSPAGAYQ
FT                   WQAKDAPAITPDAHDTSKKHVPTMLTTDLSLRFDPAYGKISKHFHENPDQFADAFARAW
FT                   YKLTHRDMGPRERYLGPLVPKETLIWQDPIPAVDHALVDDKDIAELKAKVLASGLTVPQ
FT                   LVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPAQLKTVLARLEAIQSEFNGA
FT                   QTGGKKVSLADLIVLAGCFAVEKAANDVGIDLKVPFTPGRMDASQDQTDVDSFAPLEPR
FT                   ADGFRNYIGSRHQFMTPEEALVDRAQLLNLTGPEMTVLVGGLRVLGANAADSRHGVFTK
FT                   QPGTLTNDFFANLLTMDTVWQPVAGQDDVYEGRDRKTNAVQWTGTRVDLIFGSHSQLRA
FT                   FAEVYACTDAKEKFARDFVAAWTKVMNADRFDLHR"
FT   gene            43211..43654
FT                   /pseudo
FT                   /locus_tag="Nham_0038"
FT   gene            43662..44258
FT                   /locus_tag="Nham_0039"
FT   CDS_pept        43662..44258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0039"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60940"
FT                   /db_xref="GOA:Q1QS57"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS57"
FT                   /protein_id="ABE60940.1"
FT                   /translation="MMKLYWSPRSRSFTALWLLEETGQPYERVLTDISTGAQKTPEFLA
FT                   INPMGKVPALTDGNAATAEAAAICAYVAERFPDAKLAPPLGDARRAKYLQWLFFGPSCI
FT                   EPAMIQIFTKLEVPSSTAAWGNATQVFDVLDKALEKGPWILGSDFSAADIVIGSALYYA
FT                   VRQFKMVPPRPTFDRYIDACMARAAFQRAETIAAG"
FT   gene            complement(44413..45261)
FT                   /locus_tag="Nham_0040"
FT   CDS_pept        complement(44413..45261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0040"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60941"
FT                   /db_xref="GOA:Q1QS56"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS56"
FT                   /protein_id="ABE60941.1"
FT                   /translation="MTESRMTHLMQGKRGLIMGVANDHSIAWGIAKTLAAHGAELAFTY
FT                   QGEALAKRVRPLAESVGAHLVLPCDVEDIASVDKVFADIGKAWGKMDFLVHAIAFSDKS
FT                   ELNGRYADTTRGNFERTMLISCFAFTEAAKRAAALMPDGGSMLTLTYNGGDRAMPNYNV
FT                   MGVAKAGLEASVRYLAVDFGEQNIRVNAISAGPIRTLAGAGIGDARFMFAFQQKHSPRR
FT                   RGVSLDELGGAGLYLLSDLSGGVTGEIHFVDSGYNIIAMPQPDALRSDGLGNGTPNDAA
FT                   K"
FT   gene            complement(45427..46650)
FT                   /locus_tag="Nham_0041"
FT   CDS_pept        complement(45427..46650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0041"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60942"
FT                   /db_xref="GOA:Q1QS55"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS55"
FT                   /protein_id="ABE60942.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLSSLFEAKSGITRADKYAELGFR
FT                   SQVQGAPTLNPADVIDRRAMRFLAEGAAWNHVAMEQAIRDSGLEPTDISNERTGIIMGS
FT                   GGPSARTIVEAADITRSKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAFETIQIGKQDIVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRAYDV
FT                   SRDGFVIAGGAGVVVLEELEHAKARGARIYGEVVGYGATSDGYDMVAPSGEGAERCMRM
FT                   AMSTVKTKVDYINPHATSTPAGDPPEIEAIRKVFGTGEKCPPISATKSLTGHSLGATGV
FT                   QEAIYSLLMMNNGFICESANITELDPAFADMPIVRKRIDNARVGTVMSNSFGFGGTNAT
FT                   LVFKRLDA"
FT   gene            complement(46736..47260)
FT                   /locus_tag="Nham_0042"
FT   CDS_pept        complement(46736..47260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0042"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60943"
FT                   /db_xref="GOA:Q1QS54"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS54"
FT                   /protein_id="ABE60943.1"
FT                   /translation="MQDRRSSYDYEGLLACGRGELFGPGNAQLPLPPMLMFDRITEITE
FT                   DGGEFGKGLIRAELDVKSDLWFFGCHFKGDPVMPGCLGLDALWQMVGFYLGWTGGEGRG
FT                   RALGLGDLKFSGQVLPHVRKVVYNVDIKRVMRSKLVLGIADGWLSTDGDIIYRAKDLKV
FT                   GLFKQDAAPGT"
FT   gene            48031..48528
FT                   /locus_tag="Nham_0043"
FT   CDS_pept        48031..48528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0043"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60944"
FT                   /db_xref="GOA:Q1QS53"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS53"
FT                   /protein_id="ABE60944.1"
FT                   /translation="MSTNENIVIVAEKDVDVAAIRHGRQPTLTGCPWHDVNEMLQSVGL
FT                   RPTRQRMALGWLLFGKGARHLTAEMLYEEATIAKVPVSLATVYNTLNQLTDAGLLRQVS
FT                   VDGTKTYFDTNVTAHHHFYLENNHELVDIPDPHLVLQKMPNVPEGYEISRIDMVVRLRK
FT                   KR"
FT   gene            complement(48625..49182)
FT                   /locus_tag="Nham_0044"
FT   CDS_pept        complement(48625..49182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0044"
FT                   /product="protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60945"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS52"
FT                   /protein_id="ABE60945.1"
FT                   /translation="MVGFRRGRVMMVKRLFASMVFAAAMLNAVGIEATANAKDSALSAS
FT                   GLPVPRYVSLKSDHVNVRAGPTKDNDVAWVYTKAGLPVEITAEFENWRRIRDSEGAEGW
FT                   VYHSLLSGRRTAVVTMKHKDDLAQLYSSADTESAVAARLQAGVVAQVKHCAAGWCHVAG
FT                   DGFDGWIQQQRLWGVYADEKIN"
FT   sig_peptide     complement(49090..49182)
FT                   /locus_tag="Nham_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.736 at
FT                   residue 31"
FT   gene            49669..50670
FT                   /locus_tag="Nham_0045"
FT   CDS_pept        49669..50670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0045"
FT                   /product="Glycolate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60946"
FT                   /db_xref="GOA:Q1QS51"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS51"
FT                   /protein_id="ABE60946.1"
FT                   /translation="MPVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDQPMTPEQLME
FT                   AVRTADILVSTVTDEITGNVLKQPDCKVKLIAQFGNGVDNIDVVAAHERGITVTNTPNV
FT                   LTEDTADMTMALILAVPRRFIEGAAMLTAGGDWPGWSPTWMLGRRLGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRKPVAPKIADELGATYWDSLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLIRRDAYVVNTARGTVIDEDTLTRLIEAGEIAGAALDVFEHEPAVNPRL
FT                   VRLAKAGKVVLLPHMGSATIEGRVEMGEKVIINIRTFLDAHKPPDRVLPNML"
FT   gene            complement(50818..51618)
FT                   /locus_tag="Nham_0046"
FT   CDS_pept        complement(50818..51618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0046"
FT                   /product="UBA/THIF-type NAD/FAD binding fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60947"
FT                   /db_xref="GOA:Q1QS50"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS50"
FT                   /protein_id="ABE60947.1"
FT                   /translation="MLSADELERYARHIVMREVGGPGQNALRNARVLMIGAGGLGAPAL
FT                   MYLAAAGVGTLGVIDDDVVTLSNLQRQIIHATSDIGSPKVESAADKIRALNPHVAFRAH
FT                   NMRLDAANAVALFADYDIVADGSDNFTTRYLVADACFLAKKPLVTAALGVFDGSLTTIR
FT                   GHEKNADGEFNPTYRCLFPEPPPEGTVPSCQQAGILGALAGVLGSMTALEVIREIVGFG
FT                   EGLVGRLLMVDARAMRFETLNYRRDPSNPLNGDHPTIRDLSGYR"
FT   gene            51840..53186
FT                   /locus_tag="Nham_0047"
FT   CDS_pept        51840..53186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0047"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60948"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS49"
FT                   /protein_id="ABE60948.1"
FT                   /translation="MRATIAAALMIVTTAIYAEAQPAGTNGRAGTKPSPPAHPAVQTPA
FT                   DTASAMTQAARQALQSDLAWTGHYNGIINGEVSDRLIAAIKAFQKDQGGKQTGVLNPQE
FT                   RGALASVARKSRSNVGWKTVSDASTGVRLGLPARLVPQRSSEGDDTKWSSSTGTIQILL
FT                   TRRKDADLTTAKLAEHERKQPAGRKIAYSAIKPDVFVLSGTQGLKKFYTRGQLRGNEAR
FT                   ILTVLYDQATEGTMEPVVIAMSSAFDPFPANGPPPRKIVEYATGVTVSRDGAILTGGDV
FT                   TDGCKSIVVAGHGNADRIADDKDHGLALLRIYGAHGLQPIALDGGATKGGLALVGIADP
FT                   QNQGGGAAVSQVKASVAQGADGGEPALSPAPALGFSGAAALDTNGKFAGLALLKPTDVA
FT                   GLSGSAPAAQAVLAPVEAVQAFLKANKVTPASGSSNANAAVVRVICVRK"
FT   sig_peptide     51840..51902
FT                   /locus_tag="Nham_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.899 at
FT                   residue 21"
FT   gene            complement(53229..54110)
FT                   /locus_tag="Nham_0048"
FT   CDS_pept        complement(53229..54110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0048"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60949"
FT                   /db_xref="GOA:Q1QS48"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS48"
FT                   /protein_id="ABE60949.1"
FT                   /translation="MPELPEVETVRRGLQPAMEGATIVRAETRRKDLRFPFQTDFVARL
FT                   EGQTVTGLGRRAKYLLADLASGDVLLMHLGMSGSFRVIDAAGATAPGDCHHPRNEDRAH
FT                   DHVSFTMSSGASVIFNDPRRFGYMKVIARTVLNDEPLLKGLGPEPLGNEFDAAMLARAC
FT                   RDKKTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPRRLAATLASKTGGPADRAGRLVE
FT                   AIHDVLNQAIKAGGSSLRDHRQTTGELGYFQHSFRVYDREGEKCRTPTCRGTVKRFTQN
FT                   GRSTFWCPVCQK"
FT   gene            54202..54963
FT                   /locus_tag="Nham_0049"
FT   CDS_pept        54202..54963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0049"
FT                   /product="demethylmenaquinone methyltransferase /
FT                   2-octaprenyl-6-methoxy-1,4-benzoquinone methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60950"
FT                   /db_xref="GOA:Q1QS47"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS47"
FT                   /protein_id="ABE60950.1"
FT                   /translation="MDQPGDTTHFGFRDVPLGDKQTLVNGVFHNVAQRYDLMNDLMSAG
FT                   LHRVWKDATITALNPPRNDTPFALLDVAGGTGDIAFRAAKAAGLGFRATVCDINPDMLA
FT                   VGHERAIKQHLDHQVSFVEGNAETLAFADRSFDAYTIAFGIRNVPRIDSALREAFRVLK
FT                   PGGRFLCLEFSTVDVPGLDKIYDLFSFKVIPPLGRAVTGDADSYQYLVESIRKFPKPNA
FT                   FADMIRDAGFARVTWQVLSGGIVALHSGWRL"
FT   gene            54972..56528
FT                   /locus_tag="Nham_0050"
FT   CDS_pept        54972..56528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0050"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60951"
FT                   /db_xref="GOA:Q1QS46"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS46"
FT                   /protein_id="ABE60951.1"
FT                   /translation="MTHAARLARAAFVFAREGVFGVVDPSLVPPPGQLALRMARLIERR
FT                   GAKSGPRLTRALTRLGPAYLKLGQFLATRPDVIGVAMARDLESLQDRLPPFSQAEAEAV
FT                   VAAALERPVAQAFASFGPSVAAASIAQVHRGEVEKGGVRKQVAVKVLRPNVASRFRRDL
FT                   SDFFFVANKAEAHSAEARRLRLVEVINTMSRSVAMEMDLRLEAAALSEMAENTRDDPDF
FT                   RVPTVDWDRTTHNVLTMEWIEGIALNDHARLAQSQIDLPELGRNVIQSFLRHALRDGFF
FT                   HADMHPGNLFVDDSGRLVAVDFGIMGRLGLKERRFLAEILLGFITRDYRRVAEVHFEAG
FT                   YVPGHHSVENFAQAIRAIGEPIHSRTAEEISMAKLLTLLLEVTGLFDMQTRPELILLQK
FT                   TMVVVEGVARSFDPKLDIWTVADPVVREWITQNLGPLGRVQGALAGAGELGRLLGGLPA
FT                   LASRTVSLIEQFETMAREGLTLGPATIAEIKRAEARSHRWSILALWVIAAALVGLLWTT
FT                   H"
FT   gene            56591..58030
FT                   /locus_tag="Nham_0051"
FT   CDS_pept        56591..58030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0051"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60952"
FT                   /db_xref="GOA:Q1QS45"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS45"
FT                   /protein_id="ABE60952.1"
FT                   /translation="MASLTVRKLDDAIKAELRLRAARNGRSVEDEVRVILREAATVTSS
FT                   TVATGNRAARNAAIPAGRNSFHQSNGLRNITLIIGGGIAAYKALDLIRRLKERGFIVRC
FT                   VMTNAAQQFVTPLSAGALAGTHAYTDLFDPGSEFDAGHIRLARDCDLIVVAPATADLMA
FT                   KMAHGLASDLATAILLAADKPILLAPAMNPLMWNNPATRRNVAQLARDGVAMIGPNAGK
FT                   MAEAGEAGVGRMAEPTEIATAAARILGPARPQPLEGKRVLVTAGPTREPIDPVRYIANR
FT                   SSGKQGFAIAAAAQAAGAEVTLISGPVDLDDPAGVTVAHVESAREMLAAVEAALPADIA
FT                   IFTAAVADWRVAHEGAQKLKKTAAGMPPLQLVENPDILATISKLRDTRPPLVIGFAAET
FT                   EHLIDNARAKFARKGCDWMVANDVSPGTGVMGGDRNTVHLLTRDGVGDEIKAESFPVMT
FT                   KEDVAAMLIERIVSTVTDQPT"
FT   gene            58027..58485
FT                   /locus_tag="Nham_0052"
FT   CDS_pept        58027..58485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0052"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60953"
FT                   /db_xref="GOA:Q1QS44"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS44"
FT                   /protein_id="ABE60953.1"
FT                   /translation="MSGAIRIDAQQLPHAEGLPLPAYHSSQAAGLDLMAAVPEQTPLVL
FT                   AAGQYAMVPTGLIIALPDGFEAQVRPRSGLAAKHGVTVLNSPGTVDADYRGEINVLLVN
FT                   LGNAPFTIRRGERIAQMIVAPVTRVELARAVSLSATSRGSGGFGSTGR"
FT   gene            58867..61383
FT                   /locus_tag="Nham_0053"
FT   CDS_pept        58867..61383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0053"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60954"
FT                   /db_xref="GOA:Q1QS43"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS43"
FT                   /protein_id="ABE60954.1"
FT                   /translation="MSDVVAVMRRTLLSCTSLVPGGIAGAGAACLVDISPAWATEPGLS
FT                   ERLIQTFTNLSRPDLTALALALGVLGFSVVAAILLMRTRIRAAANEQRLRTEIRELQSD
FT                   ADRFRALLFAEPQVLISWGAGEDRPQISGDIALLLPQDAKPPLRILAFGTWLPPEPALQ
FT                   MDHAVDALRNAGEGFLLNLVTSAGRTVEAMGRAIGGQAIVRIRDLGGLRRDLAETTLRH
FT                   NSLLAETGMLRAFAAAAPWPLWARGEDGNLNFANAAYARATEAASATDAIQRNLELLDS
FT                   DDRIAMARALNDHAAFAARLPVVIGGERRMYDVHALRAAGGSAGIALDASETAALSQAL
FT                   ERMADAHRRTLDQLSSGVAVFDGQRRLAFYNDSYRRLWDLDRAFLDGNPNDSSVLDRLR
FT                   AARKLPEQPDFRAWKARLHEAYRANEAAKDVWYLPDGRALSIVTTPNPEGGVTYLFDDV
FT                   TESLELARRYDRLITVQRETLDSLTEAVAVFGSNGRAQLFNPAFARMWKLSPEALSQQP
FT                   HIDTVEGWCKPLFDDDDAWQTIRNAVTGIDNRSAVRLKLERKDGSVLDCMTMPLPDGAT
FT                   MLTFHDITDSENVERALRERNDALETADQMKVDFVHHVSYELRSPLTTIIGFAHLMNDP
FT                   GTGPLTEKQAQYIDYITSSTDALLALTNNILDLATIDAGAMTLELGPVDVRKTIAAATE
FT                   GIQDRLTRERIVLEVDVDPDIGNFIGDERRIIQVLYNLLANAAGFSPQGAVIAVSARRT
FT                   AHSVSFAVTDDGPGIPPEVKDKVFDWFESRANGSRHRGAGLGLSLVRSFVELHGGRVHF
FT                   DPTVKRGTRVVCDFPLDQTAHRNAAE"
FT   sig_peptide     58867..58986
FT                   /locus_tag="Nham_0053"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.717) with cleavage site probability 0.507 at
FT                   residue 40"
FT   gene            61380..62903
FT                   /locus_tag="Nham_0054"
FT   CDS_pept        61380..62903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0054"
FT                   /product="protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60955"
FT                   /db_xref="GOA:Q1QS42"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS42"
FT                   /protein_id="ABE60955.1"
FT                   /translation="MTGPSTFATALANETATAHLMADLALLIGPGDVITLSGDLGAGKT
FT                   AAARAMIRYLAGDDTVEVPSPTFTLAQHYDLPCYPLLHADLYRINGPGELEEIGLAPLP
FT                   DATVVLIEWPERAAGALPTDRIDIAISHRPALGSAARAAEITGYGNAAAQVARLAALRR
FT                   FLDDAGYLDATRQHMAGDASTRSYARLIRSDGRFILMNAPRRPDGPAIHDGKSYSAAVH
FT                   LAEDVKPFVAIARGLRDHGFSAPAIHHADLESGFLITEDFGSAGFVEGTPPAPIAERYQ
FT                   VATDMLAALHCRTLPEILPVAPHIPYTIPVFDTEAMLVEVGLMLDWYLTDRGVEPSDDL
FT                   RAEFMAMWRVLLAKLAAAPKTWVLRDFHSPNLIWLEQRRDTGKVGVIDFQDTVLGPAAY
FT                   DLVSLLQDARVDVPESLELALLTRYMKARLGSGQPFDPAGFAELYAIMSAQRNTRLLGT
FT                   FARLNRRDGKPHYLRHQPRIWTYLTRSLAHPALSAIRAWHQAHVPPPSD"
FT   gene            63003..63323
FT                   /locus_tag="Nham_0055"
FT   CDS_pept        63003..63323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60956"
FT                   /db_xref="GOA:Q1QS41"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS41"
FT                   /protein_id="ABE60956.1"
FT                   /translation="MGAERRKGERVTFERGYGAHMMGIDGTWRRNCTMEDVSETGAKLT
FT                   VEGSIEGLHLKEFFLLLSSTGLAYRRCELAWVNGDQVGVNFLKQNDKKKKTGRRNDATA
FT                   DA"
FT   gene            63590..64312
FT                   /locus_tag="Nham_0056"
FT   CDS_pept        63590..64312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0056"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60957"
FT                   /db_xref="GOA:Q1QS40"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS40"
FT                   /protein_id="ABE60957.1"
FT                   /translation="MPVTPTKAMVLAAGLGLRMRPLTERMPKPMVPVAGKPLLDHVLDR
FT                   LADAGISEAVVNVRYLPDQIIDHVARRSRPRVIISDERDEVLGTGGAVVKALPLLGDAP
FT                   FFHLNADTMWIDGARPNLTRMTEAFDPARMDILLLMAPTASSIGYGGSGDYAMLPDGAL
FT                   RRRKENQVVPFVYAGAAIMSPALFAGAPSGEFSLTTMFDRANERERLFGLRLDGVWMHV
FT                   GTPDAVQAAEQAVLVSVA"
FT   gene            64411..67560
FT                   /locus_tag="Nham_0057"
FT   CDS_pept        64411..67560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0057"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60958"
FT                   /db_xref="GOA:Q1QS39"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS39"
FT                   /protein_id="ABE60958.1"
FT                   /translation="MRVRNVPTSVPFLRTVITALVDGALIEGFRPRAQPERLAEATLYL
FT                   PTRRAGRMARDIFLDVLNVDAVILPRIVALGDIDEDELAFAQAASSAEALQLPPALDGL
FT                   ARRLALAQLIEAWARQLKPGDPAQAPLVLGGPASTLALADDLARLMDDMATRGVDWRAL
FT                   DALVPDALDKYWQLTLDFLKIARDYWPAHLEEAGRIEPAVRRDRLIDAEAARLAAHHGG
FT                   PVIAAGSTGSMPSTAKLLHVIARLPHGAVVLPGLDTDLDDEAWQLIGGMRDGNGAFTAP
FT                   PAAGHPQFALHGLLRRFGIARRDVETLGVPAPYGREMLTSEAMRPSEATARWHTRLAEP
FT                   EVAEKIAAGMKNLAVIAAANPEVEALSIAAAMREARELNKTAALVTFDRALARRVMAAL
FT                   GRWNLAFDDSGGDALMDTPAGIFARLVAGTACNGLEPPTLLALLKHPLCRLGRVAGGWS
FT                   RAVATLELAILRGTRPPPGSKGLADEFARFCGELDKLDRGESSSLHRTEPRAALKLHRL
FT                   DESRALIAALRDALAPLEGDGASRSADFTAFAAQHREAIDVLSRDDQGVAAAFEGQHGL
FT                   ALAAAFDDLRKAGERSGLTVKIADYPEVFETAFGDRIVRRPQATAASLRIYGPLEARLT
FT                   QCDRVILGGLNESVWPPAPPSDPWLSRPMRHELGLDLPERRIGLSAHDFAQLLGADDVI
FT                   LSHAAKAGGSPAVASRFLHRLKAVAGPERWATALQAGTRYVQYAEAIDRPEQVTPVAQP
FT                   EPKPPRAARPTRLSVTAIEDWLRDPYTIYAKHILKLLPLEAVDMPLSAADRGSAIHNSL
FT                   GDFTKQYPAALPENPADVLRAIGESRFAPLMQRPEARALWWPRFQRIAAWFAEWEQSRR
FT                   PQLETIDAEIRGEISIPVASDRTFHLSARADRIEHLGDGRFTILDYKTGSPPSSKQVRL
FT                   GLSPQLTLESAILREGGFEGIPAGASVSELVYVRLSGNNPPGEPLQVNLDNGKTDMQSP
FT                   DQAADRALEELNALIRAFDNEQQGYPSLDLPMWKTRYGAYDDLARIKEWSAAGGLGIEE
FT                   W"
FT   gene            67557..71045
FT                   /locus_tag="Nham_0058"
FT   CDS_pept        67557..71045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0058"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60959"
FT                   /db_xref="GOA:Q1QS38"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS38"
FT                   /protein_id="ABE60959.1"
FT                   /translation="MKAPRPVHPDASARQQRASDPATSVFVSANAGSGKTHVLVQRVIR
FT                   LLLNGVDPARILCITFTKAAAANMSERVFSTLGHWVTLDDEALNAALRDTGIAQPDAWS
FT                   RQRARKLFAAALETPGGLKVQTIHALCTRLLQQFPFEARVPARFSVLDERDQTGMMERA
FT                   SISVMLDASQNPDSPAGRALQYAMGAAADTTLRDVVNQACLSRDHFMAWTEDRGIEQAI
FT                   SDVADALDVDPAERVEDVEREIVDGPNLPISEWEALAAILETGNKSDIEQARRLREAHA
FT                   MIGEAAQADRYLDVFLTGDSVLRKSFVTKKISDVRPDIAAMLDRESQRVIALLERRRAL
FT                   TIRDRTQSLLVIATAVAANYRREKQERGLLDYDDLIDKTLAMLDQTSPGWVHYKLDRGV
FT                   DHVLIDEAQDTSPKQWDIVERIIADFTTGEGAREGVRRTVFAVGDEKQSIFSFQGAAPR
FT                   EFDERRSKLERKFRDAELPFRKEDFIYSFRSGKTILESVDYVFRDAAIYTSIHAVGAHP
FT                   VHESLADAAPGVVDLWSLEERDARQQIEGWRAPFDAVSATSSEVKLARRIRNEVKTLIA
FT                   QGTMTGHLGDRRPLRYGDILVLVRRRGNAFDAIIQALKQSGIPVAGADRLKLTEHIAII
FT                   DLMNLADALLLPRDDLALAVALKSPLFGLDDDDLFAIAHNRKGSLRDALADHATANDKF
FT                   RDAFERLKMCETRAAHESPFAFYAWLLGGDGGRRRILRRLGHEANDALDEFLELALTYE
FT                   RKAPASQQGFMAWLRAADTDVKRDMEISRDEVRVMTVHGAKGLEASVVFLADTVTSPAD
FT                   TERLNLIRMSRGNAPAHAAGVTVWAGRKAEDPPDVVNARAAMIAETEHEYRRLLYVAMT
FT                   RAADRLIVGGCKPGNRKDVREHAWYDLIDKGLGKSGLAMREIETAAGTVKRFTRPGETE
FT                   PDAAGPATPVAAAPIALPPWLHSMAAPEAPAGPSLRPSDADDNAHHRIWPGESPDQRRR
FT                   ALLRGTLVHRLLQSLPDVPVDRRGDTALAYLGRNARDWSEAERDALAAQVLALIGDSQF
FT                   APVFTDGSRAEVAIAGRLTTRRGDPVLVSGQIDRLVVTREAVLIVDFKTNHAPPRNPAD
FT                   APPAYVRQLALYRAVLARLYPELPVKAALLWTETPEMMEISALALDAGLEAIISM"
FT   gene            71144..71464
FT                   /locus_tag="Nham_0059"
FT   CDS_pept        71144..71464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0059"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60960"
FT                   /db_xref="GOA:Q1QS37"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS37"
FT                   /protein_id="ABE60960.1"
FT                   /translation="MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEIS
FT                   GAMGDKVKIVKLNVDESPRTASKYGVMSIPTLMIFKGGELASRQVGAAPKQKLEQWITA
FT                   TV"
FT   gene            complement(71708..73036)
FT                   /locus_tag="Nham_0060"
FT   CDS_pept        complement(71708..73036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0060"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60961"
FT                   /db_xref="GOA:Q1QS36"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS36"
FT                   /protein_id="ABE60961.1"
FT                   /translation="MSAALPQQTPLGDVVARISKLHPKKIDLTLDRMWRILGQLDHPER
FT                   RLPPVIHVAGTNGKGSTVAYLRAILEAAGLRVHVFTSPYLVRLNECVRLAGTLVGDDDL
FT                   RDALLECERVNGGEPLTQFEIKTAAAFLLFTKIPADALLLEVGLGGRLDSTNVVETPLA
FT                   SVITPIGIDHTEFLGDTLAQIAGEKAGIIKRGVPVISAEQMPEAQAVIEQRAKQMRGPL
FT                   HAAGQDWHVSVEHGRLVYQDERGLLDLAAPRLFGRHQFDNAGLAIATLRAQDRFSIDTA
FT                   AFERGVTGAEWPARMQRLTSGRLVDQAPRDAELWLDGGHNVDGGRVAAAALGDLEERVS
FT                   RPLVVIAGMMGNKDAKGFLANFTGLTRHVIAVPIPDMENAMPPDVLADAVRALDMRAET
FT                   AADVKAALQSLARLAYEIPPRILIAGSLYLAGHVLAENGTQPS"
FT   gene            complement(73033..73977)
FT                   /locus_tag="Nham_0061"
FT   CDS_pept        complement(73033..73977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0061"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60962"
FT                   /db_xref="GOA:Q1QS35"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS35"
FT                   /protein_id="ABE60962.1"
FT                   /translation="MNWLTNVVRPKIRNILKRETPENLWIKCPDTGQLVFYKDVESNQF
FT                   VIPGSNYHMRMSADARLRSIFDNETWYDVALPEVTADPLKFRDERKYVDRIKDARTKTG
FT                   LHDSVKVGFGKLEGAGVVVAVQDFDFMGGSLGMAAGEAIVRGLELAVEKQCPFIVFAAS
FT                   GGARMQEGVLSLMQLPRTTVAVQMLREAGQPYIVVLTNPTTGGVTASYAMLGDVQIAEP
FT                   GALIGFAGARVIEQTIREKLPNGFQRAEYLRDHGMVDMVVHRHDLRPTLARLCRLLTKA
FT                   PEIDAAPEPSPAAEEPAEPMPAPEAAAPSAPPA"
FT   gene            complement(74164..75000)
FT                   /locus_tag="Nham_0062"
FT   CDS_pept        complement(74164..75000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0062"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60963"
FT                   /db_xref="GOA:Q1QS34"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS34"
FT                   /protein_id="ABE60963.1"
FT                   /translation="MTTRIDTRFAELKKQGRSAFVTFLMGGDPDPATSLAIIKALPKAG
FT                   ADIIEIGMPFTDPMADGPAVQAAGRRALNAGMTVTRTLQMIHDFRKGEGSTPVVLMGYY
FT                   NPIYIYGVEKFLTDAKAAGVDGLIVVDLPPEEDSELCIPAMKAGLNFIRLATPTTDDKR
FT                   LPAVLANTSGFVYYVSITGITGSAAADSTAVGAAVARIKRHTTLPVCVGFGIRTADAAR
FT                   GIAERSDGAVVGSALVDALSGSLDAEGKATAKTVNAVADLAAALAAGVRSARQAAE"
FT   gene            complement(74997..76241)
FT                   /locus_tag="Nham_0063"
FT   CDS_pept        complement(74997..76241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0063"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60964"
FT                   /db_xref="GOA:Q1QS33"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS33"
FT                   /protein_id="ABE60964.1"
FT                   /translation="MNSLPNSFRSGPDARGHFGIFGGRFVAETLMPLILDLEKAYTEAR
FT                   ADAAFQRDMAGYRKDYIGRPSPLYFAERLTEHLRDISAASGRAGGAKVYLKREELNHTG
FT                   SHKVNNVLGQILVARRMGKKRIIAETGAGQHGVATATLCARFGLECVVYMGAVDVARQE
FT                   PNVIRMEMLGAKVVPVQSGTRTLKDAMNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVR
FT                   DFQSIIGDETRAQMQEAEGRLPDSLIACIGGGSNAMGLFHPFLDDSSVEIFGVEAAGHG
FT                   LDKLHAASLTGGRPGVLHGNRTYLLMNDDGQIQDAHSISAGLDYPGIGPEHSWLHETGR
FT                   VTYLSATDEEALSAFQLLSRLEGIIPALESAHAIARVVELAPERPKDHLMVVNLSGRGD
FT                   KDVPQVGDILKGRRK"
FT   gene            complement(76389..77066)
FT                   /locus_tag="Nham_0064"
FT   CDS_pept        complement(76389..77066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0064"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60965"
FT                   /db_xref="GOA:Q1QS32"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS32"
FT                   /protein_id="ABE60965.1"
FT                   /translation="MSLIVKICGLSTPATLDVTLQGGADMVGFVFFPPSPRHLDLSRAR
FT                   ELGAQVRGRAGKVALTVDADDATLGGIIEALRPDLLQLHGKETVARIREIKRTFGLPIM
FT                   KAIGIETAGDLAALPGYAAVADRVLFDAHPPKDATRPGGLGVPFDWRLLENLAPGIPFM
FT                   LSGGLTAGNVDAAVRTTRAGGVDVSSGVESAPGVKDAGMIGDFIRAARAAEINLREATS
FT                   HVG"
FT   gene            complement(77344..77691)
FT                   /locus_tag="Nham_0065"
FT   CDS_pept        complement(77344..77691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60966"
FT                   /db_xref="GOA:Q1QS31"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS31"
FT                   /protein_id="ABE60966.1"
FT                   /translation="MRKFLTGLVLIPLGVLFIVFAFANRHLVTVTFDPFDASDPLAGVT
FT                   LPLFVLIIAVAIFGVVAGSVATWFGQRRWRHTARQYETDAREARVELADLRSRWESRDT
FT                   QRLPDLTRRAG"
FT   sig_peptide     complement(77620..77691)
FT                   /locus_tag="Nham_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.696 at
FT                   residue 24"
FT   gene            complement(77777..78082)
FT                   /locus_tag="Nham_0066"
FT   CDS_pept        complement(77777..78082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0066"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60967"
FT                   /db_xref="GOA:Q1QS30"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS30"
FT                   /protein_id="ABE60967.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVTALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGEHVPVDQKSVPFFKTGKEMRERLNRENATSEASA"
FT   gene            complement(78251..79228)
FT                   /locus_tag="Nham_0067"
FT   CDS_pept        complement(78251..79228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0067"
FT                   /product="signal peptide peptidase A, Serine peptidase,
FT                   MEROPS family S49"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60968"
FT                   /db_xref="GOA:Q1QS29"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS29"
FT                   /protein_id="ABE60968.1"
FT                   /translation="MSIESDVIVDRRRLRRKLTFWRVASVLIAIAAVVAVGAYATPWGR
FT                   ALTGASAIQRVNIEGLIRNDQNRVEALERLGKSNAPAVIVHINSPGGTTAGSEQLYDAL
FT                   MRLKAKKPMVVVVDGLCASGGYIAALASDHIIAQQTALVGSIGVLFQYPNFTDLLKTVG
FT                   VKVEEVKSSPLKAAPNGFEPTSPEARAALDALVKDSYAWFRGLVQTRRGMDNGQLEKVA
FT                   DGRVFTGRQAVDLKLIDQLGDEKAAIAWLVAEKKITPDLPVRDFKLSPRFGDMTFLRTA
FT                   ASVTFDALGLSSIARQVEQTGIVRAADRLGLDGMLALWQPAPSN"
FT   sig_peptide     complement(79106..79228)
FT                   /locus_tag="Nham_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.910 at
FT                   residue 41"
FT   gene            complement(79411..80151)
FT                   /locus_tag="Nham_0068"
FT   CDS_pept        complement(79411..80151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0068"
FT                   /product="protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60969"
FT                   /db_xref="GOA:Q1QS28"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS28"
FT                   /protein_id="ABE60969.1"
FT                   /translation="MIGAAVKALAQILSPPMRAILWRVIGLALVLIAVSAVGLQRLLSW
FT                   LAGSGELWAETVLGPTFHTPLNILAWIVSIAAGFGIVFGAVFLMPTISSLVAGVFVDDV
FT                   GEIVEREHYPAEHSGAPLPFGLAMTEGVKTALLTLLVYLIALPFVFVAGAGFIAFFIAT
FT                   AWLLGREYFELAAMRFRSPAEAKAMRRDNASTVFLGGLIIAAFVAIPIVNLATPLFGMA
FT                   FMVHMHKRLSGPRPELIAPDRRSR"
FT   gene            complement(80250..80744)
FT                   /locus_tag="Nham_0069"
FT   CDS_pept        complement(80250..80744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60970"
FT                   /db_xref="GOA:Q1QS27"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS27"
FT                   /protein_id="ABE60970.1"
FT                   /translation="MTGADVPAPELAVSQWFNTGEPLTLAALRGRPVLLHAFQMLCPGC
FT                   VAHGTPQTQRAFELFKATDLQVIGLHTVFEHHAAMTPVSLQAFIHEYGLTFPIGVDAAG
FT                   EGTPLPVTMSRYRMQGTPTSILIGRDGRIVHHGFGQQSDMALGAMIAAELAGAQTYAAK
FT                   A"
FT   gene            complement(80741..81676)
FT                   /locus_tag="Nham_0070"
FT   CDS_pept        complement(80741..81676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60971"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS26"
FT                   /protein_id="ABE60971.1"
FT                   /translation="MGLVLDTVGKWIAAYLQKEVRGYEPFTPSDPEHLRDTIREGDVLL
FT                   IEGNSRISGIIKYLTQSTWSHSALYVGPVDGAVEPDGEPHVLIEADIGEGVTSAPLSKY
FT                   FPYHTRLCRPVGLSHEDRVTVCRYAINRIGFGYDTKNIVDLMRYLIPLPVPQRWRRRMI
FT                   AFGSGDPTKIICSALIAQAFEAVRYPILPKITRAGSRKARREILHIRDSSLYMPRDFDI
FT                   SPYFEIVKPTIERGFDYLSLHWADRQKPLAEGAGVFGPFQAEGLSPPSVPASHDAAPAP
FT                   VEEVSAIERAAVAEHQLRVERAPQPVRGNP"
FT   gene            81788..83302
FT                   /locus_tag="Nham_0071"
FT   CDS_pept        81788..83302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0071"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60972"
FT                   /db_xref="GOA:Q1QS25"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS25"
FT                   /protein_id="ABE60972.1"
FT                   /translation="MRVAAGASMRQVRESFLHFQCFGNHAMRMTRRDFLSASAAFATGI
FT                   GIGRARTAPLPREADVVVIGAGAAGIAAARRIQAANRKVIMIEAADRIGGRCHTDMKTF
FT                   GTPFDRGARWLYDPDTNPMAGLARSAGTGVFAAPPGQKIRIGRRNARAGETEQFLAALV
FT                   RAKRAIGEAAHGRTDVACASVLPGDLDVWTGTIDFVLGAGATGKDLKDLSAMDRARAAE
FT                   RNAAIGCKQGLGALLAALGQSLPTSLLTPASRVSWAGRDIGVETPAGRISARAVIVTVS
FT                   TNVLTSGNIRFTPELPKRQLDAAARLSLGSYDRVALWLPDNPLGLGRNETMIEQSSDGK
FT                   TALLAANASGSSLCTIDVAGSFGRDLSAQGEGAMVAFATEWLAKLFGSDAAAAVKRSAA
FT                   TRWNAAPHVLGAMSAAEPGGQPSRKVLMEPLGSLFLAGEAAHETLWGTVGGAWESGERA
FT                   ADAALRKVGATKEPAQPSASTRKPSRHHRRAPSRRSQDAYGFPLPR"
FT   gene            83299..83970
FT                   /locus_tag="Nham_0072"
FT   CDS_pept        83299..83970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0072"
FT                   /product="protein of unknown function DUF71, ATP-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60973"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS24"
FT                   /protein_id="ABE60973.1"
FT                   /translation="MMRPRALISWSSGKDSAFALHEVRRAGAFDVVGALTTVNETFGRV
FT                   SIHGVREEVLCAQLAAAGLPAWRVPIPYPCSNEVYEARMGAAMADAMRDNITHIIFGDL
FT                   FLTDVRAYREQKLAGTGIAPVFPLWGRPTAALACEMIASGLETRLVSVDRAKLDLSFAG
FT                   RSFDRTLLADLPAGIDPCGENGEFHTCVTAAPVFSQPIEVASGEVVERDGFAYCDLLLA
FT                   E"
FT   gene            complement(84211..86664)
FT                   /locus_tag="Nham_0073"
FT   CDS_pept        complement(84211..86664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0073"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60974"
FT                   /db_xref="GOA:Q1QS23"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS23"
FT                   /protein_id="ABE60974.1"
FT                   /translation="MKFTLSWLKEHLDTDEPLDKLADKLTMIGLEVEHIDDKAKALAPF
FT                   TIARVISAAQHPNADRLRVCMVDTGETDDKGGPAPIQVVCGAPNAREGLVSVFAPPGTH
FT                   IPGKDITLGVGTIRGVESRGMLCSAAELEISDNHDGILELPDDAPVGAGYAEWAGLGDP
FT                   VIEINLTPNRQDCTGVHGIARDLSAADMGRFKDPTIKPVKGEFPCPVKVTVEDAALCPG
FT                   FALRLVRGVTNGPSPEWLQKRLTSIGLRPINALVDITNFMTYDRARPLHVFDANKVQGN
FT                   LTVRRARDGETLLALDGRTYTLDPSICVIADDKGVESLAGIMGGEQSGCDETTTDVLIE
FT                   SALWSEINIAQTGRKLGINSDARYRFERGVDPAFMVPGLEMATRLVMELCGGTPSDTVV
FT                   AGQALPDDRVIDFPLTETRRLAAIDVPLVEMRRILSHLGFMVAGNGPVVKVAIPTWRTD
FT                   VTGKADIVEEIVRIVGVDKVPMTPFDRGDAPRKPVLTPIQSRTRRGRRALAVRGMVEAV
FT                   TWSFIAKPQAELFGGGAKELALANPIASDLSDMRPSLLPGLVAIAQANADRGFPDVALF
FT                   EVGQIFRGDGPQDQFMAAAGIRRGVASSAGIGRHWSGSATADGLDANTFDVKADALAVL
FT                   AAAGAPVQALQIAAGSESKNFPAWLHPGRSAAIQIGPQNVLGYFGELHPRVLEALRADG
FT                   SLLAFEVILDRIPEGKQKPTRAKPVLELPAFQPVSRDFAFIVDRCVKAADIVRAAQGVD
FT                   RKLVSGVTVFDIYEGKGIEANKKSVAIAVTLQPRDKTLTDQEIEAVAAKVVAEVAKRTG
FT                   GSLRG"
FT   gene            complement(86661..87767)
FT                   /locus_tag="Nham_0074"
FT   CDS_pept        complement(86661..87767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0074"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60975"
FT                   /db_xref="GOA:Q1QS22"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS22"
FT                   /protein_id="ABE60975.1"
FT                   /translation="MSDLEQLQSQILADIASASDEAALEAVRVATLGKKGSISALLSTL
FT                   GKMSPDERKSEGAKINLAKDTVTQALAARREVLKALALDARLASETIDVTLPLRESPAE
FT                   AGRIHPLSQVWDEVTTIFADMGFAVAEGPDIETDDYNFTRLNFPEGHPAREMHDTFYFN
FT                   PKEAAGSEAGEKPSRLLLRTHTSPVQVRTMLSQKPPIRVICPGRTYRSDSDQTHTPMFH
FT                   QVEGLVIDKSSHLGHLKWILHEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDIQCRRDK
FT                   NEIRFGEGEDWLEILGCGMVHPNVLKLCGLDPEVYQGFAWGMGIDRIAMLKYGIADLRQ
FT                   LFEGDVRWLNHYGFRPLEVPTLAGGLSS"
FT   gene            complement(87949..88308)
FT                   /locus_tag="Nham_0075"
FT   CDS_pept        complement(87949..88308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0075"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60976"
FT                   /db_xref="GOA:Q1QS21"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS21"
FT                   /protein_id="ABE60976.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKITKGFSGRRKNTIRAAKAAADKAGQY
FT                   AFRDRKRKKRTFRALWIQRLNAAVRPFGMTYSVFINGLSKSGITVDRKVLSDLAINEPA
FT                   AFQAIAEKAKAALAA"
FT   gene            complement(88378..88578)
FT                   /locus_tag="Nham_0076"
FT   CDS_pept        complement(88378..88578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0076"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60977"
FT                   /db_xref="GOA:Q1QS20"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS20"
FT                   /protein_id="ABE60977.1"
FT                   /translation="MPKLKTKSGAKKRFKVTGTGKVVSAHAGKRHGMIKRTKKQIRQLR
FT                   GTRILFKTDGDNIKKYFLPNA"
FT   gene            complement(88906..89421)
FT                   /locus_tag="Nham_0077"
FT   CDS_pept        complement(88906..89421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0077"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60978"
FT                   /db_xref="GOA:Q1QS19"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS19"
FT                   /protein_id="ABE60978.1"
FT                   /translation="MPVAKDGPRTNDEIRNAQVQLIDQEGTNQGTVETISAIKMAMDAG
FT                   MDLVEIAPNSSPPVCKIMDYGKYKFQAQKKAAEARKRQKIVEIKEIKLRPMIDDHDYNV
FT                   KMKAMQRFFEEGDKVKITLRYRGREMAHQDIGTKLLDKVKTDVAAYAKVEQDARFEGRQ
FT                   VVMVLAPR"
FT   gene            89676..90449
FT                   /locus_tag="Nham_0078"
FT   CDS_pept        89676..90449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60979"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS18"
FT                   /protein_id="ABE60979.1"
FT                   /translation="MTNGTAAQFIEVGGGNAMRRIAVRARDGNSPGLFWLGGFRSDMAG
FT                   TKALALDAWAAERGRACVRFDYSGHGESAGAFTDGTIGRWLEESLAVFDAFCEGPQVVI
FT                   GSSMGGWIALLLARALARREAPRAPLAGLVLIAPAPDFTEELMWKGFSPEARSAIETEG
FT                   VWLRPSDYGDPYPITRNLIEDGRRHLLLGGSITTGCPVRILQGAQDLDVPWRHAFALTE
FT                   RLPSDDVVLTMIRDGDHRLSRPQDIARILAAVAEF"
FT   gene            complement(90511..92751)
FT                   /locus_tag="Nham_0079"
FT   CDS_pept        complement(90511..92751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60980"
FT                   /db_xref="GOA:Q1QS17"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS17"
FT                   /protein_id="ABE60980.1"
FT                   /translation="MGRKIVLLSDGTGNSAAKVWRTNVWRTFEAIDLSGADQVAFYDDG
FT                   VGTSSFKPLAILGGAFGFGLKRNVIDIYKFACRNWRDDSDELFGFGFSRGGFTIRVVMG
FT                   LILNQGLVAADSEAELSRKAKAAYRQYRRERFHTVWHIEDIFRGIRDLFLRKGYDKRDN
FT                   RRVDHIRFIGVWDTVAAYGLPLDEMTRGVSKWIWPLELPNHTLDCTRVRRACQALSLDE
FT                   PRTTFHPELWDERGAPPLAPRDDGNRHLADEQISQVWFAGVHSNVGGGYPDDALAFIPL
FT                   VWMLRQAGACGLRLKSDRATPPADPDPLKNAISMCDKDGRLYDPRKGLGSYYRYGPRKL
FT                   AELCDFRFSRNDEVVVARPKVHVSAFKRIASRSQDYAPVGLPKIYDVVTDDGLVLTPDQ
FT                   YGFESSARALARTETQEHVWNEIWKRRLVYFATVGSTAWLLLYPLARSLPAADEYTSPI
FT                   RWVSDIIRIVGGFLPGFAQTWINAYARSPGQFLVLLALAGGLTFWGTRLATRISDSMNA
FT                   IWQRTPTAPTGLPTNWIYRLRASGPYIWFHRQLKRRWAPTFFAGLFVYLGITLGSHLIY
FT                   NVQDVAGWTCNESPKVRGLARGEQATFDFSTSHFCAGTGIAVDGFGARYLVQVETTTPW
FT                   QDGDIPSPLGGFYTTDAPRWSQRVWLMLGVPLRRELTRPWFRLVLRYGTTGGEEVFLDP
FT                   DPEDGKVETMIRPTRSGELFIFVNDAVLGIPGLYDVFYRNNEGSAKLVVTRK"
FT   gene            complement(93054..94781)
FT                   /locus_tag="Nham_0080"
FT   CDS_pept        complement(93054..94781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0080"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60981"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS16"
FT                   /protein_id="ABE60981.1"
FT                   /translation="MFFFKKWSIAKENAAKTAAISKSQAVIEFRLDGTVITANENFLNI
FT                   LGYGLADVQGKHHSMFVEADERSSAAYRDFWARLNQGESQSAEYKRIDRDGEEVWVQAS
FT                   YLPVLDARGKPTKVIEIASDITAKKIEALDHAGQVSAIERTQAVVEFNLDGTIITANKN
FT                   FLNALGYALGEVQGKHDRMFVEPSERAGAAYREFWAKLNQGQAQSAECKRIGKAGNEVW
FT                   IQATYNPIADENGKPFKVVTFATDVTSQKLKMANLESQITAIGKSQAVVEFGMDGKVIT
FT                   ANDNSLKTFGYSLAKEVQGKHHSMFVEAGERASTAYRDFWARLNRGESQSAEYKRIGKD
FT                   GKEIWVQASYNPVLDSKGKPTKVIQLATDITARKIEALDNAGQLAAIDRAQAVAAFNLD
FT                   GTIIAANDKYLKAMGYTLGEVRGKHDGMFVEPSERAGAAYRDFWARLNRGESQSAEHKR
FT                   IGKDGKEVWIQASYTPILDLNGKPIKVVEYATVIESVADGSEEGSLSIQEAPVSVANQA
FT                   ADDITSESVGPSLSMRRLEASRKNASAGPSLFSNLLANLRDGLSNAMVSSARAVTNFL"
FT   gene            complement(95235..95309)
FT                   /locus_tag="Nham_R0001"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(95235..95309)
FT                   /locus_tag="Nham_R0001"
FT                   /product="tRNA-Gly"
FT   gene            95549..96481
FT                   /locus_tag="Nham_0081"
FT   CDS_pept        95549..96481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0081"
FT                   /product="thioredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60982"
FT                   /db_xref="GOA:Q1QS15"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS15"
FT                   /protein_id="ABE60982.1"
FT                   /translation="MSIVEQGSGPPPQASNLIRETTAQTFMNDVVEESMRQPVLVDFWA
FT                   PWCGPCRQLTPILEKAVLAGGGKVKLVKMNIDQHPAIFQQLAAQIGNQSIPAVFAFTGG
FT                   RPVDYFTGAAPESQVNAFIDKLTQGMAAPGAPNIEEILQEAEAALVAGDPATAASIYAE
FT                   VVGFDAANLPAIAGLARCYATTGALDKAKQTLALVPESKRGDAAVATVQAMIDLAEQAS
FT                   SLGPVADLERKVAENPLDHQARFDLATALNASGNRNDATGHLLEIVKRDRKWNDDAARK
FT                   QLVQFFEAWGAADEATVEGRKRLSTILFS"
FT   gene            96539..97213
FT                   /locus_tag="Nham_0082"
FT   CDS_pept        96539..97213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0082"
FT                   /product="peptidase S16, lon-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60983"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS14"
FT                   /protein_id="ABE60983.1"
FT                   /translation="MPINADYRGPGDLPEVIPVFPLPGALLLPRGQMPLNIFEMRYLAM
FT                   VDDAFRDGHRLIGMIQPDITNSASEDRPKLFGVGCVGRITQFAESGDGRYILELTGVSR
FT                   FRVAEELTVLTPYRQCKVDFFAYADDLTARKGEDAVDRERLLAVLTDFLKVNELKVDWE
FT                   GIETAPNEALVNALAMMSPYGPPEKQAMLEAPDLKTRAEILIAVTEMDLAKKRTSGDPG
FT                   LQ"
FT   gene            97255..97452
FT                   /locus_tag="Nham_0083"
FT   CDS_pept        97255..97452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0083"
FT                   /product="protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60984"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QS13"
FT                   /protein_id="ABE60984.1"
FT                   /translation="MTTPSDRPEDTVDRKLLEILVCPVTKGPLEFDGARQELISRSAKL
FT                   AYPIREGIPIMLPEEARKIE"
FT   gene            complement(97735..99084)
FT                   /locus_tag="Nham_0084"
FT   CDS_pept        complement(97735..99084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0084"
FT                   /product="ammonium transporter"
FT                   /note="TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60985"
FT                   /db_xref="GOA:Q1QS12"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS12"
FT                   /protein_id="ABE60985.1"
FT                   /translation="MRFERPARAGLAIAAILGAAGLAGFADTALAQTAVAVAPAATSPP
FT                   KIDSGDTAWMLTATALVLMMTIPGLALFYGGMVRKKNVLATVMQSFAIACLVSVLWMVI
FT                   GYSWAFTEGTNFLGGASRMLLMGMGTDSIAAAAPTIPESVFMCFQMTFAIITPALICGA
FT                   IADRMKFSAMMWFMGLWSLLVYAPIAHWVWGGGFLGGLGVLDFAGGTVVHINAGVAGLV
FT                   CALVLGKRKGYGSENMAPHNLVLTVIGASLLWVGWFGFNAGSAVTAGGQAGMAMAVTQI
FT                   ATAAAALAWMAVEWGLRGQPSVLGICSGAVAGLVAITPASGFVDPTGALVIGAAAGVGC
FT                   YWGATGLKHMMGYDDSLDAFGVHGVGGIIGALLTGVFARTAINKAGTGLIDGNAHQVVI
FT                   QIYGILATVVYDAIVTLIILLAIKAVIGLRVSGENEREGLDITQHGEVVQ"
FT   sig_peptide     complement(99004..99084)
FT                   /locus_tag="Nham_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.603 at
FT                   residue 27"
FT   gene            complement(99122..99460)
FT                   /locus_tag="Nham_0085"
FT   CDS_pept        complement(99122..99460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0085"
FT                   /product="nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60986"
FT                   /db_xref="GOA:Q1QS11"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS11"
FT                   /protein_id="ABE60986.1"
FT                   /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYAVSFLPKVKIEVAVNSGQVDTVIEAIASAARTGRIGDGKIFVINLEHAVRIRT
FT                   GDLDADAI"
FT   gene            complement(99872..100210)
FT                   /locus_tag="Nham_0086"
FT   CDS_pept        complement(99872..100210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0086"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60987"
FT                   /db_xref="GOA:Q1QS10"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS10"
FT                   /protein_id="ABE60987.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTAVGAHGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYVVNFLPKLRIEVAVASELADKTVEVITAAARTGQIGDGKIFVMPIDHALRIRT
FT                   GETDNDAL"
FT   gene            complement(100358..101218)
FT                   /locus_tag="Nham_0087"
FT   CDS_pept        complement(100358..101218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0087"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60988"
FT                   /db_xref="GOA:Q1QS09"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS09"
FT                   /protein_id="ABE60988.1"
FT                   /translation="MSKSLIDLISILDLEPIEENLFRGNSPKTSWQRVFGGQVIGQAMV
FT                   AACRTVEGRLPHSLHCYFILPGDPAIPIIYEVERLRDGKSYSTRRVTAIQHGHAIFSTM
FT                   VSFHAPEQGAFDHQDRMPDVPPPEKLTPEEFAKQPMFKEMPDFIRRYYESDRPIELRPV
FT                   ELNRYFGERIDDGRTHVWIRTAAKLPDDPALHMCALAYASDFSLLDAVMARYGRTLFDK
FT                   RMMAASLDHAMWFHRPFRADEWLLYAQDSPSARDGRALARGLIFRRDGTLVASVVQEGA
FT                   VRERR"
FT   gene            101377..102597
FT                   /locus_tag="Nham_0088"
FT   CDS_pept        101377..102597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0088"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60989"
FT                   /db_xref="GOA:Q1QS08"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS08"
FT                   /protein_id="ABE60989.1"
FT                   /translation="MTTQRSIVICGGGFAGLALALALRQGLGAGVPIVVADPALANRSS
FT                   RDPRATAIVAACRRLFEALGVWDEVAGTAQPILDMVITDSRLEDATRPVFLTFAGDVEP
FT                   GEPFAHMIENGHLIEALVSRASAEGVDLRATAVTGSDLRSGGVMVSLADGATIDASLLV
FT                   AADGARSRLRERAGIATHGWEYDQSGIVVTVGHERDHQGRAEEHFLPAGPFAILPLTGR
FT                   RSSLVWTEKRADAARIVALAEEDFHAALEQRFGLHLGEIKALDKPRAFPLHYFVARSFI
FT                   AERLALVGDAAHVIHPIAGQGLNLGLKDVAALAETVVDAVRLGIDPGQADVLERYQRWR
FT                   RFDTVAMGFATNTLNVLFSNESTLLRGVRDIGLGLVDRMPPLKNAFIRQAAGLTGEVPR
FT                   LLKGEAL"
FT   sig_peptide     101377..101439
FT                   /locus_tag="Nham_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.543 at
FT                   residue 21"
FT   gene            102806..104077
FT                   /locus_tag="Nham_0089"
FT   CDS_pept        102806..104077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0089"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60990"
FT                   /db_xref="GOA:Q1QS07"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS07"
FT                   /protein_id="ABE60990.1"
FT                   /translation="MATTASSRAAQGAASPTEFAASPAESAASRAASTTACERSPFART
FT                   AELLAPYQPGQPPITLSVGEPQHPPPDFVAPILSQHINEFRRYPIARGIEPFRHAAANW
FT                   LSRRFALPRAVDPETEILVLNGSREGLFLAAIAAVRYVATRKGVPAILVPNPFYPAYGA
FT                   GARAAHCETIFLPTTRANGFLPDLDALDEATLARTVAIYLASPANPQGAVASSDYFTRL
FT                   IALARRHGFLVFSDECYSEIYTQAPPGSALECAGPDYANVVAFQSLSKRSNLPGIRVGF
FT                   AAGDRNFLAAFHELRNVAAPQVPVPLQHVAVAAYGDEAHVEENRRLYRIKFDLADRILG
FT                   HRYGYARPAGGFCVWLDVSAHGGDEAAAVKLYKEAGVRVVPGSYLARPQADGSNPGAGY
FT                   IRLALVPDTETTAEALHRLVKTLG"
FT   gene            104090..106597
FT                   /locus_tag="Nham_0090"
FT   CDS_pept        104090..106597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0090"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60991"
FT                   /db_xref="GOA:Q1QS06"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS06"
FT                   /protein_id="ABE60991.1"
FT                   /translation="MSMAAIERLLPIVDHLPPSIRDPLARRLRELTGLGLIGLSGSAAA
FT                   ALMTWSVQDPSLSHATSRAIHNVLGYPGAIGADLLMQILGLGAIMLILPVAIWGWRMLT
FT                   HRPFDREATRLACWILCTSAAAGFASCWPHNGAWPLPTGLGGVVGDALVRAPAILFGPA
FT                   SVLQRIVFGAIFLAVMAATFLWAGGMGSRPRDESAGIDDDDAPFDDGGDHASVSLGWAV
FT                   HALMSAKARFKRLRLGALLTLAYKSLVSSAPRKTAALAFERHEPNLSGGPTAPSLVPAH
FT                   GGIDDEDADADTDTDTDTDTDDEDTEDDDAPVVRAPRRKAAPRQPAKKSGKFDLPSVNV
FT                   LSAPRAADRQPLSKSELEANSRALEGVLGDFGVRGEILKANPGPVVTLYELEPAPGIKS
FT                   SRVIGLADDIARSMSALSARVAVVAGRNAIGIELPNAHREKVYLRELLTAKEASETVAK
FT                   LPLCLGKNIGGESIIVDLARMPHLLIAGTTGSGKSVAINTMILSLLYRLRPDQCRLIMV
FT                   DPKMLELSVYDGIPHLLTPVVTDPKKAVVALKWAVREMEERYKKMSKLGVRNIDGYNQR
FT                   LVESRGKGEELTRTVHTGFDKETGKAIYEEEKLDLEPLPYIVIIVDEMADLMMVAGKDI
FT                   EGAVQRLAQMARAAGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEM
FT                   GAEQLLGQGDMLYMAGGGRISRVHGPFVSDEEVEKVVRHLKTQGQPEYLEAVTAEEPTD
FT                   EDGAVFDGTSMGSDGGGDLFSQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELE
FT                   GIVGQPNHAGKREILIEEEEGQF"
FT   gene            106840..107859
FT                   /locus_tag="Nham_0091"
FT   CDS_pept        106840..107859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0091"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60992"
FT                   /db_xref="GOA:Q1QS05"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS05"
FT                   /protein_id="ABE60992.1"
FT                   /translation="MILVWFGFRSSLDGLARGMSELLNHHTSAAAISVRPRPGKSDIRG
FT                   GAKRCKRTASDGQDETLSRHVTHSSAARRPIRIRARPGRVWLAAALTASLLVPPALAQA
FT                   IPIPRPAPKARDVAPVAKLLDTVEPEVTGTTQPPDPIIPDRRRNVPANIFATFSADQKA
FT                   AAARVSAYLSSLRTLAGNFVQVGPDGSRSTGEFYIQKPGKVRFEYDPPSPIAMISDGSS
FT                   LVVRDTKLATQDIYPLSQTPLRYLLSDRIDLMKDTNVVSVTSDDLYISVTIEEKQALIG
FT                   TSRLMLMVGAKDGKLKQWTVTDPQGYDTTVAIYNLNTTAKLDPALFKIDYTRYPTSNN"
FT   gene            107936..108817
FT                   /locus_tag="Nham_0092"
FT   CDS_pept        107936..108817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0092"
FT                   /product="exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60993"
FT                   /db_xref="GOA:Q1QS04"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS04"
FT                   /protein_id="ABE60993.1"
FT                   /translation="MDTRVKPAYDGKQTCRRLRQKSMQITLTTWNVNSVRLRIDLVAKF
FT                   LKAQRPDVLCLQETKCPDDAFPLKRFRRLGYEHVALNGQKGYHGVAVVSKLPFDASNIR
FT                   TFCDKIDSRHVGVTLGGEAGLAAPLVLHNFYVPAGGDIPDPALNPKFAHKLQFLDEMKA
FT                   CTPLHPRDGDRHVLVGDLNVAPHEHDVWSHKQLLKIVSHTPVECEKLLGLQSHGNWVDI
FT                   ARARIPMSEKVYTWWSYRAADWVAANRGRRLDHIWVSEALRGGIRDFRITRAARGWERP
FT                   SDHVPVTAVIEV"
FT   gene            complement(108887..109336)
FT                   /locus_tag="Nham_0093"
FT   CDS_pept        complement(108887..109336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0093"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60994"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS03"
FT                   /protein_id="ABE60994.1"
FT                   /translation="MSIDDDVVLLERVPTLRLLGAEALRVLAIGAEQQQFARGSILFRA
FT                   GDEADAGYVVQEGGFRIHVEDGRDREVVAERGTLIGELALIVPMSRPATATALEYSMAI
FT                   RIPRTLFLRVLDSDPAAARRLRDELANRTRQTTGDILMASAKLSG"
FT   gene            complement(109421..110107)
FT                   /locus_tag="Nham_0094"
FT   CDS_pept        complement(109421..110107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0094"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60995"
FT                   /db_xref="GOA:Q1QS02"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS02"
FT                   /protein_id="ABE60995.1"
FT                   /translation="MANARKILIVDDDTDLRDTLVEQLSLHEEFEASAVDTGAKGASAA
FT                   KAHSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYI
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFSVGHYSFRPGSKMLTTATAKKVRLTEKETAI
FT                   LRFLYRAGQMPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            110256..110897
FT                   /locus_tag="Nham_0095"
FT   CDS_pept        110256..110897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60996"
FT                   /db_xref="GOA:Q1QS01"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS01"
FT                   /protein_id="ABE60996.1"
FT                   /translation="MNVPVVTCRTDVSAAEWARPPHSMQNSGFSTSCTTHSRDRPLAAI
FT                   HVRAAAGRPERGWLIAEGRAFPVALGRGGIRANKREGDGGTPRGIFRPIRLWWRPDRHP
FT                   RPRTFLPVRPITPTDAWCEDPADRHYNRPIRLTRDASGDRLTRDDHLYDFIIEIDHNTR
FT                   PRIAGRGSAVFLHLARDNFGPTAGCVAMTRSAMLRLLLRRIGPRTKIVIG"
FT   gene            complement(111017..111694)
FT                   /locus_tag="Nham_0096"
FT   CDS_pept        complement(111017..111694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0096"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60997"
FT                   /db_xref="GOA:Q1QS00"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QS00"
FT                   /protein_id="ABE60997.1"
FT                   /translation="MTTDNAAPATSGLASVEAEIVRACRDARCERSSVTLVAVSKTFDT
FT                   DAIAPVIAAGQQVFGENRVQEAQRKWPELMAAHPGIALHLIGPLQSNKAKDAVGLFDAI
FT                   HSVDRPSICAALAKEIASQNRRPDLFVQINTGEEPQKAGVAPSDADAFIAACRDTYGLT
FT                   ISGLMCIPPADDAPAPHFALTAKIAKRNGLTQLSMGMSADFAIAIALGATHVRVGSAIF
FT                   GTR"
FT   gene            complement(111728..112432)
FT                   /locus_tag="Nham_0097"
FT   CDS_pept        complement(111728..112432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0097"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60998"
FT                   /db_xref="GOA:Q1QRZ9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRZ9"
FT                   /protein_id="ABE60998.1"
FT                   /translation="MADLSAFPITRRWPAADPGRLQLYSLPTPNGVKVSIMLEETALPY
FT                   EPHLVDFGKDDQKTPEFLSLNPNGKIPAIVDPDGPGGKPFGLFESGAILQYLAEKTGQF
FT                   LPADPARRWQTIQWLHFQMGGVGPMFGQVGFFNKFAGKKFEDKRPRDRYVAESKRLLGV
FT                   MDGHLANRQWFVGDDYTIADIAMFGWVRNLIGFYEAREIVGFDRFGNVADWLERGLARP
FT                   AVQRGLGIPARG"
FT   gene            112586..115222
FT                   /locus_tag="Nham_0098"
FT   CDS_pept        112586..115222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0098"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE60999"
FT                   /db_xref="GOA:Q1QRZ8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRZ8"
FT                   /protein_id="ABE60999.1"
FT                   /translation="MTSDRYNARDAEPRWQAAWDQQAIFATKNDDPREKYYVLEMFPYP
FT                   SGRIHIGHVRNYTLGDVIARYMRAKGYNVLHPMGWDAFGLPAENAAIERKVAPKAWTYD
FT                   NIKAMKKQLRSIGLSLDWAREFATCDPSYYKHQQKMFLDFLRAGLAEREKRKINWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVEQREMNQWVFKITKYSQELLEALDTLDRWPDKVRLMQR
FT                   NWIGRSEGLLLRFALDPATTPNGEGELKIFTTRPDTLFGAKFMAIAPDHPLAQAAAKDN
FT                   PALAEFIAECKRRGTAQAEIDTAEKMGFDTGIRAIHPFDPDWTLPVYVANFILMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYGLGNTPVVCPEGQDPKTLVITDTAYDGDGRMINSRFLDGM
FT                   TAEAAKKEVAKRLESEMRGNMPVGERKVNFRLRDWGISRQRYWGCPIPVIHCPKCDVVP
FT                   VPENDLPVTLPEDVTFDKPGNALDHHPTWKHVTCPQCGARATRETDTMDTFVDSSWYFA
FT                   RFTDPWNETAPTTPEIANRMMPVDQYIGGVEHAILHLLYSRFFTRAMKATGHLSMDEPF
FT                   KGMFTQGMVVHETYRKADGGWASPDEVGIEAVGNGRRATLISTGEPVEIGAVEKMSKSK
FT                   RNTVDPDDIIGSYGADTARWFMLSDSPPDRDVIWSEEGVQGASRFMQRLWRLVNESAEA
FT                   GKAAPRDKPATFGTDALALRKAAHGALDKVSTGIERLHFNVCLANIREFANTLAETLAR
FT                   FGTRTSDLAPDIAWSLREAATILVQLFSPMMPHLSEECWHALGHTGLVSEARWPQIERD
FT                   LLVEDTVTLPVQVNGKKRGEVTVASSAPNPEIETAVLALDAVRQALGGKPARKIIIVPQ
FT                   RIVNVVG"
FT   gene            115209..115793
FT                   /locus_tag="Nham_0099"
FT   CDS_pept        115209..115793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61000"
FT                   /db_xref="GOA:Q1QRZ7"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRZ7"
FT                   /protein_id="ABE61000.1"
FT                   /translation="MWWGRLSARPARSWLSPRIAARLGVVAVLAALTAGCFRPMYAEHA
FT                   DGSPALRDKLMGVELLPVDKPNASRDARIGVAIRNALAFKLYGGATGAPPTHQLKIRFT
FT                   TSRSSLMLDPRTALPSNESYGIDASYQLIEVATGKTVLSASTFARTSYDIPGQLQRFAR
FT                   ARAYRDAEDRAAQEIADNINTRLASFFYAGT"
FT   gene            115805..116833
FT                   /locus_tag="Nham_0100"
FT   CDS_pept        115805..116833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0100"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61001"
FT                   /db_xref="GOA:Q1QRZ6"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRZ6"
FT                   /protein_id="ABE61001.1"
FT                   /translation="MVALRGKDVDSFLARPDPGRPIILLYGPDAGLVRERADALMASAV
FT                   DDPSDPFSLVRLDGDDLATEPSRLVDEAMTVPLFGGRRAIRVKAGTRNFAGGIETLADS
FT                   AIQDCRIVIEAGELRPEAPLRKACERAKNAVAIACYPDTERDLARLIDDELRLSNLKIA
FT                   PDARATLMSLLGGDRQASRNELRKIALYAHGQREIALDDVMAVVSDASDFKLDPIVDAA
FT                   FAGQPAVVETEFAKAMVAGTYPGLVILAAQRQVAALHKAALAMEGGASASSAAESGFPR
FT                   LHFSRKTAVETALRNFSAARLLQVMDQLAVAALEARKQTVLAPVIAQRALMSIAVNARR
FT                   RG"
FT   gene            complement(117041..117328)
FT                   /locus_tag="Nham_0101"
FT   CDS_pept        complement(117041..117328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0101"
FT                   /product="Excinuclease ABC, C subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61002"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRZ5"
FT                   /protein_id="ABE61002.1"
FT                   /translation="MKQPCVYIVASKRNGTLYTGVTANLQRRIFEHRESLVAGFSKKYG
FT                   CKILVWYEAHETMTDAITREKQIKAGSRVKKLALIEGLNPEWNDLFETLF"
FT   gene            complement(117377..118261)
FT                   /locus_tag="Nham_0102"
FT   CDS_pept        complement(117377..118261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0102"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61003"
FT                   /db_xref="GOA:Q1QRZ4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRZ4"
FT                   /protein_id="ABE61003.1"
FT                   /translation="MADEARSRLGRGLASLIGDVGGEAAHTERPRAQRKVPIEFLKPNP
FT                   RNPRRAFSDVELGELSDSIKQHGVIQPIVVRPVKGAQDRFEIIAGERRWRAAQSAGLHE
FT                   VPIVPVDVTDNVALEIAIIENVQRENLNAMEEAQGYHALASEFKRTQDDIAKIVGKSRS
FT                   HVANMMRLTKLPDDVQALIASGELSAGHARALIGVPDPSMAAKRIVAEGLNVRQAEALA
FT                   HEEGVPERKLQKARADKVLKDPDTLALEKRVSDALGLAVTVDHKNPGGVVHIRYRDLDQ
FT                   LDAILKRLDSKGS"
FT   gene            complement(118441..119301)
FT                   /locus_tag="Nham_0103"
FT   CDS_pept        complement(118441..119301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0103"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61004"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRZ3"
FT                   /protein_id="ABE61004.1"
FT                   /translation="MTVIDEIYQYDGKDAGSPAGHPRIISLANQKGGVGKTTTAINLGT
FT                   ALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVSTYDVLIGEAPLRDAVVPTAVPRLHI
FT                   AASTMDLSGLELELGTTKDRAFRLRDAIAALNGNAADHSDYTYVLIDCPPSLNLLTVNA
FT                   MAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGIVLTMFDSRNNLSNQV
FT                   VADVRQFMGSKVYDTMIPRNVRISEAPSYGKPVLVYDLKCSGSEAYLKLATEVIQRERE
FT                   LRTTH"
FT   gene            complement(119298..120080)
FT                   /locus_tag="Nham_0104"
FT   CDS_pept        complement(119298..120080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0104"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61005"
FT                   /db_xref="GOA:Q1QRZ2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRZ2"
FT                   /protein_id="ABE61005.1"
FT                   /translation="MADWQKAHGRLQRDVAGNRTVPYAGADAMTRPRQAQSPLSAADKA
FT                   AALALTPVSRETEARLDAYVDLLVQWQTKTNLIASSTLPQLWTRHIADSLQLLALAPQA
FT                   KRWADFGSGGGFPGVVLACALADVEGARIDLVERNAKKAAFLREAVRITGTPGVIHPMD
FT                   IGDYVDRLDGRIDCVTARALAPLQVLLGFAEPLVKQGAKALLLKGQDVEAELTEATKYW
FT                   NIEPRLHSSRTGGQGWIVELDRIERRDRPPTKQAWRRA"
FT   gene            complement(120558..122432)
FT                   /locus_tag="Nham_0105"
FT   CDS_pept        complement(120558..122432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0105"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61006"
FT                   /db_xref="GOA:Q1QRZ1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRZ1"
FT                   /protein_id="ABE61006.1"
FT                   /translation="MTASFDVIVIGGGHAGCEAATAAARMGARTALVTHRLSTVGAMSC
FT                   NPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRMLNRRKGPAVRGPRAQEDRKLYAA
FT                   AMQAEIREAANLVVIEGEADDLIVADGRIAGIRLIDSRAFKTGAVVVTTGTFLRGLIHL
FT                   GEKSWPAGRVDEAPALGLSVSFERIGFTLGRLKTGTPPRLDGATIDWAAVEMQPGDDPP
FT                   EPFSVMTSRITTPQIRCGITRTMPATHEVIRANVHRSPIYSGQIRSSGPRYCPSLEDKV
FT                   VRFGDRDGHQIFLEPEGLDDTTVYPNGISTSLPEEVQLAILATIPGLTKVRMIRPGYAI
FT                   EYDHVDPRELDPTLQTRRLPGLFLAGQINGTTGYEEAAAQGLVAGLNAALAAGGGDPVV
FT                   FDRADGYLGVMIDDLVTRGITEPYRMFTSRAEYRLTLRADNADQRLTDKGIAMGCVGAG
FT                   RAVHHRAKMAALSAAKALATSLSVTPNEAARYGLSLNRDGHRRSAFELLAYPEIGWGEV
FT                   AAIWPELSAIDPGVAVHLEIDAKYDVYLKRQTADVEAFRRDESLVLADVDYDAVPGLSN
FT                   EARARLERARPRTVGQAGRLDGITPAALGILAAYLRREARKKTATASA"
FT   gene            complement(122606..123979)
FT                   /locus_tag="Nham_0106"
FT   CDS_pept        complement(122606..123979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0106"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61007"
FT                   /db_xref="GOA:Q1QRZ0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRZ0"
FT                   /protein_id="ABE61007.1"
FT                   /translation="MHPREQTIFALSSGRPPSAIAVVRVSGAEAGTALQEIAGAIPVVR
FT                   TAKRVLLRDLLGEAIDDAIVLWFAGPASATGEDVAEFHVHGSRAVLNALFAALSSIDHV
FT                   RPAEPGEFTRRAFENGKIDLTEAEGLDDLIHADTDRQRRQALRQLQGLLGDRAREWRRE
FT                   LIEASALIEAGIDFADEGDVPDDLLKPAMEKIARLRREIEETLAASAQSERLRDGMTVA
FT                   IAGPPNAGKSTLLNRLARREAAIVSPYAGTTRDVIEVHLDLDGYPVTLIDTAGIRETDD
FT                   PVEQEGVRRARDRAASADLVLWLADDDNGVGPSQTIGEGGVPLWLVRNKIDVSGAESDG
FT                   ANPRQLEAKPGQGILPRHFWISASRGDGVDELVAALTAFSDGWFGSGETAVITRLRHRN
FT                   ILQDAAASLAKAEALIGQGDELVAEEIRIAVRLIGRLLGRVDIDDILDSLFHDFCIGK"
FT   gene            124093..126141
FT                   /locus_tag="Nham_0107"
FT   CDS_pept        124093..126141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0107"
FT                   /product="protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61008"
FT                   /db_xref="GOA:Q1QRY9"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRY9"
FT                   /protein_id="ABE61008.1"
FT                   /translation="MNHAATGSGRPANRLAAETSPYLLQHQHNPVDWWPWGPAALAEAQ
FT                   RTNRPILLSIGYAACHWCHVMAHESFEDDEVAAVMNELFVCIKVDREERPDIDQIYMNA
FT                   LHLLGEQGGWPLTMFLSPDGSPFWGGTYFPKLPDFGRPAFTDVLQSVARVFHDKPERVT
FT                   LNRDAVIARLSERAKVGSPANLGVAELNTAAVSIARSTDPVNGGLHGAPKFPQCSVLEF
FT                   LWRAGARTGSDRFYAATTLTLTQMSQGGIYDHLGGGYARYSVDDRWLVPHFEKMLYDNA
FT                   QILDLLALDYARSKNPLYRERAIETVAWLLREMLTGEGGFASSLDADSEGKEGKFYVWS
FT                   LSEIEEVLGATDAADFAARYDITANGNFEGRNIPNRLKSSDLVSDDGAHMRTLRAKLLA
FT                   RRAGRVRPGLDDKVLADWNGLMIAALVHGACAFGLPDWLETARTAFEFIRKTMTRGDRL
FT                   GHSWREGRLLVPALACDYAAMVRAALALSEATGDTAYLEQALRWQATLDTHYADVEHGG
FT                   YYLTADDAEGLIVRPHSTIDDAIPNYNGLIAQNLVRLAALTGDSKWRDRIDALFGALLS
FT                   RAAENGFGHLALLSALDLRLTGAEIVVVGEGAQAEALLAAARALPHATSIVLHVSRGDA
FT                   LPAEHPARAKADSVQGAAAFVCRNQSCSLPVTTPQALVDLVMQRTSA"
FT   gene            complement(126334..127599)
FT                   /locus_tag="Nham_0108"
FT   CDS_pept        complement(126334..127599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0108"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61009"
FT                   /db_xref="GOA:Q1QRY8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRY8"
FT                   /protein_id="ABE61009.1"
FT                   /translation="MREMKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFAILKQL
FT                   AIQEIDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDQRFRLELEDSTRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVSDKRTFPAIDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRNTKNNAEFFESMNT"
FT   gene            complement(127911..128942)
FT                   /locus_tag="Nham_0109"
FT   CDS_pept        complement(127911..128942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0109"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61010"
FT                   /db_xref="GOA:Q1QH87"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QH87"
FT                   /protein_id="ABE61010.1"
FT                   /translation="MEKIITIGLDLAKSVFQVHGIADDGSIVVRRALRRSQVLDFFRAI
FT                   DPCLVGIEACASSHYWANAIGQLGHTVRMMPPTYVKAYVKRSKTDAADAEAICEAVSRP
FT                   TMRFVPIKTPAEQAACMVLRTRELFVRQRSQTANAMRAHMAELGIIAAAGMTSIAKLIL
FT                   VLRDAEDTRLPVAARAALLEMAEQIEMLTARIEKLDTKIIATVKADETAWRLTSIPGVG
FT                   PIIAATVRATIQDPTVFKTGRDLAAWIGITPRANSSGGKERLGRISKQGNKQLRTLLIV
FT                   GATSILKQARRGVKLPSWIISLMARRPYKVVAVALANKIARTIWALLVKGGTYQAPAIM
FT                   TRA"
FT   gene            129221..130444
FT                   /locus_tag="Nham_0110"
FT   CDS_pept        129221..130444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0110"
FT                   /product="transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61011"
FT                   /db_xref="GOA:Q1QJ32"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QJ32"
FT                   /protein_id="ABE61011.1"
FT                   /translation="MARRKDPAIPNDLLDQLLAGGAASAAFEQGGLLDSLKKALTERAL
FT                   NAEMDHHLASGEDAGNTRNGYGRKTVTTETGKLEIDIPRDRQSSFDPQLIAKYQRRFPG
FT                   FDDKIVSMYARGMSTREITGHLRDLYGIEVSPDLISTVTDAVLDEVATWQQRPLDPVYP
FT                   LIFFDAIRVKIRDEGMVRNKAIHIALGVRADGAKEVLGLWLEQNEGAKFWLRVMNELKN
FT                   RGVDDILLAVVDGLKGFPDAITAVFPEAVVQTCIVHLLRNSMDFVSWKDRKGLATALKD
FT                   IYRAVDADAAEKALAAFEAGPWGQRYPAIGQSWRRAWGEVIPFFAFPDEVRRIVYTTNS
FT                   IEALNSKLRRAVRARGHFPSDDAATKLLYLILNRSEKEWKMPPREWTMAKAQFAVIFGE
FT                   RFIKAMAA"
FT   gene            complement(130647..131066)
FT                   /locus_tag="Nham_0111"
FT   CDS_pept        complement(130647..131066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0111"
FT                   /product="conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61012"
FT                   /db_xref="GOA:Q1QRY5"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRY5"
FT                   /protein_id="ABE61012.1"
FT                   /translation="MYEWIKAFHVIAVISWMAGMLYLPRLFVYHCDAEVGSKQSETFKV
FT                   MERRLFKAIINPAMMVAWGLGLYMMWAHHWYSVGWFQGKLALVILMSAIHGYFARRVRD
FT                   FAADRNVMSQRFYRIINEVVTVLMVGIVILVIVKP"
FT   gene            131529..132371
FT                   /locus_tag="Nham_0112"
FT   CDS_pept        131529..132371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0112"
FT                   /product="protein of unknown function DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61013"
FT                   /db_xref="GOA:Q1QRY4"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRY4"
FT                   /protein_id="ABE61013.1"
FT                   /translation="MAPITGSNFHLHLVSDSTGETLITVSRAVVAQYANVTPVEHVYPL
FT                   VRSQKQLDRVLAEIEEEPGIVLFTLLEKDLVERLEAKCQEINSPSLSIIGPVMQLFQAY
FT                   LGAATIGRVGAQHTLNADYFRRIDALNYTMMHDDGQHVEGLEEADVVLVGVSRTSKTPT
FT                   SIYLANRGIRTANVPLVPGIAIPRQLESLRTPLVVSLHAAPERLIQVRQNRLLSIGTRA
FT                   GNDTYIDRQSVADEVTYARRLSAKHDWVQLDVTRRSIEETAAAIMKLFADRQRQRQPE"
FT   gene            132381..132989
FT                   /locus_tag="Nham_0113"
FT   CDS_pept        132381..132989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0113"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61014"
FT                   /db_xref="GOA:Q1QRY3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRY3"
FT                   /protein_id="ABE61014.1"
FT                   /translation="MAVWREPKPLILASQSRVRQALLANAGLSFEAIPAAIDERAIQRS
FT                   CGLTSGAEIAVRLACEKARYVSLRSPGRYVIGADQTLECDGRLFNKPDGRVGAAEHLRA
FT                   LSGRTHALHAAVAIVRDGRQLFEYVSVARMTMRELSEDTIEAYLNAAGDEVTASVGAYQ
FT                   LENLGVHLFSRVEGDHFSILGLPLLPLLAFLRSQGLLSL"
FT   gene            133006..133605
FT                   /locus_tag="Nham_0114"
FT   CDS_pept        133006..133605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0114"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61015"
FT                   /db_xref="GOA:Q1QRY2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRY2"
FT                   /protein_id="ABE61015.1"
FT                   /translation="MLVLGLTGSIGMGKSTTAELFSEAGVPVYDADATVHKIYEGEAAP
FT                   AIEAAFPGTTVNGKVDREKLSAKVVHDAAAMKRLEQIVHPMLHAYRQAFLDQAEQSGAA
FT                   VAVVDVPLLFETGGEKRVDAVVVVSTTPEVQRERILARGNMTDEKLDAILARQLPDAEK
FT                   RKRADFVVDTSHGLDHVRARIREILAEAAKMPRRRL"
FT   gene            133628..134347
FT                   /locus_tag="Nham_0115"
FT   CDS_pept        133628..134347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0115"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61016"
FT                   /db_xref="GOA:Q1QRY1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRY1"
FT                   /protein_id="ABE61016.1"
FT                   /translation="MREIVLDIETTGLDPLRGDRVVEIGCVEIFNRMPTGQTFHRYINP
FT                   ERDMPQEAFAVHGLSSEFLAEKPLFTHIVDDFLEFIGDAPLVIHNASFDISFINAELDR
FT                   LKMRTIGRDRLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQPQLILAETASRRTGGTLDMPRRQRTVPLAPRVTDADRIAHRDFVATLGEKA
FT                   IWKEFAGTEALKQAVSD"
FT   gene            complement(134447..134926)
FT                   /locus_tag="Nham_0116"
FT   CDS_pept        complement(134447..134926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0116"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61017"
FT                   /db_xref="GOA:Q1QRY0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRY0"
FT                   /protein_id="ABE61017.1"
FT                   /translation="MTNGNGTPPEGAPSPQLNVLAQYTKDLSFENPNAPSSLAPQQKPP
FT                   SISVQINVNANNVAQDEFEVTLTVEGKAEHNDKLMFRFELAYAGLFRIVNVPQENLPPL
FT                   VMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGMFRQNMERQAAVQQKPS"
FT   gene            135379..136083
FT                   /locus_tag="Nham_0117"
FT   CDS_pept        135379..136083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0117"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61018"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRX9"
FT                   /protein_id="ABE61018.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRSVLGQRTGSERPPYDRATREVLHGT
FT                   QDKNVVPMAGPVIDQASSAPTADAASTPDRWKNLAEPGTPLALGLDAIAAHDSSFDPKH
FT                   FISGARSAYEMIVLAFANGDRRTLKDLLSSDVYESFDAAIKDREKLEQKTETRFVSIDK
FT                   VELIGAELRDSAEQLTVRFISQMISMTRDKTGAIVDGNPEKISDITDVWTFARDIPSRD
FT                   PNWKLVGTGSTD"
FT   gene            136094..137596
FT                   /locus_tag="Nham_0118"
FT   CDS_pept        136094..137596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0118"
FT                   /product="MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61019"
FT                   /db_xref="GOA:Q1QRX8"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRX8"
FT                   /protein_id="ABE61019.1"
FT                   /translation="MKRCAVGFCVAAALVPVAVEAHDTRHRPAWPLEIAGGQYIPVSWA
FT                   EIAGWNDDNHLDAFKAFRASCRAVTARRISAVGQKALGTSLREPCRVAKMAAISDDAKA
FT                   RAFFETRFRAVRISRLGETDGFVTGYYEPIIDGSRTRTDTYTVPVYRRPSNLFVRGFTQ
FT                   GAPSLPNSGPVYRKIGRRKLVPYYDRAEIEDGAIAGRGLEICWLKSQTDLLFTQIQGSA
FT                   RVRLEDGSTIRINYDSYNGYPYTAVGRILIERNIVPKDQMSMQRIRQWMNENPDGAIEL
FT                   RRQNRSYVFFREVKLSDNDEAVGAQGVPLAPGRSIAVDKSLHVYGTPFFIEGELPIESE
FT                   QAKTPFHRLMIAQDTGSAILGPARADLYFGAGPEAGRVSGRLRHNMQFVMLVPNSLDPV
FT                   ARGRTMPLPETRPSARIAKLFPQKKNQKPDDPKVAPQQSAPSAVVPAGQPARAALVSAA
FT                   KAAPPEAVPLPAVRPEVMPGPHQARRHYHRRHHRHERRRNPR"
FT   sig_peptide     136094..136159
FT                   /locus_tag="Nham_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.978 at
FT                   residue 22"
FT   gene            137593..138183
FT                   /locus_tag="Nham_0119"
FT   CDS_pept        137593..138183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0119"
FT                   /product="Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61020"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRX7"
FT                   /protein_id="ABE61020.1"
FT                   /translation="MKRLPPRISDLPAPSRRRRALTGEERELWESVAKQAKPLRKTARL
FT                   WTSLEGALSGAPDPAREAAAKAVAVAPANLKPSRPVPPPLTLLSRRERARLSRGKQDIE
FT                   ARIDLHGMTQARAHRALHNFLLRASGDGLRFVLVITGKGRAAGLDPSRGILRQQVPEWL
FT                   GLPEFRTLVVGFEQAHIGHGGEGALYVRVRRRR"
FT   gene            complement(138299..139600)
FT                   /locus_tag="Nham_0120"
FT   CDS_pept        complement(138299..139600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0120"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61021"
FT                   /db_xref="GOA:Q1QRX6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRX6"
FT                   /protein_id="ABE61021.1"
FT                   /translation="MTHFSPREIVSELDRFIVGQTDAKRAVSIALRNRWRRQQLTGSMR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVEQIVRDLV
FT                   EVAIGQTRERKRKDVQARAQLAAEERVLDALVGANASAATRDSFRRKLRAGDLNDKEIE
FT                   IETQSSGGAPMFEIPGMPGAQVGAISIGDIFGKMGGRTKTRRLTVVDSYEILVNEESDK
FT                   LLDSDQLTQEAIAAVENNGIVFLDEIDKICVRDGRSGGDVSREGVQRDLLPLIEGTTVS
FT                   TKHGAVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELDALTRNDMRRILTEPEAS
FT                   LIKQYVALMQTEGVTLDITDDAIDALADIAVAVNSTVENIGARRLQTVMERVLDDISFS
FT                   APDRNGETVRIDAGYVQKHIGDLAKNADLSRFIL"
FT   gene            complement(139683..140237)
FT                   /locus_tag="Nham_0121"
FT   CDS_pept        complement(139683..140237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0121"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61022"
FT                   /db_xref="GOA:Q1QRX5"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRX5"
FT                   /protein_id="ABE61022.1"
FT                   /translation="MQASQPEVWHGTTILTVRKGGKVVIGGDGQVSIGQTVIKSNAKKV
FT                   RKLGKGDVIGGFAGATADAFTLFERLESKLEQYPGQLTRAAVELAKDWRTDRYLRRLEA
FT                   MMLVADKDVSLVLTGTGDVLEPEAGVMAIGSGGNYALSAARALIDSDKDAETIVRRSLD
FT                   IAADICVYTNRNLTIETLSTD"
FT   gene            140506..141099
FT                   /locus_tag="Nham_0122"
FT   CDS_pept        140506..141099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0122"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61023"
FT                   /db_xref="GOA:Q1QRX4"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRX4"
FT                   /protein_id="ABE61023.1"
FT                   /translation="MRTATIKRKTKETDIEVAVNLDGSGVSSVATGIGFFDHMLDLLAR
FT                   HSRIDIMVKADGDLHVDYHHTTEDVGIALGQAVKQALGTMAGITRYACAHMPMDETLSR
FT                   VVIDISGRPMLVFKVEFPRDKIGEFDTELVREWFNAFAVNAGVTLHVETLYGENSHHIA
FT                   ESCFKGLARALRAAVAIDPRAAGEVPSTKGQLGG"
FT   gene            141126..141641
FT                   /locus_tag="Nham_0123"
FT   CDS_pept        141126..141641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61024"
FT                   /db_xref="GOA:Q1QRX3"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRX3"
FT                   /protein_id="ABE61024.1"
FT                   /translation="MSVYTVHAPPVDGTDVRGTTDKFVFVRDGFSFWAFVFGPVWLLYQ
FT                   RLWLAFAGYMVLSIALEVVLTLLHAGSGMRSIVMLLIAVLMGLEAASLRRWTLSRGKWR
FT                   QFDVVVADDEEAAERRFFDRWTMTRGVNFDPSTVDRGAPPPTRNGPGQPSTPRSDIVGL
FT                   FPQPGFPR"
FT   gene            141638..142288
FT                   /locus_tag="Nham_0124"
FT   CDS_pept        141638..142288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0124"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61025"
FT                   /db_xref="GOA:Q1QRX2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRX2"
FT                   /protein_id="ABE61025.1"
FT                   /translation="MSAAIIDYGSGNLHSAAKAFECAARGMEGMEKIVVTRDPDVVFRA
FT                   DRVVLPGVGAFADCRRGLDALDGMVQALTEVVRDKARPFLGICVGMQLMATRGKEHVTT
FT                   DGLGWIAGDVEKISPRDESLKIPHMGWNTLDPVREHPVLEGLPLGPKGRHAYFVHSYQL
FT                   NAANESDVLARADYGGPVTAIVGKDTAIGTQFHPEKSQRFGLALIANFLKWKP"
FT   gene            142285..143025
FT                   /locus_tag="Nham_0125"
FT   CDS_pept        142285..143025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0125"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61026"
FT                   /db_xref="GOA:Q1QRX1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRX1"
FT                   /protein_id="ABE61026.1"
FT                   /translation="MILFPAIDLKDGQCVRLEQGDMARATVFNFDPAEQARAFASQGFE
FT                   YLHVVDLDGAFAGRPVNADAVERMLKNVAMPVQLGGGIRDLKTVEAWLKKGITRVIIGT
FT                   AAVRDPVLVKEAAKAFPGRVAVGLDARDGKVAVEGWAETSEVTALDIARRFEDAGIAAI
FT                   IFTDIARDGLLKGLNLDATIALADSISIPVIASGGFASIADVKALLAPRAKKLAGAIAG
FT                   RALYDGRLDPAEALALIRAARAAA"
FT   gene            143041..143817
FT                   /locus_tag="Nham_0126"
FT   CDS_pept        143041..143817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0126"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61027"
FT                   /db_xref="GOA:Q1QRX0"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRX0"
FT                   /protein_id="ABE61027.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAVAYDAAGAD
FT                   ELTFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTIDDIRTLLRSGADKVSINS
FT                   AAVSRREFVKEAAEKFGDQCIVVAIDAKRVSRAGGSDRWEIFTHGGRKSTGIDAIDYAQ
FT                   EVVSLGAGEILLTSMDRDGTRQGFDLPLTRLVADSVSVPVIASGGVGNLDHLVDGIREG
FT                   HATAVLAASIFHFGEFTIRQAKDHMARAGLPMRLDP"
FT   gene            143899..144222
FT                   /locus_tag="Nham_0127"
FT   CDS_pept        143899..144222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0127"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61028"
FT                   /db_xref="GOA:Q1QRW9"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRW9"
FT                   /protein_id="ABE61028.1"
FT                   /translation="MPRFTIHDLAATIDARAASGGDASYTRKLLDKGSGHCAKKFGEEA
FT                   VETVIAAIENDRHHLIAEGADLMFHFLVLLKARGVTFEDIEFALAQRTTMSGLEEKAAR
FT                   NRE"
FT   gene            144237..145193
FT                   /locus_tag="Nham_0128"
FT   CDS_pept        144237..145193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0128"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61029"
FT                   /db_xref="GOA:Q1QRW8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRW8"
FT                   /protein_id="ABE61029.1"
FT                   /translation="MDLRAEQQQYNPYRIFSRSEWAKLRDDMPMTLAADEIAALRSMHD
FT                   RLDLTEVEEIYLPLSRLLSIYVASMQRLFVAQRRFLGIQDRKVPYIIGVAGSVAVGKST
FT                   TARVLQALLARWSPGPKVDLITTDGFLFPNAVLERHGLMQKKGFPESYKLPMLLAFLSD
FT                   IKAGRAPVRAPVYSHLTYDIVPKSWIEVSQPDILIVEGVNVLQTGRLPRDGRAVPVVSD
FT                   FFDFSVYLDAEEPVLRDWYVKRFLALRDTAFHDPRSYFHRYALLSDDEATATAIAIWER
FT                   TNRANLEDNILPTRPRATLILKKGADHVVEQVALRRL"
FT   gene            complement(145259..147517)
FT                   /locus_tag="Nham_0129"
FT   CDS_pept        complement(145259..147517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0129"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61030"
FT                   /db_xref="GOA:Q1QRW7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW7"
FT                   /protein_id="ABE61030.1"
FT                   /translation="MMARLFWIRARLRRLIRRHPRLHLAFRTVTTFSIAFGGAYGFVSG
FT                   SRSADYDPNAFAIGVSFLFALACVALAILSMRLRWMRRKLRKISLHNETLADRNWELKE
FT                   AEERARSLFESQDDLIVLRNADGLITSVNDAYCVLAQRSRADLLGSRFALPVLEQGESA
FT                   IESNGTRIHDQRVETALGPRWIAWREGLVRIDANHPAELQCVGRDVTNRTETEYALGEA
FT                   RDHANAANRAKSRFLAMTSHEIRTPLNGIIGMSGLLLDTSLTPEQTTYVKAVKASGDAL
FT                   LSLIEELLDYSRIEAGKIDLESRPFILSDLIEDITELLAPRAQARQLEIAAYIDEQLPI
FT                   EVIGDATRLRQILLNLAGNAIKFTPSGGVALIVEPGTEPGTIRFMVQDTGIGITPDAQA
FT                   RVFREFEQADEQIARNYGGTGLGLSISDRIVKRMGGRITLESKPGAGSTFEVSIPLPAH
FT                   DSPPERKRFSTPDLTGHPIMLVAPQTIEASLLARRLERWGAETCTISDIAVAHALLPGR
FT                   PWHTVLVDHAMGAEDVWRLGQTACRHAARRIVMVTPSTRHDLQTPGAGAFTGYLVKPLR
FT                   TASIAARLAATADGPTALRATEGRHDCNTLEESEAPTTAPTQSLSILVAEDNEINALLI
FT                   RSLLTRLGHDVILAANGEKALESWVAAGTAGAPYDLVLMDVQMPKLDGVETTKRIRERE
FT                   AGQRGSRTTILALTANALLDDRSACFEAGMDGFLVKPLDRDKLADALAGLMAARHIPA"
FT   sig_peptide     complement(147368..147517)
FT                   /locus_tag="Nham_0129"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.539 at
FT                   residue 50"
FT   gene            complement(147863..148759)
FT                   /locus_tag="Nham_0130"
FT   CDS_pept        complement(147863..148759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0130"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61031"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW6"
FT                   /protein_id="ABE61031.1"
FT                   /translation="MIGSPGSGKSMLAARLPSILPPLSPAELLEVSMIASVAGEIDGGA
FT                   LTSRRPFRAPHHSASMAALTGGGTRAKPGEISLAHNGVLFLDELPEFDPRVLDSLRQPL
FT                   ENGEIAVSRANHRVTYPARFMLVAAMNPCRCGHAYEPGYACKRGRNDRCTADYQTRISG
FT                   PLMDRIDLRIEVPAVTASDLILPPSSEGSSEVGARVAAARDIQAERYAALGLPNVRTNA
FT                   EAPAAALEDIAQPDAQGLKLLRDAAESMRLSARGYHRVLRVARTLADLDGADKIGRLHL
FT                   AEALSYRALADDIKRAA"
FT   gene            149040..149663
FT                   /locus_tag="Nham_0131"
FT   CDS_pept        149040..149663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW5"
FT                   /protein_id="ABE61032.1"
FT                   /translation="MRRRISCSQTWVCKMSVSWTDWKTDDKDGEFAGPAKQDIRRTYSF
FT                   PNIDSAGGIATLTIVCVLEMTMLPDGENVSLDRKLRFYLRPFRLQHEANFIMGFMTRAE
FT                   SHGGEFDVLAAPSGDEDGMAIIAKYGGRNDVSACIATLRAGRDLVFSLQDEQESLVNFL
FT                   LPNDDTFQRLYDETIQTLQQRAVLNQILMVWNGPSKRHRRCLSW"
FT   gene            149698..150729
FT                   /locus_tag="Nham_0132"
FT   CDS_pept        149698..150729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0132"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61033"
FT                   /db_xref="GOA:Q1QH87"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QH87"
FT                   /protein_id="ABE61033.1"
FT                   /translation="MEKIITIGLDLAKSVFQVHGIADDGSIVVRRALRRSQVLDFFRAI
FT                   DPCLVGIEACASSHYWANAIGQLGHTVRMMPPTYVKAYVKRSKTDAADAEAICEAVSRP
FT                   TMRFVPIKTPAEQAACMVLRTRELFVRQRSQTANAMRAHMAELGIIAAAGMTSIAKLIL
FT                   VLRDAEDTRLPVAARAALLEMAEQIEMLTARIEKLDTKIIATVKADETAWRLTSIPGVG
FT                   PIIAATVRATIQDPTVFKTGRDLAAWIGITPRANSSGGKERLGRISKQGNKQLRTLLIV
FT                   GATSILKQARRGVKLPSWIISLMARRPYKVVAVALANKIARTIWALLVKGGTYQAPAIM
FT                   TRA"
FT   gene            151606..152184
FT                   /locus_tag="Nham_0133"
FT   CDS_pept        151606..152184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW3"
FT                   /protein_id="ABE61034.1"
FT                   /translation="MLFGWLPWLRGRAVALERGTSIPADAQNDLALILLNEFSEWYRAL
FT                   APKGTLPRAFTGVSSNGRQAVIILADLPLDHVQRREFLIWLCRNEKFIAYAYGTRVGIA
FT                   NDSDSFTEGLDIYASSDRYDASRTLGVERQDGSFIQLTEHSHSLLPSNPANGIFFGLQR
FT                   SNKTIAPDSEVAFLGIWQNLKSKVMWRQR"
FT   gene            complement(152663..153112)
FT                   /locus_tag="Nham_0134"
FT   CDS_pept        complement(152663..153112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW2"
FT                   /protein_id="ABE61035.1"
FT                   /translation="MTVAPHILRRYVIDRASGRSQRHEWAFYAPDIDAWIRTDETSARR
FT                   HEHHKRIRVDGRPWCDVLGHRADVRDDEALQIFFMTMIDPEDWHRLEIAVRNRPKRCLR
FT                   EWRASGKRIMAAVAPETAAPVPDTLGPLDGWPSERGSGQRSLLPR"
FT   gene            complement(153109..153447)
FT                   /locus_tag="Nham_0135"
FT   CDS_pept        complement(153109..153447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61036"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW1"
FT                   /protein_id="ABE61036.1"
FT                   /translation="MISKEKDSQASFEMIANDLINVGRLRFQAEEMMALMDRQHDAAKD
FT                   MGYWRAMRYFDRRGTQMFYVVEYLNRCRAQAEKWAFGQSDTFDVEEALDDLNSFAFPFP
FT                   EEDDEYDL"
FT   gene            complement(153447..155741)
FT                   /locus_tag="Nham_0136"
FT   CDS_pept        complement(153447..155741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61037"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRW0"
FT                   /protein_id="ABE61037.1"
FT                   /translation="MIITTVRHGRTKRDTKNLLAHLRKEIGQTSRVVKIGNVALSNADD
FT                   VAVYMEMMRDGSFADVAMHHIAISPVKRMSPEQIDDAVRRILVAFGAEDHPYVLFEHDG
FT                   KARSAKAVDQHFHVMLGHIGPDGKALDDSGSFRKLEAVARSIEVDIGEDLTHSRRTAAV
FT                   AAELRAMGRDDVADALQVPAELPRAAMSSTTRAMAARAGVDLPETQAAVRAAWTAADNA
FT                   VAFRSALAEQRLEVRPGKKAGVFVVAAGDVEIGALDRIVRMKRGEVAARMEKNENVRPA
FT                   EAARKAEEPRRSDLLRSPGRQRILGESSALIAAARRSREPGVESDRRVEGGFDSRNRDF
FT                   GPSKSSPRAHRNHVRENLDVARLRRADFRALKAAAEAIASGRPDRSLHRRVAERAAVAS
FT                   FRSIDFADVGPIAMKMAAGRIPDQSDLETLKEVRMKLLKPARSLDLKTRLLADIAPRGF
FT                   DVTQFSNDLHMVKVPSPGRATARVMTRDGGWLEFDVRTRKPIRTWGNTGRASVLAQALA
FT                   RHLGTEVQHLAKTASVGANAEALHVVKLSEDKIKSLTMWWAARGYVAVPASDGCWVDAG
FT                   HARIRDTGAELEIHGGVTDEAVNAVLLKARDAWKGNITLDGHWTQAEQDRLWIAAQRQG
FT                   ITVENCRPSQMIQTAWRREQDAGAKSVKTISAVRTEMVDAQDLLAGAMGDRNAIIRLRG
FT                   NLQAFLAIYLDDDQRKELSGRTVADVIPQLNRFRQIGTAELEAWEKQTGRKFTPPKPDA
FT                   EKRADENRLEM"
FT   gene            complement(155738..156100)
FT                   /locus_tag="Nham_0137"
FT   CDS_pept        complement(155738..156100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61038"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV9"
FT                   /protein_id="ABE61038.1"
FT                   /translation="MSGTEKRQKTTTTTLRLTPDERAAVVAAAAAQGLGPSSFARVVTL
FT                   RAAGREAVPFRKQRDVLTAAVAPLLGEAGRIGSNVNQMARHAHIGGRVDPAALDALRIE
FT                   VEALTRAVMALRETAA"
FT   sig_peptide     complement(155978..156100)
FT                   /locus_tag="Nham_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.868 at
FT                   residue 41"
FT   gene            complement(156339..156626)
FT                   /locus_tag="Nham_0138"
FT   CDS_pept        complement(156339..156626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV8"
FT                   /protein_id="ABE61039.1"
FT                   /translation="MTSFLLPSSQVKNRKLQMRIDDLRFEYKPDIFGFIADHCGIDLVI
FT                   QPLRGGFAVEIVDGIGVHPLGSFPSERWAKVAALKAAEKVSGRIDGSRNG"
FT   gene            complement(156793..158691)
FT                   /locus_tag="Nham_0139"
FT   CDS_pept        complement(156793..158691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61040"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV7"
FT                   /protein_id="ABE61040.1"
FT                   /translation="MVAPALACVNDKPAKTSLPRFRFVDNTERRAFGPAEHIRAVHPPN
FT                   AQGTRLRRGFVVWGQKGRWTDEKGRERAWKTWSDPVGGNAECAAEKFIENGKHRTADDL
FT                   YFSMQAFKRPNCRKIWNLAAIGCAYVDIDYKETRWKGRDPRAVLTAVLFALDDARMPPP
FT                   CFVMDSGSGLHLVWPHNLVTPKALPRWNLMQDRIVETLKLFGADPAAKDAARVLRLSGS
FT                   WNPNATRKDPARGLVHLIWIQGDELAKPYRYDFDELADEILPMTRAEIVSLRAERAKRR
FT                   AESKPKSRKGRKPAARRDSASYAEAVLEDLHRLRQHRYRSTSGRLPAGQRDNWLFCAAM
FT                   ALSWITPAPALQRQIEAIAEQVSSWRGREARSRMGSIIKRAQDAAAGKTIEFDGKEVDP
FT                   RYRMKAETIIKWLAIEEAEMRAAGLRVLLSPDVRRERKTLDARDRRKTNGATSHDDKRT
FT                   TRIELGKRATWMHVRSGLTYAEIAAELGVSKATIGKAIDEAHHASLPTSENASGIRRAA
FT                   IRAVYGGITPPKGGLPVPRGTGCLHPARTEPEKQPTTSGGGTAPPRKRTTAASGGGTGA
FT                   KARKSAQRSQAGQRTGGMRKVASTSARHGQSDERHVPDVSMAITNWVPPRFLRRTG"
FT   gene            complement(158977..160173)
FT                   /locus_tag="Nham_0140"
FT   CDS_pept        complement(158977..160173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61041"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV6"
FT                   /protein_id="ABE61041.1"
FT                   /translation="MPHKLHTELPSELEPVREAACRALGSVKPATASTPADKDFLFDAK
FT                   RTNAGRKLPAQHLVYFVLVDLLGYRDLGRSEKLAWSIPIDFNGRAFLIEHRKFGVGVFA
FT                   ADLDRDEADAQQIVNHIHKAVKAARPFFDWLAARAIDESAINVTNKSASLFDRFVFLRD
FT                   GYHLKADDAEARKDERIVKTGKSIDGGEWQTFSFPASRLRTEAKWLGLAAIEAFFSWTE
FT                   HVLIHVGILRGVLTSANEVTSAAEANWSTKFKLAFDLADEHSKKLYDELLVVRKELRNF
FT                   AAHGSFGKLGEAFHFHSSAGAVPVLLPDPIGSRKFTLGEPSPYDLQHALRTIEKFIVHL
FT                   WEGPRAPARIYIQEYELPLILTMTHDGTYRSAMTSIEEMTLFADHLSGQIDRAGDMDW"
FT   gene            complement(160184..160771)
FT                   /locus_tag="Nham_0141"
FT   CDS_pept        complement(160184..160771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61042"
FT                   /db_xref="GOA:Q1QRV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV5"
FT                   /protein_id="ABE61042.1"
FT                   /translation="MIYEYSAQNHDWDLTLHAAAELIKAGLIADKKPRTGTLSMGFSFF
FT                   TGGMVLSFAAIESFSASVAFSMRSHERFSGFDFQRYRNARRFWDKMEMLMSVAGIEIDK
FT                   GNGLFQYIGQMQEWRNLVTHASPYEIEPTEIDNTTSAPGKLHEKKWRLEYTRMADAENA
FT                   KKFYGTALNFINLVTEQTGIDPRASAKFRPMA"
FT   gene            complement(160829..161731)
FT                   /locus_tag="Nham_0142"
FT   CDS_pept        complement(160829..161731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV4"
FT                   /protein_id="ABE61043.1"
FT                   /translation="MAEENEAQAHRAQLSEHHRLGRNLLHAQTRAIDALIHELHALDSA
FT                   RENEAIRVPLLMLQAVGVSVHSVLTLTHQRDMSIRDCFGIARSAVETAVNAAFIAVSGE
FT                   PMAKRAVRHMRQKRWRDLRRQGRVGKHNITVSRDIGIEMDHLPGVREALEEFTNKRGEE
FT                   VRSWTPENLESRITVISNRHGRAGLCLGAASFSVYRPASELLHGTYYGVNLFWQGSRDV
FT                   PARGQEEFDELWVTEHFVTLLTALFFAASGAIDAISAVHMLAGHSERQDDLSRQLSVLV
FT                   EEMGKNDQDDEHDFCTAEL"
FT   gene            complement(161894..163591)
FT                   /locus_tag="Nham_0143"
FT   CDS_pept        complement(161894..163591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0143"
FT                   /product="Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61044"
FT                   /db_xref="GOA:Q1QRV3"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV3"
FT                   /protein_id="ABE61044.1"
FT                   /translation="MRWQKLKKVYSYIRFSTPEQAKGDSLRRQIDNARQWCSERGLVMD
FT                   ESLRDLGISAYTGTNRTTGALRSFLDLVESGKIPKGSILLVESLDRLSREAVIDAASRL
FT                   FDLIRSGITIVTLVDGQEYSAERLNNDWSPLIVSIAVMARAHEESRTKGKRVGEAWAKK
FT                   KQAAREEGRPLTRRCPAWIQIANKKYEVIPEKAQIVQRIFRMAIEGHGSRTILKALNSD
FT                   GIPTFMVSKKKQNNGWQTSSLRRLLTSRTVLGEYQPHVGRHWARKPEGDPVKGFYPAII
FT                   DEATFWRAQSAMESRRGRGGRKGEGVAHLLQGLAKCGDCGSAMHIINKGPLPKGGTYFE
FT                   CSAARRKFECSNTERWRVDRIEARLLKALTYIDVDAVVFGEQRDEVSDKVDILQAKLAD
FT                   AEQRRKRLIVLVESGDDAAAERFQTVAAEVKHIKGELTKATKEAAKTAADPGVKAALIN
FT                   AIDLSQLMTVVADRTRYEYRVRLAHQMRKLVQIVEFHSQEGATARLIPQLNLPPGRVPW
FT                   AAYGFETRSWLIWLNSDDVHGLDFFAPDPEMIAQDTPAPNFELRGRRG"
FT   gene            complement(163628..164275)
FT                   /locus_tag="Nham_0144"
FT   CDS_pept        complement(163628..164275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0144"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61045"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV2"
FT                   /protein_id="ABE61045.1"
FT                   /translation="MVQRVSTVAFEGIEGRVVDVQVQVAPGLPAFNIVGLPDKAVSEAR
FT                   ERVRAALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPSDALSGFS
FT                   VLGELGLDGSIAAVAGVLPAAISANARDEGLICPAACGAEAAWASPDIQIVAACSLIQI
FT                   ANHFKGTQVLSRPQPRIHEPQGALLDLRDIKGQESAKRALEIAAAGGHHLLR"
FT   gene            complement(164375..165316)
FT                   /locus_tag="Nham_0145"
FT   CDS_pept        complement(164375..165316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0145"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61046"
FT                   /db_xref="GOA:Q1QRV1"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRV1"
FT                   /protein_id="ABE61046.1"
FT                   /translation="MKLKIAVQMDPIARINVRGDSTFALLLEAQRRGHAVSYYTPDKLS
FT                   LRGKDLVAPAQSLTVRDQDGDHFTLGEATRAYLESFDVVLLRQDPPFDLAYITTTHLLE
FT                   RIHPKTLVVNDPASVRDAPEKLFVMDFPELMPPTLISRDLDEISSFRAEHGAVVMKPLH
FT                   GYGGAAVFRVMPQDMNFGSLFDMFSVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAQATDLTPREREICERIGPALRERGLLFVGIDVIDGNLTEI
FT                   NVTSPTGIRAIAAFGGPDVAAKIWDRIEAKRS"
FT   gene            complement(165366..165773)
FT                   /locus_tag="Nham_0146"
FT   CDS_pept        complement(165366..165773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0146"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61047"
FT                   /db_xref="GOA:Q1QRV0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRV0"
FT                   /protein_id="ABE61047.1"
FT                   /translation="MTAGKGAPRGDARIAAPERVAAFRTGLSAESRAAAYLIAKGYRIL
FT                   ARRFRTPHGEIDIVARRRQLLAFVEVKARRSLDEAAYAVTPRQQQRIIGAAQVWLMTHP
FT                   EHAAFELRFDAMLIAPRRLPRHLLGAFDAST"
FT   gene            complement(165770..166714)
FT                   /locus_tag="Nham_0147"
FT   CDS_pept        complement(165770..166714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0147"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61048"
FT                   /db_xref="GOA:Q1QRU9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU9"
FT                   /protein_id="ABE61048.1"
FT                   /translation="MRAKSASLKPDTETPGIRTFSIAGHQLVAPRAMPGLHLVATPIGN
FT                   LGDITLRALETLAGVDIIACEDTRITRRLTDRFSITGVLKPYHDHNASTARPKILEQLA
FT                   QGASIALVSDAGTPLISDPGFKLVREVCAAGHQVIALPGPSSVLAALAVAALPTDRFFF
FT                   EGFLPSKETARRTRLAELAQIDATLVMFESGNRIRDSLRDLAAILGNRDAAICRELTKL
FT                   HEDIRRATLVELAQTAAMLETRGEFVLVVGPPPAGAGMMSSADLDNLLLASLKENSVKD
FT                   SVARAVEISCRPRREVYARALELAGQNRAKDDK"
FT   gene            167003..168214
FT                   /locus_tag="Nham_0148"
FT   CDS_pept        167003..168214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0148"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61049"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU8"
FT                   /protein_id="ABE61049.1"
FT                   /translation="MARIRMTDPFKPKPERPGATRRAVLGFVVGAPLLGACSGIQQTLT
FT                   GSSSQPAPSGPAQQAVTIGTGQVKVGLVLPLSAAGNASIAAQSMKNAAEMALSEFQNPN
FT                   IQLLIKDDAGSAQGAQQGAQQALDEGAEVILGPLFAASVPAVAQAARTRGTSVIAFSTD
FT                   SSVAGRGVYLLSFLPESDVNRIVEYAVSTGKRSFAAMVPENAYGNVVEAAFKQTVGRRG
FT                   GRIVAFEKYGADRAGAARKVAQSLRSADALLIADDGDAVVSVADALTAAGANLRNVQLL
FT                   GTGLWDNPRVFASAALQGGLYAAPDPSGFRSFAGRYRAKYGGEPVRTATLAYDAVALVA
FT                   ALARTQGAQRFAAETLTNPSGFAGIDGLFRFRSDGTNQRGLAVMRVASGGGEPIAGSPK
FT                   SFGA"
FT   gene            complement(168230..169390)
FT                   /locus_tag="Nham_0149"
FT   CDS_pept        complement(168230..169390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0149"
FT                   /product="Putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61050"
FT                   /db_xref="GOA:Q1QRU7"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU7"
FT                   /protein_id="ABE61050.1"
FT                   /translation="MTSADPTTAFGVYVHWPFCLSKCPYCDFNSHVRHAPIDEERFVRA
FT                   FTREIETTAARSPGREVSSIFLGGGTPSLMQPQTVGAILEAIGKNWRVADNAEITLEAN
FT                   PTSVEATRFRGYRAAGVNRVSLGVQALDDASLKALGRLHTAREALDAVAIARSVFDRYS
FT                   FDLIYARPDQTPAMWSEELQRAISEAAEHLSLYQLTIEQGTPFFGLHAAGKLKTPDEAI
FT                   SRALYDVTQEICARHGLPAYEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDG
FT                   DRHAIATEKRPEAWLMRVEAIGNGIVADDLLNSEERADEFLLMGLRLREGIDPQRYAAL
FT                   SGRLLDPRRIAILREEGAIAISPDGRLRVTQDGFPVLDAVVADLAA"
FT   gene            complement(169377..170012)
FT                   /locus_tag="Nham_0150"
FT   CDS_pept        complement(169377..170012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0150"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61051"
FT                   /db_xref="GOA:Q1QRU6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU6"
FT                   /protein_id="ABE61051.1"
FT                   /translation="MHRRIAGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPE
FT                   ETGDDFRANATIKAVAAARSAKLPAFADDSGLVVDALDGAPGIYSARWAGETKDFSAAM
FT                   TRIERLLQERGATTAEKRKAHFVSALCVAWPDGHLEEVEARVHGTLVWPPRGTAGFGYD
FT                   PAFQPDGHTRTFGEMTSIEKHGLPPRGLGLSHRARAFVKLAEMSLDQR"
FT   gene            complement(170161..170874)
FT                   /locus_tag="Nham_0151"
FT   CDS_pept        complement(170161..170874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0151"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61052"
FT                   /db_xref="GOA:Q1QRU5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRU5"
FT                   /protein_id="ABE61052.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCMVKFGDTHVLVTATLEE
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREASAGKQGGRTVEIQRLIGRSLRAAVDL
FT                   EALGERQITVDCDVIQADGGTRTASITGAWVALADCIGWMKARNMIKTSVLRDNVAAVS
FT                   CGIYNGTPVLDLDYAEDSEADTDANFVMTGDGRIIEVQGTAEKTPFSQDEFLALLALAK
FT                   KGVARLVDLQKMAVA"
FT   gene            171055..172143
FT                   /locus_tag="Nham_0152"
FT   CDS_pept        171055..172143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0152"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61053"
FT                   /db_xref="GOA:Q1QRU4"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRU4"
FT                   /protein_id="ABE61053.1"
FT                   /translation="MVHHDPIGLIAPNTGLAQLNERSRDIFRQIVESYLATGEPVGSRN
FT                   ISRLITMPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTEFGLRFFVDALMQVGDLTET
FT                   ERQSIQTQLASVGKAQSVEAALDQALTRLSGLTRAAAVVLTAKSNVRLKHIEFVRLEPE
FT                   KALVVLVAEDGQVENRVLTLPSGVPASALTEASNFLNARIRGRTLAEARLELETALTQS
FT                   KAELDQLTQKVIAAGIASWSGGDSDDRQLIVRGHANLLEDLHALEDLERVRLLFDDLET
FT                   KRGVIDLLGRAERADGVRIFIGSENKLFSLSGSSTIIAPYNDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYAARIVSQMLGG"
FT   gene            172225..172836
FT                   /locus_tag="Nham_0153"
FT   CDS_pept        172225..172836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0153"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61054"
FT                   /db_xref="GOA:Q1QRU3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU3"
FT                   /protein_id="ABE61054.1"
FT                   /translation="MREGCVMTDSDGKSDNSGDPAPEAEPVVSKPYIMPDDPEEGSLEA
FT                   LAKEVAEAKDRMLRTLAEMENLRKRTAREVSDARTYGISGFARDVLDIADNLQRALDAV
FT                   PTEARAAADPGLKALIEGVELTERSLHNALEKHGVKKFDPAGEKFDPNVHQAMYEIPDP
FT                   SVPVGTIAQVIQAGYTIGERVLRPALVGVAKGGAKAAASE"
FT   gene            complement(173001..173939)
FT                   /locus_tag="Nham_0154"
FT   CDS_pept        complement(173001..173939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU2"
FT                   /protein_id="ABE61055.1"
FT                   /translation="MRHLTQLIAVLCVLSGVAPAFADDPVYAPGTRIGLVPLIGLSPSK
FT                   TFPGFETADHRVKVVVAELPAAAFKDVENLAKSDTAGAQVIKPQSLETASGQGYFIIET
FT                   AKNGNDNVRRYSMVVSGGTFSGYIAAQVSENVEKIYSDQAMQKMFATVALRKEVPVEEQ
FT                   LGLLPFKLTELSSFKMIRTLAPGAAILLSDAETDDDIDGKAFLIVNLVGSAPERPDDRG
FT                   RFARDIAATIPNLRDGRITMSEPMRINGSPGFETRIDATNTQTNTPVTVVQWLVFGSGN
FT                   TAMRLIGSTPRDGWSAVFPRFRAVRDGIRPH"
FT   sig_peptide     complement(173871..173939)
FT                   /locus_tag="Nham_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            174596..176494
FT                   /locus_tag="Nham_0155"
FT   CDS_pept        174596..176494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0155"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61056"
FT                   /db_xref="GOA:Q1QRU1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRU1"
FT                   /protein_id="ABE61056.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKTPKVIENAEGMRTTPSIVAFSDD
FT                   GERLVGQPAKRQAVTNPERTIFAVKRLIGRRYDDPTVEKDKHLVPYKIAKAGNGDAWVE
FT                   VDGKTYSPSQISAFTLQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKAKQGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVSYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEIGEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDSQNAVTIRVFQGEREMAADNKILGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIDKMVKDAEAN
FT                   AIEDKKRREAVDAKNHADSLVHSTEKALAEHGSKIEDSERRAIEDAVSDLKEALKGDDA
FT                   EAIKAKTNTLAQASMKLGEAMYKQQAEADAAKDAAKDDVVDAEFTEVDDDKNKKSA"
FT   gene            176650..177783
FT                   /locus_tag="Nham_0156"
FT   CDS_pept        176650..177783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0156"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61057"
FT                   /db_xref="GOA:Q1QRU0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRU0"
FT                   /protein_id="ABE61057.1"
FT                   /translation="MSTKRCYYETLEVDRNADDSKLKAAFRKLAMKWHPDRNPGDATSE
FT                   MRFKEINEAYEVLKDGDKRAAYDRFGHAAFEHGGMGGGPGFGAGFASSFSDIFEDLFGM
FT                   AGQRGRGGGRERGADLRYNMEISLDEAFQGKTAQVEIPVSVTCESCSGTGAKAGTKPKN
FT                   CAMCGGAGRIRQAQGFFTLERTCPGCQGRGQMIEDPCPSCGGTGRVNRERSLSVNVPAG
FT                   VEDGTRIRLAGEGEAGIRGGPPGDLYIFLSLAPHEFFQRDGADLHCRVPISMVTAALGG
FT                   EFEVPTIDKSKTKVRVPSGTQSGRRFRIASKGMPVLRSRQTGDMYVQVVVETPQNLTKK
FT                   QQELLAEFEKLSSGATQPEAAGFFTKVKDFFGTRASP"
FT   gene            177877..178479
FT                   /locus_tag="Nham_0157"
FT   CDS_pept        177877..178479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0157"
FT                   /product="Ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61058"
FT                   /db_xref="GOA:Q1QRT9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT9"
FT                   /protein_id="ABE61058.1"
FT                   /translation="MPLQLSARAPKKPLRLDDEVRFLRSWFEKPLHMGAVMPSGRILAR
FT                   TMAQYVDVGSTDPVVELGPGTGAITNALIEHGVDQKRLVLIEYDPGFCALLRDRYPQAT
FT                   VVQGDAYTLRDSLWNVLSARASAIVSGLPLVTKPMLTRLKLIRDAFAALAPGAPFVQFT
FT                   YSVVPPIPKSLPGISTEASERIWMNLPPARVWVYRRG"
FT   gene            178829..179698
FT                   /locus_tag="Nham_0158"
FT   CDS_pept        178829..179698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0158"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61059"
FT                   /db_xref="GOA:Q1QRT8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT8"
FT                   /protein_id="ABE61059.1"
FT                   /translation="MPGNVAPAIPGEYFEDSVVADMRLIVAGAGGRMGRALVRAIAESG
FT                   GAVLAGALEPPGSELIGKDTGVLAGLPANGIEVSADLWSLSAHADGILDFTVPAATIAN
FT                   VAIAAERGLVHVIGTTGLSASDMAVIKSVTSRTVVVQSGNMSLGINLLAALVKRMAQSL
FT                   DESFDIEILEMHHRAKIDAPSGTALMLGQAAADGRKIVLDQHAARGRDGITGARKSGDI
FT                   GFASLRGGTVSGDHSVIFAGPYERITLSHHAEDRMIFAHGALKAAKWAHGKTPGLYSMA
FT                   DVLGLGDL"
FT   gene            179740..180363
FT                   /locus_tag="Nham_0159"
FT   CDS_pept        179740..180363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0159"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61060"
FT                   /db_xref="GOA:Q1QRT7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRT7"
FT                   /protein_id="ABE61060.1"
FT                   /translation="MSERLLVLVRHGQSEWNLKNLFTGWKDPDLTELGVTEAKDAGRKL
FT                   KEQGFAFDIAFTSVLIRAEHTLDLVLEELGQTGIPVRKDLALNERDYGDLAGLNKDEAR
FT                   KKWGEEQVLIWRRSYDVPPPGGESLKDTLARTLPYFVQEILPCVLRGECTLVAAHGNSL
FT                   RALVMVLEKLSPEQILKRELATGAPVIYRLNADATVASKLDLAA"
FT   gene            complement(180499..181443)
FT                   /locus_tag="Nham_0160"
FT   CDS_pept        complement(180499..181443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0160"
FT                   /product="DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase / Transcriptional regulator Ada /
FT                   transcriptional regulator, AraC family"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61061"
FT                   /db_xref="GOA:Q1QRT6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT6"
FT                   /protein_id="ABE61061.1"
FT                   /translation="MAATQPPPYIRVMMTFAKSFAPNDPRLTLPGAESAALRDYDAVRR
FT                   AIAFISANWRTQPTIAAIADAAGVAPDELHHLFRRWAGLTPKAFMQALTLDHARGLLRK
FT                   SASVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKNGGAGMRLAFGFHPSPFGTAIVIA
FT                   SSRGLAGLAFADAGEEQTALADMKRRWPNATYVEDHAGTAALAQRVFDTKLWRPDQPLR
FT                   VVLIGTDFEVRVWETLLRIPMGKATTYSSIAANVNSPKASRAVGAAVSKNPVSFVVPCH
FT                   RVIGKSGALTGYHWGITRKQAMLGWEAGQVGVE"
FT   gene            complement(181569..182093)
FT                   /locus_tag="Nham_0161"
FT   CDS_pept        complement(181569..182093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61062"
FT                   /db_xref="GOA:Q1QRT5"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT5"
FT                   /protein_id="ABE61062.1"
FT                   /translation="MTLDNNLTNPELAEQTLFSALLTPHRSLTQAGFIVLMTIVTVVSF
FT                   VAGMVFLMMGAWPVFLFFGLDALMIYWAFRINFLRARATEEIFITHFELRVRRTSHRGH
FT                   IVEWVSNPLWVQLDQKIHEEYGIERLYLVSRGRRISIASFLGPDEKVSFVEALSAALQL
FT                   AKRGPTYNPLS"
FT   gene            182236..183024
FT                   /locus_tag="Nham_0162"
FT   CDS_pept        182236..183024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0162"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61063"
FT                   /db_xref="GOA:Q1QRT4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT4"
FT                   /protein_id="ABE61063.1"
FT                   /translation="MGQAPAAKPRKRAATPEAGAASKAILPAAKRPAKPARRSARGSAA
FT                   PTPPLRPWTVAEIREAFVRFRNANPEPKGELEHLNPYTLLVAVVLSAQATDAGVNKATR
FT                   ALFAVADTPARMLALGEEKVRDHIKTIGLYRNKARNIIALSEKLLADFNGEVPRSRAGI
FT                   ESLPGAGRKTANVVLNMAFGEHTMAVDTHVFRVGNRTGMAPGKTPLEVELGLERVIPDE
FT                   FMLHAHHWLILHGRYTCLARSPRCAVCLINDLCRWPEKTI"
FT   gene            complement(183215..184915)
FT                   /locus_tag="Nham_0163"
FT   CDS_pept        complement(183215..184915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0163"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61064"
FT                   /db_xref="GOA:Q1QRT3"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT3"
FT                   /protein_id="ABE61064.1"
FT                   /translation="MASTDTYNPSRDDFAAMLDESFAGGSLQESSVIKGKVVAIEKDMA
FT                   VIDVGLKTEGRVALREFAGPGRENSLKVGDEVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFQNNEKVHGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVGPLMNNTQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLAIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARYTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVEVQ
FT                   VLEVDAVKRRISLGLKQTMRNPWEAFVEKHPVGSTVEGEVKNKTEFGLFLGLEGDVDGM
FT                   VHLSDLDWKQPGEQVIDNFKRGDMVKAIVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAVVTCEVLEIKDGGIEVQIAGTEFQTFIKRSELARDRNDQRSERFAVGEKVDARVIQF
FT                   DRKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRTDK"
FT   gene            complement(185323..185952)
FT                   /locus_tag="Nham_0164"
FT   CDS_pept        complement(185323..185952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0164"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61065"
FT                   /db_xref="GOA:Q1QRT2"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRT2"
FT                   /protein_id="ABE61065.1"
FT                   /translation="MIIAIDGPAASGKGTLGKRLAHHYHFRHLDTGVIYRAVAKALLDA
FT                   GADPADEALAVAAALELDPEKFGHPALKTQTVGEVASVVSAFPRVREALLTFQRQFAAE
FT                   PPGAVLDGRDIGTVICPEADVKIFVVADPVVRARRRTLEARSRGEEADEAVVLADILKR
FT                   DERDRNRPIAPLKAAADAHVLDNSNLDIEAGLKAAIAIVEAVRAGR"
FT   gene            complement(185949..187298)
FT                   /locus_tag="Nham_0165"
FT   CDS_pept        complement(185949..187298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0165"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61066"
FT                   /db_xref="GOA:Q1QRT1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRT1"
FT                   /protein_id="ABE61066.1"
FT                   /translation="MTHSGQPAPLEARKCQSLIGRVRVPGDKSISHRALILGALAVGET
FT                   RIAGLLEGEDVLNTAKAMQALGAKVERRIDDKSGIVWSVRGVGTSGFATPEAPLDFGNS
FT                   GTGCRLVMGAVAGCPIVATFDGDGSLRSRPMRRILDPLELMGARVTGESDGGRLPLTLA
FT                   GARDPLPIVYRTPVASAQIKSAVLLAGLSAPGITTVIESEASRDHTELMLKHFGAQIVS
FT                   VSDGTHGRKISLTGQPELHGAAVTVPADPSSAAFPIVAALITEGSDIVLTDVMTNPLRT
FT                   GLFATLREMGASIEESETRLDAGEPMAQLRVRASKLRGVEVPAARAPSMIDEYLVLAVA
FT                   AAFAEGTTVMRGLHELRVKESDRLEAAAAMLRVNGVAVEIAGDDLIVEGRGRVPGGGLV
FT                   TTHMDHRIAMSALAMGCASDAPVKVDDTAFIATSFPDFVPMMRRLGADFA"
FT   gene            187444..187857
FT                   /locus_tag="Nham_0166"
FT   CDS_pept        187444..187857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61067"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRT0"
FT                   /protein_id="ABE61067.1"
FT                   /translation="MAKSELGTKRICPTTGKKFYDLNKTPVISPYTGEVVPIVVAPVRA
FT                   RGEAARAAAAAASASDASPEPAEAEGLVSLEEADAEENTGKVKKAVVPESEDDIEVDDT
FT                   LDEDDDSTFIADEEEGDEDVTNIIGDVGDDEET"
FT   gene            188039..188114
FT                   /locus_tag="Nham_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            188039..188114
FT                   /locus_tag="Nham_R0002"
FT                   /product="tRNA-Ala"
FT   gene            188426..188857
FT                   /locus_tag="Nham_0167"
FT   CDS_pept        188426..188857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0167"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61068"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS9"
FT                   /protein_id="ABE61068.1"
FT                   /translation="MSRVPSLSSPFLLGFDEIERALDRVVKGADGYPPYNIERCGCDRN
FT                   NGQPERLRITLAVAGFTRDQLDVTIEENQLVIRGRQQDDKIRQYIHRGIAARHFQRTFV
FT                   LAEGMLVLGADLKNGLLSVDLARPEAERIVKTIAINEHE"
FT   gene            188963..189229
FT                   /locus_tag="Nham_0168"
FT   CDS_pept        188963..189229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0168"
FT                   /product="protein of unknown function DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61069"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS8"
FT                   /protein_id="ABE61069.1"
FT                   /translation="MREVSATLQPESLSIEALAQLGEGHIAYVKQVRSEDVPDLFPQAP
FT                   KIAPGLMLFALHAADGTPIMLTDSREAAVASAWSNELQAVSVH"
FT   gene            189495..191336
FT                   /locus_tag="Nham_0169"
FT   CDS_pept        189495..191336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0169"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61070"
FT                   /db_xref="GOA:Q1QRS7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRS7"
FT                   /protein_id="ABE61070.1"
FT                   /translation="MPAYRSRTSTHGRNMAGARGLWRATGMKNEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAALRLNVPAVFVSGGPMESGKVNVNGKIRSVD
FT                   LIDAMVAAADDSVSDADVEAIERSACPTCGSCSGMFTANSMNCLTEALGLALPGNGSVL
FT                   ATHADRKGLFVEAGHLIVDLARRYYEQDDARVLPRAIASFKAFENAMTLDISMGGSTNT
FT                   VLHLLAAAYEGEVPFTMKDIDRLSRRVPVLCKVAPSVVDVHLEDVHRAGGIMGILGELD
FT                   RAGLIDSSLPTVHSTSLKDGLERWDIKRTKSDSVRSFYLAAPGGVRTQVAFSQDKRFEE
FT                   LDADRSSGCIRDAEHAFSKDGGLAVLYGNIARDGCIVKTAGVDDSILTFSGPARIFESQ
FT                   DAAVDAILTNRIQPGDVVLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKQCALITDGRFS
FT                   GGSSGLSIGHVSPEAAEGGAIGLVEEGDRIVFDIPNRKVHLDVSDAELERRRAAMEAKG
FT                   DKAWKPAPRKRRVTMALKAYAAHATSAALGAVRVVKD"
FT   gene            complement(191721..192119)
FT                   /locus_tag="Nham_0170"
FT   CDS_pept        complement(191721..192119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61071"
FT                   /db_xref="InterPro:IPR009273"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS6"
FT                   /protein_id="ABE61071.1"
FT                   /translation="MPSAKSILLICAFALTVMAPAGATDPRFIASLGKLDPQTRLEQIC
FT                   DLAAVKHIGKSGKLPKPDRAKSNVITPPRHHGDTIVANGGAFRSGGKWYAFSFKCKGSP
FT                   DHLDVLSFTYRVGAMIPKSKWPEYGLWD"
FT   sig_peptide     complement(192048..192119)
FT                   /locus_tag="Nham_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            complement(192484..192945)
FT                   /locus_tag="Nham_0171"
FT   CDS_pept        complement(192484..192945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0171"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61072"
FT                   /db_xref="GOA:Q1QRS5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS5"
FT                   /protein_id="ABE61072.1"
FT                   /translation="MMITDLVAPEAILPALKVNSKKQALQELAARAAELTGQNDRAIFE
FT                   VLLRREKLGTTAVGYGVAIPHGKLQKLDKIFGLFARLDRPIDFEAMDGQPVDLIFLLLA
FT                   PEGAGADHLKALARIARLLRDQDIANKLRASRDAQAIYSVLALPPATVP"
FT   gene            complement(193196..193792)
FT                   /locus_tag="Nham_0172"
FT   CDS_pept        complement(193196..193792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0172"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61073"
FT                   /db_xref="GOA:Q1QRS4"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS4"
FT                   /protein_id="ABE61073.1"
FT                   /translation="MTLRISGKSINVGEALRGRLNSRTDEVLRKYFDGKYSGHITLCKD
FT                   GFGFRTDCALHLDSGVTLEAESNAADAYASADQALLQIEKRLRRYKSRLKDRSARKIHA
FT                   TTEAVAVLDAPSYVIEAPNVDGEDEVTAFNPVIIAEAITSLRRLSVSEAVMELDFTGVP
FT                   VLVFQHGSSGRVNVIYRRPDGNVGWIDPPAVNGSA"
FT   gene            complement(193849..195489)
FT                   /locus_tag="Nham_0173"
FT   CDS_pept        complement(193849..195489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0173"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61074"
FT                   /db_xref="GOA:Q1QRS3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS3"
FT                   /protein_id="ABE61074.1"
FT                   /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLTAFVEDELER
FT                   NPLLERASDGPEPPAAGEPAARDAEFSEGGDAAAFGDDDTGERSGGQSSEPAPDEWINS
FT                   ELGSRTEIEQTFDSGLENVFPEEPAEAAARAAQDSAPTAFTEWGGGASNDDSYNLEAFV
FT                   AAEVTLCEHLAEQLAVTVTAPAQRMIGRYLIDLVDDAGYLPPDLGEVGDRLGAGADDVA
FT                   AVLAVLQTFDPPGICARNLSECLAIQLREKDRYDPAMQVLVEHLDLLARRDFAGLRRIC
FT                   GIDDEDLAGMIGEIRHLDPKPGLRFGTPRTQTVVPDVYVRPGPDGGWLVELNSDTLPRV
FT                   LVNQTYYAELSKTIRKDGDKAYFTDCLQNATWLVRALDQRARTILKVATEIVRQQDGFF
FT                   TSGVAHLRPLNLKTVADAIQMHESTVSRVTANKYMATNRGIFELKYFFTASIASADGGD
FT                   AHSAEAVRHHIRQLIDAEDPSAVLSDDTIVERLRQAGIDIARRTVAKYREALRIPSSVQ
FT                   RRRDKQSVLGNARTAAAPSADRSRDIAPA"
FT   gene            complement(195721..196104)
FT                   /locus_tag="Nham_0174"
FT   CDS_pept        complement(195721..196104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61075"
FT                   /db_xref="GOA:Q1QRS2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS2"
FT                   /protein_id="ABE61075.1"
FT                   /translation="MKIIVTVVALALPLLSSAALAQERAGSAALGALSGAVVLGPVGAV
FT                   AGAVVGYTAGPSIAHSWGLRRSSTKRKRQSTNRSQRRLTTVNDSRRAPGAQTASPKPRP
FT                   TAAAAAAPRAVDPTPMPPVQALY"
FT   sig_peptide     complement(196039..196104)
FT                   /locus_tag="Nham_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            196228..196590
FT                   /locus_tag="Nham_0175"
FT   CDS_pept        196228..196590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS1"
FT                   /protein_id="ABE61076.1"
FT                   /translation="MAGCAAQSTTRKLHMVKTSLLVAAASLLLALPASAADLSFTGEAP
FT                   QVAPIAQAHMICDDDGYCYRTHAPRYVQRWHDDDGDDGAGDERRDYRPRYYAPRAGVSR
FT                   NDDDDGSAFGVDVGPW"
FT   sig_peptide     196228..196335
FT                   /locus_tag="Nham_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            complement(196682..197683)
FT                   /locus_tag="Nham_0176"
FT   CDS_pept        complement(196682..197683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0176"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61077"
FT                   /db_xref="GOA:Q1QRS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRS0"
FT                   /protein_id="ABE61077.1"
FT                   /translation="MVDIFNVFRKRPQKRGPQAFARTQADITALGDTIGDMLTSPVRDA
FT                   PPIARGADRDVPPVAPVPQSRRPARPTPEPPRPRAASNGAAAPRMAKRPGYLAVHGVEK
FT                   SFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIPADRGAIELDGHDVTKL
FT                   PMYQRARLGIGYLPQEASIFRGLSVEQNIRAVLEVVEPSKKKREAELDALLEEFNISRL
FT                   RKTPSIALSGGERRRVEIARALATRPSYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIG
FT                   VLITDHNVRETLGLTDRAYIVYAGEILTEGSPDEIVNDPDVRRLYLGEEFRL"
FT   gene            complement(197904..198590)
FT                   /locus_tag="Nham_0177"
FT   CDS_pept        complement(197904..198590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0177"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61078"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR9"
FT                   /protein_id="ABE61078.1"
FT                   /translation="MNPATQSPRHLPLATRIAGLLCGGLITIAVMAAGEAAGQSAVQGV
FT                   PNAMQGFSQNRDQPIQIEAAALEMRDKKKEATFSGNVKVVQGDTTMTSKTLVVYYESGN
FT                   SANAKGKSPSKPAMASATPGPSGASSIKRLEARGNVVVTQKDQVVTGDTAQFDTRTNLV
FT                   TMLGKVVLTQGKNVLRGDRLIVDMTTGVSRVESNSGRVQGLFQSSGQGGPLSGPMPLSG
FT                   SSQKPK"
FT   sig_peptide     complement(198492..198590)
FT                   /locus_tag="Nham_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.854 at
FT                   residue 33"
FT   gene            complement(198587..199363)
FT                   /locus_tag="Nham_0178"
FT   CDS_pept        complement(198587..199363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61079"
FT                   /db_xref="GOA:Q1QRR8"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR8"
FT                   /protein_id="ABE61079.1"
FT                   /translation="MYSVQNPTYQAGMQTGLEARFARAARHSRMVRALRIAVPAVVGLV
FT                   MAALIAVAVFNPFRALAKLPLEMDNLVVSGTKITMESPHLSGFTPDKRPYEMQATTATQ
FT                   DITDPDHVELHTLRAKVLMEDRSTVTLNSRTGVFDTKTQMLDLHKDILMQSSTGYEARL
FT                   SHALVDMGQGTVTSDQPVDVKLLNGTLTADTMKVTEKGDVVRFENNVVMHLVMDRPVAT
FT                   AGPADEETAPPAASAERTHTSRGRSHTQHNSGGDTK"
FT   gene            complement(199614..200234)
FT                   /locus_tag="Nham_0179"
FT   CDS_pept        complement(199614..200234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0179"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61080"
FT                   /db_xref="GOA:Q1QRR7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR7"
FT                   /protein_id="ABE61080.1"
FT                   /translation="MTIRLHRGDLPDQDLKRYTHSAAIDTETMGLNPHRDRLCVVQMSP
FT                   GDGSADVIQIAQGQREAPNLKQLLADPTIVKIFHFARFDLAALSNAFGVMPQPVYCTKI
FT                   ASRLIRTYTDRHGLKDLVRELLNIELSKQQQSSDWGAQTLSDAQLAYAASDVLHLHALR
FT                   DKLDAMLARENRTGMAQACFEFLPTRAKLDLSGWGAEDIFAHA"
FT   gene            200513..201277
FT                   /locus_tag="Nham_0180"
FT   CDS_pept        200513..201277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0180"
FT                   /product="protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61081"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR6"
FT                   /protein_id="ABE61081.1"
FT                   /translation="MKAERQQRSPRFAILIDAENVSSKFADGLFKKIAQMGDAPVRLIY
FT                   GNLSGPNLKGWASVLPDHSLERRDQIRAAKGKNSADMALVIDAMDLLHDGRINGFCLVS
FT                   SDSDFTNLAARLRREGASVYGFGEKKTPDCFQRACDRFISLEGLLPKTSEPKPIAVPPP
FT                   ILPNSKNPKPPSAAIPILNKAISQIESEDGWALLGPVGQQISKLFSDFDVRSYGFGKLS
FT                   SLVRKTGAFEIDENNGPMRIRTRPRAGRKPAS"
FT   gene            complement(201529..202158)
FT                   /locus_tag="Nham_0181"
FT   CDS_pept        complement(201529..202158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61082"
FT                   /db_xref="GOA:Q1QRR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR5"
FT                   /protein_id="ABE61082.1"
FT                   /translation="MSENTNGTVNYTAREAVGVFSDFEALEAAVDELEVSGFDRAAVSV
FT                   LASDQKIKERMDGLYPTLIEIEDDGRAPGTAFAEKGSRVEGEAALVGIPFYIGCVAAAA
FT                   VAAGSGGLAVPAIGTIIVGAAAGGGLGALLAGAVAHHHRASVSKQLSRGGTVVWVSVRD
FT                   DDAEKRAVEILTKAGARDVHVHEIQREWTLKDRPLSEGQPDPLLRI"
FT   gene            202247..202450
FT                   /locus_tag="Nham_0182"
FT   CDS_pept        202247..202450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR4"
FT                   /protein_id="ABE61083.1"
FT                   /translation="MFPVEAARKIGDGSTDTIIGHLPKFVLGMSHSSDGIGVIARPTEA
FT                   QPPDRPGRHQRDSYRRALIIPR"
FT   gene            complement(202647..202733)
FT                   /locus_tag="Nham_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(202647..202733)
FT                   /locus_tag="Nham_R0003"
FT                   /product="tRNA-Leu"
FT   gene            203006..203974
FT                   /locus_tag="Nham_0183"
FT   CDS_pept        203006..203974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0183"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61084"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR3"
FT                   /protein_id="ABE61084.1"
FT                   /translation="MASNTDTLVTVFGGSGFLGRHVVRALAKRDYRIRVGVRRPELAGH
FT                   LQPLGKVGQIHAVQANLRYPASVRAAMRDSHVAINLVGILSKSGAQTFDAVVAEGAATV
FT                   AKAAAATGARMVHVSAIGADDKSASAYARAKAAGEKAVLAAVPSATILRPSVVFGSEDQ
FT                   FANRFAALALMSPVLPLIGGGATKLQPVYVGDVATAVADAVDGRTKAGAVYELGGPEVL
FT                   SMREIIQIILRVIERERVLVPLPFLIARFKAMFLQFAPGALKLTPDQVALLRTDNVVSD
FT                   SATAAGLTLQGLGISPDSMEAVVPQYLWRFRKAGQFAQNGA"
FT   gene            complement(204018..204824)
FT                   /locus_tag="Nham_0184"
FT   CDS_pept        complement(204018..204824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0184"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61085"
FT                   /db_xref="GOA:Q1QRR2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRR2"
FT                   /protein_id="ABE61085.1"
FT                   /translation="MFSDAIRAVILGIVEGVTEFLPVSSTGHLLLAERFFDLGSGNFWN
FT                   TFTVLIQLGAILAIVVIYFEKLWRIALGMFSNDADRRFVIGVLAAFLPAVVVGLIAGKY
FT                   IKELLFNPWVVCFSLIVGGAVLMWVDQLDHKPHEHDATAFPLPMYIWIGIAQCLAMIPG
FT                   VSRSGATIVSAMLLGADKRAAAEFSFFLAIPTMIGAFAYDFYKNRADMTTDHLGIVAIG
FT                   FVVSFVTAIVVVKAFLSYVTRNGFTFFAWWRVIVGTLGLIALALGR"
FT   gene            205005..205697
FT                   /locus_tag="Nham_0185"
FT   CDS_pept        205005..205697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0185"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61086"
FT                   /db_xref="GOA:Q1QRR1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR1"
FT                   /protein_id="ABE61086.1"
FT                   /translation="MFTLFHHPFCPQSRFIRLALGEHGLDVRPVEERVWERREAFLALN
FT                   PAGTTPVLIAEGVPAVPGAAIIADYLDETYGERIGDRRLLPTTMPERIEVRRLMAWFNE
FT                   KFFEEASGPLVTERIYKRFMGEAIGGGSPETDVMRAARTNVRYHLAYIGWLARTRNYLA
FT                   GDRLTYADLAAAAHLSAIDYLGDVPWAEDDAAKAWYARIKSRPSFRPLLSEWLAGVPAS
FT                   RTYVDLDF"
FT   gene            complement(205913..206833)
FT                   /locus_tag="Nham_0186"
FT   CDS_pept        complement(205913..206833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0186"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61087"
FT                   /db_xref="GOA:Q1QRR0"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRR0"
FT                   /protein_id="ABE61087.1"
FT                   /translation="MRILVVGAGATGGYFGGRLLNAGQDVTFLVRSRRATELASAGLVV
FT                   KSPLGDFTLKNPPTVQAGGLSERFDVILLSCKAFDLDDAITSFAPAVGPRTAIIPLLNG
FT                   MRHLEALDAKFGRERVLGGLCSLAVTLNDKREIVHLAPMQSLGFGERDGGTSDRVRAIT
FT                   EVFASGNCGSQASDDIIQDMWEKWVFLATLAGATCLMRASIGQIVAAPGGRDFILSALD
FT                   EIAGIAKAAGHAPREQFLTRTTAMLTAEGSPLTASMFRDIEAGARVEADQIIGDLITRA
FT                   EAAKLPVPKLRTIYTHLKAYENRRG"
FT   gene            complement(206930..208279)
FT                   /locus_tag="Nham_0187"
FT   CDS_pept        complement(206930..208279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0187"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61088"
FT                   /db_xref="GOA:Q1QRQ9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ9"
FT                   /protein_id="ABE61088.1"
FT                   /translation="MTTARPLWQAYLAFLMPMMLSNVLQALFGTINGIYLGQMIGVDAL
FT                   AAASIFFPMMFFFISFIIGLGAGSSVLIGQAWGARAVGKAKAIAGTTLALTLLGGCVIA
FT                   IGGGVFARDLMMALATPPNILDAATDYARIMMITMPATFTFLLATAMMRGVGDTVTPLW
FT                   ALAISTLIGLVVTPALIRGWFGLPQFGVASAAIASAISAVVTLLWLGVHMRRMNHPLAP
FT                   DAALLRAMRLDRELLGKVLRIGVPTAVQMVVMSLAEIVLLGIVNRFGSDATAAYGAVNQ
FT                   VLSYVQFPAISIAITASIFAAQAIGAGQTGRIGAIVRTGIWLNLLLTGGLVALGYLLSR
FT                   IIIGLFITNPEVLDLAQTLLFIVLWSTVPFGMAGVFSATMRASGTVLVPTLLSILAIVA
FT                   VEVPVAMVLSHRIGVEGVWIAYPAAFCTMMVLQMAFYLMVWRKREIKRLI"
FT   gene            complement(208502..209083)
FT                   /locus_tag="Nham_0188"
FT   CDS_pept        complement(208502..209083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61089"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ8"
FT                   /protein_id="ABE61089.1"
FT                   /translation="MIHDQTSCFTAFEGQRRIASGPLADVALAVKRAGTRTTAPIAIYS
FT                   DATGRPIDLDLRGSDDEIAARLTLPVGTAEACDASKPRGRGRPKLGVVAREVTLLPRHW
FT                   DWLSAQPGGASVALRKLVEEARRSSGDRDRSRAARDAAYHFMSAMAGNLANFEEAARAL
FT                   FAGDRRRLAGLIAGWPDDIRDHIVKLVERI"
FT   gene            209445..210620
FT                   /locus_tag="Nham_0189"
FT   CDS_pept        209445..210620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61090"
FT                   /db_xref="GOA:Q1QRQ7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ7"
FT                   /protein_id="ABE61090.1"
FT                   /translation="MGGSGVVILGGAHGTLALARSLGTLKIPVVCISNDRMLPSWSRYV
FT                   EGPISWPGHCDGEAVSFLARMAKERKWDGYLLVPAGDGEVRFVSENRAALSATFKIMLP
FT                   GWDSLRWLCDKPFLYRRADELNVKIPRTHRLVSVEQAETLAVTFPVVLKPNMGGGNGPF
FT                   FKAKVVRADDQAELARAYRDAAGQIGAANVVVQELIPGGGESQFSYAALWHDGQPVTEF
FT                   TARRTRQYPVDFGYTSTFVEVVDEPRAIEAARTMLASVGFGGLVEVEFKRDHRDGSLKL
FT                   LDVNPRPWSWFGLCAAAGVDLGAMMWQVANGRPAKPAVAQIGVSWMYLVRDFVVAMTLL
FT                   VRGRIGVGDYLRSFGRVRAWAAFALNDPLPGVIDLPLTAWRVLTRRVLKIG"
FT   gene            complement(210726..211865)
FT                   /locus_tag="Nham_0190"
FT   CDS_pept        complement(210726..211865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0190"
FT                   /product="Uncharacterized protein involved in methicillin
FT                   resistance-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61091"
FT                   /db_xref="GOA:Q1QRQ6"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ6"
FT                   /protein_id="ABE61091.1"
FT                   /translation="MLQQANVPPLGVAAPIDCPTPADRYSVEIDSVASDAWDVIASGFA
FT                   DIHPEQTACYASNHWKGHDSHLLLRHNGEPVAGARVAIVGLPLIGRGLAFLRFGPFWRK
FT                   QKAEADPEIYRTMIAALVEEYCVTRGHCLTTLSRPHPHYHALECGLLRDLGFVQRRAFS
FT                   DCERYVVNTALDAETQRRSLAQKWRYNLRQALGNSVDVRLTEDPEEIQAFQALYVSMME
FT                   RKHFSSTTPVHLTGELISRLPEKLKPKLVIARHAGKLVAGATIGLFGDTAYYMFGATSA
FT                   DALPIKAGYALHWWIFNWLHDHGYEWYDLGGAAHEPGLRQFKKGFVGKAGSVVVMEGEF
FT                   DRWASSLGRLSADTVFGLRHLKRRIQYGAKFGKLADPSS"
FT   gene            complement(212055..213800)
FT                   /locus_tag="Nham_0191"
FT   CDS_pept        complement(212055..213800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0191"
FT                   /product="gamma-glutamyltransferase 1, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61092"
FT                   /db_xref="GOA:Q1QRQ5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ5"
FT                   /protein_id="ABE61092.1"
FT                   /translation="MIRRRPRRHIFFLAIAAWMVLWAPASAQDVRGASPPLAPGAIRPV
FT                   VAKHGMVVAQEKLAAAIGAEVLARGGNAIDAAVATGFAMAVTYPRAGNIGGGGFMVIHL
FT                   ADGNRDIAIDYRETAPAATRRDIFLGTDGKPDPAKSRDSALGIGVPGTVAGLALALDKY
FT                   GSGKFTLADLLKPAIALARDGLKIGDDTADTLPQWHRRIARWPSSMTIFSHPDGSALRE
FT                   GDLLIQTDLAATLTAIADHGPRGFYEGPVASKLVKGIRAAGGIMTLDDLRSYRPLDREP
FT                   VRGSYRGYDIVSMPPSSSGGTVLIESLNILEGFPMRDLHQGSVDSLHLLIEAMKRAYAD
FT                   RARYLGDPAFVQAPIATLLAKNYAAKQRASIDMMRATPAAAVPLPPPHEGDNTTHFSVA
FT                   DAFGNAVSNTYTLNFSYGVGLVADGTGVLLNNELDDFTAAPGAANAYGLVGFAANLPGP
FT                   GKRPLSSMTPTIVLKDGKPVLVTGSPGGSRIISTVLQVIVNVIDYDMTIADAVDAPRLH
FT                   HQWLPDRVRAERGFSEQIIAGLRARGHTVVMPMGQTSANSIAITPDGFFGAADPRTRGS
FT                   SAAGY"
FT   sig_peptide     complement(213717..213800)
FT                   /locus_tag="Nham_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 28"
FT   gene            213912..215321
FT                   /locus_tag="Nham_0192"
FT   CDS_pept        213912..215321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0192"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61093"
FT                   /db_xref="GOA:Q1QRQ4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ4"
FT                   /protein_id="ABE61093.1"
FT                   /translation="MTVTTAVPAGNADPGARYASRTAVASWIMFDWAAQPYFTLITTFV
FT                   FAPYFATFVAATPAEGQSLWGFATGAAGIVIALASPVLGAIADASGRRKPWIAAFGALL
FT                   VIGSSLMWIGKPGDAGVILPLLIAYGIATVGVEFATVFNNAMMPSLVPPDKIGRLSGTG
FT                   WATGYIGGILSLVLVLGFLAANPATGKTLFGLSPLFGLDPATHEGDRITGPLTGLWFVI
FT                   FVLPMFLLTPDFPARRPLRTALREGLIELRGTLRELPKRKSMATFLLANMIYTDGLVSL
FT                   FAFGGIYAAGTFGWHTIQIGTFGILLAIAGALGAWIGGKLDDRVGPKVVIAASMIVLLS
FT                   AIVAILMVDRDSILFVEVAPPVPGGGLFAAPAEKAYLILGCLIGGAGGPLQAASRTLLI
FT                   RLAPKDRIAQFFGLFALTGKVTSFVGPLLVGLITAITASQKAGMAVLVLFFLAGLVLLS
FT                   QVRVQPGQSSG"
FT   gene            complement(215345..216328)
FT                   /locus_tag="Nham_0193"
FT   CDS_pept        complement(215345..216328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0193"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61094"
FT                   /db_xref="GOA:Q1QRQ3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ3"
FT                   /protein_id="ABE61094.1"
FT                   /translation="MSRNPVAPSVPAVAVLALAAAGFIGSMLSASAAAPLTGATPEQPP
FT                   AAKTEAARPSYTPPADSDIPDGPFGDMIRLGEAIFHDTRHNAKGFVGNDLQCSNCHIDR
FT                   GRQPNSAPLGAAYLLYPAYRAKNGHVNTFQERLQGCFRFSMNGKAPPFNDKVLVALETY
FT                   AYFLAKGGPTGVAVKGQGYPKLKAPDQPADYDRGAKAYAQHCSLCHGGDGEGQKSADGQ
FT                   TVFPPLWGPRSFNWGAGMASINNAAGFIKANMPLGLGGSLSDQEAWDIATYMDSQERPQ
FT                   DPRFVESVAETRKRFHDEPTSKYGLVVNGVHLGEKSPPSGTIDAAD"
FT   sig_peptide     complement(216230..216328)
FT                   /locus_tag="Nham_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.820 at
FT                   residue 33"
FT   gene            complement(216325..216987)
FT                   /locus_tag="Nham_0194"
FT   CDS_pept        complement(216325..216987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0194"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61095"
FT                   /db_xref="GOA:Q1QRQ2"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ2"
FT                   /protein_id="ABE61095.1"
FT                   /translation="MRSLVGAALLLLGMSALPVLAADGKDITARGTPDRAASCSPCHGQ
FT                   NGQGQPATGVPRLAGLNAQYFERQLESFKDGTRKNRIMLMIASDLTDGERKALANYYAD
FT                   MATPKPETAPADPAVIAAGAKLAATGDWSKDLPGCGQCHGAAGLGVGTDFPRLAGQWAV
FT                   YIEKALRSWKAGDRKNDPMGVMANVANKLTDDQIKSVAAYYESLPVAAPVHNPDNKP"
FT   sig_peptide     complement(216922..216987)
FT                   /locus_tag="Nham_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(217228..218820)
FT                   /locus_tag="Nham_0195"
FT   CDS_pept        complement(217228..218820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0195"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61096"
FT                   /db_xref="GOA:Q1QRQ1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ1"
FT                   /protein_id="ABE61096.1"
FT                   /translation="MTDRPRRVTRALLSVSDKTGLIEFARALAGLGIDLVSTGGTAKAI
FT                   AAAGLKVSDVSELTGFPEMMDGRVKTLHPKVHGGLLAIRDNGDHAKAMKDHGIAPIDLL
FT                   VVNLYPFEATVDKGAPYEDCIENIDIGGPAMIRAAAKNHDDVAVVVEAQDYQAVLDELK
FT                   ANDGATTLGLRKRLAAKAYARTAAYDAAISNWFAVQLATDAPDYRAFGGRLAQTLRYGE
FT                   NPHQTAAFYRTPDRRAGVSTARQLQGKELSYNNINDTDAAYECVAEFDATRTAACVIIK
FT                   HANPCGVAEGADLASAYRKALACDQTSAYGGIIAFNRTLDADAANAVAGIFTEVIIAPD
FT                   ATEEAIAIIGKRKNLRLLLAGGLPDPRARGLTAKTVAGGLLVQGRDNAVVDDMALTVAT
FT                   KRAPTDAEMRDLRFAFRIAKHVKSNTIVYAKDLATVGIGAGQMSRVDSARIAARKADDA
FT                   ARELKLAQPLTIGSVVASDAFFPFADGMLACVEAGATAVIQPGGSMRDDEVIKAADEHG
FT                   IAMVFTGVRHFRH"
FT   gene            complement(218922..220676)
FT                   /locus_tag="Nham_0196"
FT   CDS_pept        complement(218922..220676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0196"
FT                   /product="Heparinase II/III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61097"
FT                   /db_xref="GOA:Q1QRQ0"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRQ0"
FT                   /protein_id="ABE61097.1"
FT                   /translation="MSVAYRRRISTLLLRRFARRTIARAGDGPAALSRLWPGRADRLTI
FT                   APHDLRTADGTRAAEIYAGRFVFAGKIVTCHSRSIFDLEPPSEDWEAALLGFGWLRHLR
FT                   AADTAITRANARSLVDDWMSNPARRRPLGRRADVMARRVISLLSQAPLVLSDTDGKFYR
FT                   RYLRALARDIRLLRFGLHDAPDGVARLQVLIALCYASLCLANQARTIRTATRKLSDELR
FT                   RQILPDGGHVSRNPGALIELLIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHG
FT                   DGSFALFNGMSGAPSDLLATLLAYDDTRGIPMASMPHTGFQRLDAGTTTLIVDTGPPPP
FT                   SNLSEEAHAGCLSFELSSGPNRIVTNCGTPSTGRDNWRTFARSTPAHSTLSCHETSSCQ
FT                   FVERSAMKRLLQGAPIVSGPANVESSRETVDEAERLTASHDGYLARFGVIHRRVLTITR
FT                   DGSRLEGEDTLAPAPSGRMKGSRIDYALRFHLHPSVKASRLSDARGVMLVLPNREVWTF
FT                   EAPDDRVDLEDSVFLAGNDGPRRTTQIVIHQSAREAPTVRWSLVRSTASVTATNARRNA
FT                   RREPELPL"
FT   gene            complement(220814..222166)
FT                   /locus_tag="Nham_0197"
FT   CDS_pept        complement(220814..222166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0197"
FT                   /product="Fmu (Sun)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61098"
FT                   /db_xref="GOA:Q1QRP9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP9"
FT                   /protein_id="ABE61098.1"
FT                   /translation="MPSTRFAPPVEVPGLAARRIAADILDGVLHKHRTLDEQLEGAAAH
FT                   PGLKALADRDRALMRRLVATILRRLGTLGHVLSRLLDRGIPTDAPRAQSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQSDRRAAKYAGLVNAVLRRCAREGQPLIDEVRSEALDIPPWL
FT                   MTRWIANYGENTAKAIATAISHEPSLDLTVKAGAAQWATRLHGEVLPTGTVRTALQGPV
FT                   TMLPGFSEGRWWVQDAAAALPARLFGDLQGRRVADLCAAPGGKTAQLAQAGAEVTAIDR
FT                   SPNRVARLRDNLGRLSLGARALVADAVEWQDDAAGSGFDGVLVDAPCSSTGTIRRHPDV
FT                   AWLKQDSDIAALTALQKRLLQKAFALLKPGGTLVYCTCSLEPEEGEHLVGALLASEAGV
FT                   RRVPIGAAEVAGLEDIVTPAGDLRTLPCHLPHDDPRLSGLDGFYAARLIKS"
FT   gene            222371..222589
FT                   /locus_tag="Nham_0198"
FT   CDS_pept        222371..222589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0198"
FT                   /product="protein of unknown function DUF1674"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61099"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP8"
FT                   /protein_id="ABE61099.1"
FT                   /translation="MADESSALPRTGPAPARKALTPAARRALAEAEARRAAAQTAASAG
FT                   PKEIQGPKGPEPTRFGDWERNGIASDF"
FT   gene            222663..223249
FT                   /pseudo
FT                   /locus_tag="Nham_0199"
FT   gene            complement(223410..223928)
FT                   /locus_tag="Nham_0200"
FT   CDS_pept        complement(223410..223928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0200"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61100"
FT                   /db_xref="GOA:Q1QRP7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP7"
FT                   /protein_id="ABE61100.1"
FT                   /translation="MLTRAAVALAATIGASLLGTASAEARPDEVSYRSDYAPGTILVKT
FT                   KERRLYLIVDSDRAIRYPVGVGKAGKQWAGTAHIEGKYRDPAWAPPAEVKRDNPRIPDV
FT                   IAGGSPSNPMGVAAMTLSGGGQYAIHGTNRPQTVGHFVSYGCIRMYNNDIDDLYRRVSI
FT                   GTPVVVMQR"
FT   sig_peptide     complement(223857..223928)
FT                   /locus_tag="Nham_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.664 at
FT                   residue 24"
FT   gene            complement(224147..225778)
FT                   /locus_tag="Nham_0201"
FT   CDS_pept        complement(224147..225778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0201"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61101"
FT                   /db_xref="GOA:Q1QRP6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP6"
FT                   /protein_id="ABE61101.1"
FT                   /translation="MSDVMSASDLRALAEQSNAWPFEQARQIVARLKKTPKDEVLFETG
FT                   YGPSGLPHIGTFGEVARTTMVRHAFRVLTEDRIKTRLLAFSDDMDGLRKVPDNVPNKEL
FT                   LAQDLGKPLTKVRDPFGTHPSFGEHNNARLRAFLDTFGFDYEFASSTAYYTSGRFDATL
FT                   LKMLENIDKVMAIMLPSLREERAASYSPFLPICPRTGVVLQVPVVAHDAKAGTISYDDP
FT                   ETGEQVTVPVTGGHCKLQWKPDWAMRWTALCVDYEMAGKDLIDSVKLSGKICSALGGTP
FT                   PEGFNYELFLDDKGQKISKSKGNGITIDEWLRYASPESLSLFMYREPKAAKRLHFDVIP
FT                   RNVDDYQQFLDGYPRQDARQQLANPVWHIHAGRPPAADMPVTFQLLLTLVSSSNAENTE
FT                   TLWGFIGRYRPGVTPQTHPKLDALVGYAINYYRDFVAPTKQFREPTESESAALQDLRDA
FT                   LSQLPADVSAEDIQNAVYEIGRREPFLNHKKLAKDGRPGVSLDWFNMLYQVLLGQEKGP
FT                   RFGSFVAVYGVQNAIAMIDGALARAG"
FT   gene            complement(225903..226823)
FT                   /locus_tag="Nham_0202"
FT   CDS_pept        complement(225903..226823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0202"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61102"
FT                   /db_xref="GOA:Q1QRP5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP5"
FT                   /protein_id="ABE61102.1"
FT                   /translation="MQPQITVSANERLIRRLATMLGCMLVAGWMLVLGAAVDDARAQAA
FT                   AKTATVAPQAVPGFWDPRRRPDRPDLSRITVIRFLTETDYPPFNFTGPDGNPAGFNVDL
FT                   ARALCEEIKITCTIQMRRFETLVDALTSNRGDAIIASLAVTPELRKRVDFTDPYYRTPA
FT                   RFVSRRDAVMAEVRPEYLEGKKVGVIAGSAHEAYLKVFFTDAELHTYPNDEALRQALRR
FT                   GEVDFIFGDAISLAFWINGTDSEGCCAFSGGPFVESRYFGEGVGIAVKKGNDVLRQALN
FT                   WALFRVWEKGRYTDLWLRYFSVSPF"
FT   sig_peptide     complement(226716..226823)
FT                   /locus_tag="Nham_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.676 at
FT                   residue 36"
FT   gene            226878..228275
FT                   /locus_tag="Nham_0203"
FT   CDS_pept        226878..228275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0203"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61103"
FT                   /db_xref="GOA:Q1QRP4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP4"
FT                   /protein_id="ABE61103.1"
FT                   /translation="MSFVAWGRDLAGRDQVEDGRWIAAPRRDRPVEAPLPVCPAGVSHI
FT                   LQSSNDNWLCDPEPGPASELDCLRHVLAPALLRAAEARGREVGIGADQALIRSGVINED
FT                   AYLQTLSSHTGLAIETCAEESRADCPLPDRHLPGAAEHGLLPLRRDGKLIWAVAPRGFA
FT                   ARRLCRLTAAYPSLCDRVRLTSTRDLNQFLLRQTGDVLGQSAANALGRRFPALSAAPVA
FT                   DGAPGGLRTMRRPAQTGALAVMMVLTPTFALDILSDALAIWFLAFISLRLAASLRPPRP
FT                   AVRLPRVPDGRLPTYTVIAALYREAASVAPLMQAIGALDYPREKLDVIIVIELDDLETR
FT                   AALARLGPMPQVQVLLASAEGPRTKPKALNCALPFARGSFTAVFDAEDRPDPGQLRAAL
FT                   DAFRIQGTDVACAQASLCIENQSDSWLSRMFAAEYAGQFDVFLPGLASFGVPLPLGGSS
FT                   NHFRGIR"
FT   gene            228332..228793
FT                   /locus_tag="Nham_0204"
FT   CDS_pept        228332..228793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QKP9"
FT                   /protein_id="ABE61104.1"
FT                   /translation="MSDSIRLARTDTYEHTISGLLKKRADLFNEAERIRDRMAEIKNDI
FT                   SALDRVLGTLGYTGDLDAEMPRQKRQVLFGRGELTRAILDELRDAPRPLGSREIAQGIV
FT                   ALSGQDARDRKYVTDLTRRVSKALRMLKESGSVRSLGDCKGNLRWTLQS"
FT   gene            229256..229846
FT                   /locus_tag="Nham_0205"
FT   CDS_pept        229256..229846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61105"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP2"
FT                   /protein_id="ABE61105.1"
FT                   /translation="MPVVNVAADDIIARAKYFRQMLDNELASPALRGAELFYHNSMPDI
FT                   LAHCYFAISEAYKKIYLVNGHRTDSSKRAALTCATIVAIAPIRQNPDSNSEEKAIEAAY
FT                   ANPMLAMSCSCSIVNHPFHKRPFDDRHRVYRAFFDFSLPSIEPILAEARANRGAIISDW
FT                   EIPLTSPEETLLNLLVDDFVMYSKFTIAEQEGR"
FT   gene            complement(229843..230832)
FT                   /locus_tag="Nham_0206"
FT   CDS_pept        complement(229843..230832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0206"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61106"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP1"
FT                   /protein_id="ABE61106.1"
FT                   /translation="MRSTENVGLMSQHFLLSAKARTLSLAKVARLSDDEAYETFRLIRW
FT                   AATDGTPVCPRCDCAGVYTYTTRRLFKCKACSHQFSVTSGTIFASRKLPVRDYLLAIAI
FT                   FVNGAKGHSALQLSRDLDCQYKTVFVMAHKIREALAAEASSATASGEVEVDGAYFGGYV
FT                   KPANHKGNRRDRRRIINQNGKRRVVVIMRERGGRTLPFVFRSEDASLVKIARTVAPGSV
FT                   IHADEATHWDALHARFLTKRINHSESYSDGDACTNQAESFFSRMRRAEIGIHHRIAGDY
FT                   LSAYAGEMAWRENNRRVSNGEQYLMVADAALHHPVSRQWKGYWQRKGA"
FT   gene            230911..231138
FT                   /locus_tag="Nham_0207"
FT   CDS_pept        230911..231138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0207"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61107"
FT                   /db_xref="GOA:Q1QRP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRP0"
FT                   /protein_id="ABE61107.1"
FT                   /translation="MTPEQCRAARAWLNWPQDALAKAANVGVSTVRDFEAGRREPTRNN
FT                   LTAMKAALETGGISFVDDEKERGIKAPRST"
FT   gene            complement(231400..231999)
FT                   /locus_tag="Nham_0208"
FT   CDS_pept        complement(231400..231999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61108"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QKQ0"
FT                   /protein_id="ABE61108.1"
FT                   /translation="MEKCIEISVAGEPDSPYTGEVLKPEADSMSKTVDQVISELAAEIT
FT                   AEEASLRKKKETVNTLCGAIGRPPAYSLESAATALPTQIRSDQFYGQPLAASVRTILEM
FT                   RRAQNLGAAANREIYDSLVAGGYEFDTKSEDIAQKSLRNSLAKNTALFHKLPNGQFGLL
FT                   AWYPNVKKPKASAAVRGEDEIEEPPTNDNTGESILD"
FT   gene            232194..232853
FT                   /locus_tag="Nham_0209"
FT   CDS_pept        232194..232853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0209"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61109"
FT                   /db_xref="GOA:Q1QRN8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN8"
FT                   /protein_id="ABE61109.1"
FT                   /translation="MGGWDAYNVTEDADLGFRLARFGYRSTTFVSTTFEEAPARFGGWL
FT                   RQRSRWMKGWMQTWSVHMRRPWRLWSDAGAKGFFTLNAVVGGNVLTALCFPILAVDIAV
FT                   GLLARSGGATEGLAASPITPLHLTTIVAGFVSTIVVGLMGLARRGQLRQGWILALTPVY
FT                   WACLSIAAWRALYQLLNEPYRWEKTEHGLSPQIRSNATAQTPTIRAMATQRRRRYR"
FT   gene            complement(232844..233437)
FT                   /locus_tag="Nham_0210"
FT   CDS_pept        complement(232844..233437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0210"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61110"
FT                   /db_xref="GOA:Q1QRN7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN7"
FT                   /protein_id="ABE61110.1"
FT                   /translation="MTNKVTRPLIVFAAFAGSLVVGLTVVLWLLGGLTSKPAVASIGGP
FT                   FQLTDQTGQTVTEKSLVGRPTIVFFGYTHCPDVCPTSLFEMSEVLRAMGKDADRVNAYF
FT                   VTVDPERDTQATMKEYLSSFDPHLKGLTGDTAAVTKMASEYRVFIKKIPLQDGGYSMDH
FT                   TALIYLMDRDGRFVSPFDLKRTPEAAAADLKRYL"
FT   sig_peptide     complement(233315..233437)
FT                   /locus_tag="Nham_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.709 at
FT                   residue 41"
FT   gene            complement(233504..233677)
FT                   /locus_tag="Nham_0211"
FT   CDS_pept        complement(233504..233677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61111"
FT                   /db_xref="GOA:Q1QRN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN6"
FT                   /protein_id="ABE61111.1"
FT                   /translation="MQRPAQLATSQSGIAFVIVAGSAAAGAVLLLGTLALWAHYGTAVF
FT                   FEMLASGIAACF"
FT   sig_peptide     complement(233561..233677)
FT                   /locus_tag="Nham_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.474 at
FT                   residue 39"
FT   gene            complement(233839..234294)
FT                   /locus_tag="Nham_0212"
FT   CDS_pept        complement(233839..234294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61112"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN5"
FT                   /protein_id="ABE61112.1"
FT                   /translation="MRVVTGLLAALLVLGHVAASHAVVRIGEDRGGRIGTYVDKYQNLR
FT                   DTGQSVIIDGLCASACTIVLGAVPHDRICVTSHAALGFHAAWDVGSDGRAVTNSEATHM
FT                   LYLMYPSAIRRWIKQRGGLTRRMIFLRGRQLTDLYRPCYLNARASAH"
FT   sig_peptide     complement(234226..234294)
FT                   /locus_tag="Nham_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.931 at
FT                   residue 23"
FT   gene            234563..235255
FT                   /locus_tag="Nham_0213"
FT   CDS_pept        234563..235255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0213"
FT                   /product="sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61113"
FT                   /db_xref="GOA:Q1QRN4"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN4"
FT                   /protein_id="ABE61113.1"
FT                   /translation="MQQVQSRLAAGPCDDDDELIRRARARDESAIRAIMQANNRKLYRI
FT                   ARGILRNDGEAEDVVQETYVRAFTHLESFRGESRLATWLARIAMNEALGRLRRQHPSVD
FT                   WTTLEPVASDARIIQFPVSAISEDPEKTMAQREIQHIVEHAVDELPEAFRIVFITRVIE
FT                   GMNVEETAEILDLKPETVKTRLHRARTMLRANVEKKIGPVVMEAFPFAGKRCARLTDAV
FT                   LGRLGLTK"
FT   gene            235351..235875
FT                   /locus_tag="Nham_0214"
FT   CDS_pept        235351..235875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61114"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN3"
FT                   /protein_id="ABE61114.1"
FT                   /translation="MFVRLSAAIAAVVLLTSGAFAQGAKLTDPQIAHIAYTAGVIDITA
FT                   AKQALKKSENKEVKAFAADMVRDHEAVNEKALALVKKLKVTPEDNDTSRTLSKNAAATL
FT                   EKLSKLSGAAFDKAYVDNEVAFHKAVDNALETQLIPSASNAELKSLLETGLKIFQGHEQ
FT                   HAEHVAAELKK"
FT   sig_peptide     235351..235416
FT                   /locus_tag="Nham_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.962 at
FT                   residue 22"
FT   gene            235886..236227
FT                   /locus_tag="Nham_0215"
FT   CDS_pept        235886..236227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0215"
FT                   /product="putative amicyanin precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61115"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN2"
FT                   /protein_id="ABE61115.1"
FT                   /translation="MKPGGHFLIVAASGIAILGIAVSGISVPARAATIQILMQDLEITP
FT                   AETTAKVGDTIEWVNEDIFVHSATARNGDWDVELPAQKTGTLVLKKPGVVDYYCRYHPN
FT                   MKARLTIAP"
FT   sig_peptide     235886..235981
FT                   /locus_tag="Nham_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(236253..236825)
FT                   /locus_tag="Nham_0216"
FT   CDS_pept        complement(236253..236825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61116"
FT                   /db_xref="GOA:Q1QRN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRN1"
FT                   /protein_id="ABE61116.1"
FT                   /translation="MTGMAAPHDSSRNGLLKTGAAGVGTGIVTPLIQPLIDQINGSPGD
FT                   LRIALLAVPFALLVLVLILIDSDNPRWAALAGAVVTVIAFVCAVNAAIWIDGQISGSEN
FT                   AVRNVLSGLAGGFVGSGILALGVSLLPAGPLDPLAWLPMLVIGTSAGALLALDNALNLD
FT                   LLSMLYPVWQAGVAICLAMALRRTQPA"
FT   gene            complement(236858..236931)
FT                   /locus_tag="Nham_R0004"
FT                   /note="tRNA-Gly2"
FT   tRNA            complement(236858..236931)
FT                   /locus_tag="Nham_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(237035..237439)
FT                   /locus_tag="Nham_0217"
FT   CDS_pept        complement(237035..237439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0217"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61117"
FT                   /db_xref="GOA:Q1QRN0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRN0"
FT                   /protein_id="ABE61117.1"
FT                   /translation="MAAGETKTLKWTFILAVAAGGSLGSVARYLVGIGFGRLLGPKFPW
FT                   GTLFINITGSLLIGLFAGLFAIRWNLPQAVRIFLIVGICGGYTTFSTFSLDSFYLIERG
FT                   EVAAAGAYMIASVVLSVGALIAGIQIVRVL"
FT   gene            complement(238066..239172)
FT                   /locus_tag="Nham_0218"
FT   CDS_pept        complement(238066..239172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0218"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61118"
FT                   /db_xref="GOA:Q1QRM9"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM9"
FT                   /protein_id="ABE61118.1"
FT                   /translation="MPFTLPPDANGILPDRMIAAMADAGLILPEYPFVESQIQPASLDL
FT                   RLGAMAYRVRASFLPGPGATVAERIDELKLHEIDLSDGAVLETNCVYIVPLLESLALPP
FT                   EIVAAANPKSSTGRLDVFTRVIADGTRRFDMIGAGYHGPLYAEISPKTFPVLLREGSRL
FT                   SQVRFRSGDAILDADELDALHARERLVDSDDTEFANGVALSVDLSGENADGFVGYRAKR
FT                   HTGVIDIDRRGRYAVGEFWEPIAARPDGSLILDPGEFYILASKEAVQVPPDYAAEMVPF
FT                   DPLVGEFRVHYAGFFDPGFGYAGAGGQGSRAVLEVRSREVPFILEHGQIVGRLVYEKML
FT                   ARPDAIYGQRIGSSYQAQGLKLSKHFRV"
FT   gene            239411..240679
FT                   /locus_tag="Nham_0219"
FT   CDS_pept        239411..240679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0219"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61119"
FT                   /db_xref="GOA:Q1QRM8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM8"
FT                   /protein_id="ABE61119.1"
FT                   /translation="MIPACGFFQAGFFVTVFQGGRAGGHMSQSSPTAQYRTETRLVHSG
FT                   TMRSQFAETSEALFLTQGYIYDTAEQCEARFKGEDPGFIYSRYSNPTVAMFEQRMAELE
FT                   GAEAARATATGMAAVTTAMLAPLRAGDHVVAAKALFGSCRYVVEDLLPRYGIESTLVDG
FT                   LDLEQWRKAMRPNTKSCFIESPTNPTLDVLDIGGIAEIAHQAGARLIVDNVFATPIWQS
FT                   PLALGADIVVYSATKHIDGQGRTLGGVILCSNAFVQEHLQTFIRQTGPSISPFNAWVLL
FT                   KGLETLGVRVRQQTESAAAIADALASHPKVSRLIYPGRPDHPQAALVKKQMRAGSTLIG
FT                   FEVKGGKAGAFRCLNALKLARISNNLGDAKSLVTHPATTTHQRLAPEVRVGLGIGEGFI
FT                   RYSAGLEHKDDLIEDLVAALETV"
FT   gene            complement(240783..241766)
FT                   /locus_tag="Nham_0220"
FT   CDS_pept        complement(240783..241766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0220"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61120"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM7"
FT                   /protein_id="ABE61120.1"
FT                   /translation="MTIHSRFSTTAVLAALAIMVMGTSTSTVVAQTAPANATARPTGSA
FT                   GLSAPASSGVAAARSGTPTQNLSGKATDKVKAVADRPRDIFNRVPCLPPKGVSQSMGSL
FT                   PHVAAKLAANKPVVIVAFGSSSTQGYGATSPEFTYPNRLAARLHRKYPAAAITVINRGR
FT                   GGEDAPEMMKRLRSEVIDAKPDMVIWQVGTNAVLRNLDPASTAKTVEAGVATIQASGAD
FT                   LVLVDPQYAPAVNARGENAGRMVSLLSRVAHHRHVGIFPRFEVMRDWHDRQSLPFDTFV
FT                   TKDGLHMNDWGYACFAQLLGDDIIQSVDQVQAGVSPPQAATAFRPL"
FT   sig_peptide     complement(241674..241766)
FT                   /locus_tag="Nham_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 31"
FT   gene            complement(241766..242527)
FT                   /locus_tag="Nham_0221"
FT   CDS_pept        complement(241766..242527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61121"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM6"
FT                   /protein_id="ABE61121.1"
FT                   /translation="MRAGWTSVLLLLAGLTASAFARADDPPRSCDVPAYLLTSDRPLTR
FT                   VASAVKAGGPLDILVVGSRSSTIPGAEGDAYPARLQAALREKLPGITVNVSVELEPRKT
FT                   AEDIAPGLGKLALAKKPTLVVWQTGTVDAIRSVDDDTFHDAIDHGVTALQNAGTDVVLM
FT                   NMQYSPRTETMVSPTSYIDNMRVVAQQHDVPLFDRFAIMNHWNESGEFDLFSPVRGADL
FT                   AKRVHNCLGRALSTFVIDTAHINPAELGTRR"
FT   sig_peptide     complement(242456..242527)
FT                   /locus_tag="Nham_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.962 at
FT                   residue 24"
FT   gene            complement(242524..243759)
FT                   /locus_tag="Nham_0222"
FT   CDS_pept        complement(242524..243759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0222"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61122"
FT                   /db_xref="GOA:Q1QRM5"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM5"
FT                   /protein_id="ABE61122.1"
FT                   /translation="MSVANQVVGARASAAADGASNDVSIPAPPIERELRLDLFRGLALW
FT                   LIFIDHLPQHLLTWLTIRNYGFSDATEIFIFISGYTAALVYGRVMRERGFVVAAARILK
FT                   RVWQIYVAHIFLFTIFLAEISYVASSFENPLYTEEMGILDFLKHPDITIVQALLLKFRP
FT                   VNMDVLPLYVALMLFFPPMLALMQRRADLGLALSAGLYALTWQFDLALPAYPNGVWFFN
FT                   PFAWQLLFVFGAWCALGGAKRMSRILSSPVTLWICAAYLLFAFYTTLTWHVPQLNHLMP
FT                   GIVEQWMYPIDKTNLDVLRFAHFLALAALTVHFLPRDWPGLTSPWLRPLVLCGQHSLEI
FT                   FCIGVFLAFAGQFILAEASGGAGLHFVISLCGILIMSGAAWVFSWYKKVAGKGGSRAKS
FT                   ADGDADLAGGGA"
FT   gene            243972..244490
FT                   /locus_tag="Nham_0223"
FT   CDS_pept        243972..244490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0223"
FT                   /product="ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61123"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM4"
FT                   /protein_id="ABE61123.1"
FT                   /translation="MRVKAGLKPLCFDAFSLCEPVPILGSRPRPCFARKRYRESPMYRA
FT                   VTRQIEVTVEPNFMPERSSAERGHFFWAYTVVITNAGPDTVQLRTRHWIITDASGRKQE
FT                   VRGEGVVGEQPVLAPGERFEYTSGVPLPTATGFMSGRYQMISIRSGEPFEIDVPTFSLD
FT                   SPDSKRVLN"
FT   gene            complement(244525..245532)
FT                   /locus_tag="Nham_0224"
FT   CDS_pept        complement(244525..245532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0224"
FT                   /product="Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61124"
FT                   /db_xref="GOA:Q1QRM3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM3"
FT                   /protein_id="ABE61124.1"
FT                   /translation="MTSQMSDPAISLETPVRAPSSVPVDDAVIPFEVSALDLRGRLTRL
FT                   GPALDELLVRHDYPAPVAKLLGEAVVLTTLLGSSLKFDGRFILQTQTDGPVSFLIVDFR
FT                   APARLRAYARFDQARLGDALDSGALLGRGHLAMTIDQGPDMSRYQGLVALEGGSLEDAA
FT                   HEYFLRSEQIPTRVRLAVGEEWRRDGNGPKRGWRGGGMLLQFLPKAPERARQADLDPGD
FT                   APPDGSAAHTVAEDDAWVEGQSLIGTVEDIELIDPDLSGERLLYRLFHERGVRVFPPQA
FT                   LQAQCSCSRDAVEAMLKSFAPQDRSGMVKDGKVAVTCEFCSSVYEFTPQQAGAE"
FT   gene            complement(245648..246157)
FT                   /locus_tag="Nham_0225"
FT   CDS_pept        complement(245648..246157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0225"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61125"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM2"
FT                   /protein_id="ABE61125.1"
FT                   /translation="MDAAELRATQAPIKKRYKTDPKSALITLKARGSIENEGIACKIDT
FT                   GRALTVAGLHPATGGSGLELCSGDMLLEALVACAGVTLKSVATAIDVPLKSGHVTAEGD
FT                   LDFRGTLGVDKETPVGFESIRLRFDVATDAPQDKLDLLLKLTERYCVVYQTIRNGPKVS
FT                   VEMKRV"
FT   gene            246434..249229
FT                   /locus_tag="Nham_0226"
FT   CDS_pept        246434..249229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0226"
FT                   /product="UTP-GlnB (protein PII) uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61126"
FT                   /db_xref="GOA:Q1QRM1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRM1"
FT                   /protein_id="ABE61126.1"
FT                   /translation="MDLATTNDAAGAGNDFDTARITGDIDALAAKHAGHEDVFRAAVSR
FT                   LLKAELAKVRDAAQAKLLRDRHGRRCAERLCFIQDEIIRLSFSAATRHLYHSPIPSDGE
FT                   RMAVVATGGYGRGLMAPESDIDLLFILPYKQTAWGEQVAEAILYCLWDMGLNVGHATRS
FT                   VNESIRQARRDMTVRTGILETRFLAGDRALYDELVTRFDTEVVQGTAAEFVTAKLAERE
FT                   ERHRRAGQSRYLVEPNVKDGKGGLRDLHTLFWIAKYVYRVHESRELLGCGVFDVREYRT
FT                   FRRCADFLWSVRCNLHFATGRAEERLSFDLQREIAVRLGYTSHPGMQDVERFMKHYFLT
FT                   AKDVGDLTAILCAKLEDQQAKPAPVLGRMMSRRRPGTELRRVPEGDDFIIDNNRINLAA
FT                   PDVFKRDPVNLIRVFRLAQKNNLAFHPDALRTVTRSRRLINAQLRENPEANRLFMEILT
FT                   SNDAETVLRRMNETGVLGHFIRAFGKIVSMMQFNMYHHYTVDEHLLRCIGILQDIERGG
FT                   NDELALASELMRKIHPEHRPVIYITTLLHDIAKGRPEDHSIAGARVARRLCPRLGFNAS
FT                   DTELIAWLIEQHLTMSKVAQSRDLSDRKTIENFAAVVQSVEQMKLLTILTTADIRGVGP
FT                   GVWNGWKAQLLRTLYYETEPVLTGGFSEVNRVQRIAEAQAEFRAAFTEWSEPELNAYIA
FT                   RHYPAYWLKVDLAHKIRHARFLRASEQGGRKLNINVGFDEARGVTELTIFAADHPWLLS
FT                   IIAGACASAGANIVDAQIYTTTDGQALDTIAISREYDRDEDEGRRAARIGEIIEQVIDG
FT                   RLRLPDVVARRAAGKTRLRPFVVEPKVIVNNQWSDRHTVIEVSGLDRPGLLFQLTAAIS
FT                   KLNLNIASAHVATFGERARDVFYVTDLLGARITAPTRQAAIKRALIHLLANGGAAEQSV
FT                   G"
FT   gene            249672..251870
FT                   /locus_tag="Nham_0227"
FT   CDS_pept        249672..251870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0227"
FT                   /product="Penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61127"
FT                   /db_xref="GOA:Q1QRM0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRM0"
FT                   /protein_id="ABE61127.1"
FT                   /translation="MVWGRKKKRGGRKEPVFGGVAASLAELRLNPLDRITVADDKPASR
FT                   AAPRKAAGPGGDGSRERKPSQNRKGRKGRARKRTRGRLSRLFYWGAVLALWGGIAIVGV
FT                   VVYVGAHLPPIQSLEIPKRPPTIKIVGADGSVLATRGEMAGSNVSLKDLPPYLPKAFIA
FT                   IEDRRFYSHYGVDPIGILRAAVTNVLHMGVSQGGSTLTQQLAKNLFLTQERTLERKLQE
FT                   VELALWLERKHTKAQILELYLNRVYFGSGAYGVEAAAQKYFGKPAKDVTLAEAAMLAGL
FT                   VKSPSRLAPNRNPEGAEARAKVVLAAMADAHFITEQQARAATTRPSYAVKPVGAGTINY
FT                   VADWVGEVLDDLVGQVDQNIVVETTIDPKLQSVAEAALIDELAAKSVKFNVSQGALVAM
FT                   TPDGAIRAMVGGRNYGDSQFNRAVMAKRQPGSAFKPFVYLTAIEAGLTPETIRQDAPLD
FT                   IKGWRPENYGHEYFGAVTLTQALAMSLNTVAVRLGLEVGPVNVVRTAHRLGITSKLEPN
FT                   ASIALGTSEVSPLELVGAYAPFANGGYAANPHIVDRIRTVDGNKLLYARAQAAPGRVID
FT                   PRSVAMMNTMMEQTLISGTARKAGIPGWTAAGKTGTSQDFRDAWFVGYTAKLVTGVWLG
FT                   NDDNSPTRKATGGGLPVEVWTRFMRTAHEGMQPEPIPGTQRGGPLPDIAQLGRQVIAPA
FT                   PAAPASVGGPPQPVRANVRPEAASGLDGWLVDRLFGGR"
FT   gene            complement(252028..252864)
FT                   /locus_tag="Nham_0228"
FT   CDS_pept        complement(252028..252864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0228"
FT                   /product="protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61128"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL9"
FT                   /protein_id="ABE61128.1"
FT                   /translation="MICFCAERFDWRRIWQNPGDTPASGFTDMARALLYRRPAEPSRLL
FT                   VKHGSQIYSVRLRRHRRARRYTLRIHPSDREAILTMPPRGTLVEAKDFAQRHGGWIAAR
FT                   LGRLPKAAPFHHGAVIPLRGVAHRIVHRTGERGTVWTETRDSGERILCVAGGLDYLDRR
FT                   VHDFLKREARHDLQKATQRYADTLGVKVKRLSIRDQSSRWGSCTSSGSLSFSWRLILAP
FT                   PFVLDYLAAHEVAHLVEMNHSPRFWKVVARICNHVERAKKWLDAEGNDLHRYGIQD"
FT   gene            complement(253067..254401)
FT                   /locus_tag="Nham_0229"
FT   CDS_pept        complement(253067..254401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0229"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61129"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL8"
FT                   /protein_id="ABE61129.1"
FT                   /translation="MPIGEFGRPPDMPAEVSPAMTAPMYWMYEMAQASLNPARAVTDAT
FT                   RMLFQNPLNPWSHTEFGKSVAAGCELFERTTRRYGKPEWGLHETEVNGVRTPMEIRSVW
FT                   EKPFCRLLYFDRMHVRPLRKPQPRVLLVAPMSGHYATLLRGTVEAFMPTHDVYITDWTD
FT                   ARMVPVSEGRFDLDDYVDYLIEMLHVLGGNVHIIAVCQPSVPVLAAVSVMEAEGDPCVP
FT                   LSMTLMGGPIDTRKNPTAVNNLAAAKGTDWFRNNVITKVPFPHPGVMRDVYPGFLQLNG
FT                   FITMNLDRHMEAHKSLFKNLVKGDGDLVDKHRDFYDEYLAVMDLTAEYYLQTVDLVFVK
FT                   HALPNGEMTHRGRPVDPSKITRVALMTVEGEKDDISGLGQTEAAHALCTSIPERRRAHY
FT                   MQKGVGHYGVFNGSRFKSEIVPRINDFMQSNARHPAQLSRAAAAE"
FT   gene            254849..256243
FT                   /locus_tag="Nham_0230"
FT   CDS_pept        254849..256243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0230"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61130"
FT                   /db_xref="GOA:Q1QRL7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL7"
FT                   /protein_id="ABE61130.1"
FT                   /translation="MIPKIGSHFSGSCSKLWTMTDVDASDFRHPRRYVRLDTILRLRWL
FT                   AALGQLAAIFVVAQGLEFELPIIPCVTIVGLSSLLNLALQVIFNPMQRLEPRYAAGLLA
FT                   LNIAELAALLFFTGGLQNPFSYLFLAPVLISATALPTRMTMALGVFAVASATVLGFTHL
FT                   PLPWDANDPLILPRIYLAGVWLSIVLAIGVTSLYTFQVTEQARKLSDALAATELVLTRE
FT                   QHLTQIDGLAAAAAHELGTPLSTIFLISRELEKALQENGAPDPQRLAGDLGVVREQAQR
FT                   CRDILAKIAQLSSSGAPFDRMPLSTLIEETVAPHRDFGIDITIRIAVADDDEPVGMRNP
FT                   AILYGVGNILENAVDFARSAVEVNAWWNSETVEIVISDNGPGIAPDILKRIGEPYLSRR
FT                   RNVSDAQGGRAGLGLGIFIARTLLERTGATVSFANRTFPEHGAVVQIVWPRLRFETSKT
FT                   VAETMV"
FT   gene            256335..256889
FT                   /locus_tag="Nham_0231"
FT   CDS_pept        256335..256889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0231"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61131"
FT                   /db_xref="GOA:Q1QRL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL6"
FT                   /protein_id="ABE61131.1"
FT                   /translation="MNAAPDVIPQADRSLLIVEDDKPFLERLSRAMETRGFNVTSCDSV
FT                   SDGLAHIGKSAPAFAVVDLRLGDGNGLDVVSALKRERPDARAIVLTGYGNIATAVTAVK
FT                   MGAVDYLSKPADADDVVAALLASGTEKSELPQNPMSADRVRWEHIQRIYEMCNRNVSET
FT                   ARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(256918..257409)
FT                   /locus_tag="Nham_0232"
FT   CDS_pept        complement(256918..257409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0232"
FT                   /product="protein of unknown function DUF1052"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61132"
FT                   /db_xref="GOA:Q1QRL5"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL5"
FT                   /protein_id="ABE61132.1"
FT                   /translation="MESNAVHIALVPPPDRRQSETALAIARGTGRFLRSLGFCCVSELP
FT                   LPSGRRADLVALNARGDIWIVEIKSSAEDLRADRKWQDYRAHCDRLFFAFTRDLPCGIF
FT                   PTDTGLIVADAYGAYLHCEAPEHRLPAPTRKAMMLRFAMAAAQRLNRLADPQGHAEGEF
FT                   "
FT   gene            257533..258225
FT                   /locus_tag="Nham_0233"
FT   CDS_pept        257533..258225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0233"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61133"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL4"
FT                   /protein_id="ABE61133.1"
FT                   /translation="MAQENQQENQPDDQSAAKAGVTIIPVTPFRQNCTLLWCETTRDAV
FT                   VIDPGGDVPLIRTSIEQSGVTVRRIWLTHGHIDHVGGAAELRDALKVPIEGPHIADKFL
FT                   LDHVVESGRGYGMTGMRNFTPDRWLEEGEKVKIGELEFDVLHCPGHSPGSVVFFNREMR
FT                   FAHVGDVLFNGSVGRTDLPGGSHATLIKSITDKLLPLGDDVAFICGHGPGSSIGHERAS
FT                   NPFLTDGM"
FT   gene            complement(258295..258711)
FT                   /locus_tag="Nham_0234"
FT   CDS_pept        complement(258295..258711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61134"
FT                   /db_xref="GOA:Q1QRL3"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL3"
FT                   /protein_id="ABE61134.1"
FT                   /translation="MVRRVIGTAAIAVALVWPVSAMAQGVPGGMERGAREGERAGGPVG
FT                   AIVGGTVGAVVGGVAGVLGVEQRPRFHRYVVEQHRPSYHYREPVRVGAVLPESGVTYYE
FT                   VPAEYGAPQYRYTVVNDRTVLVDPRTHRIVDVIE"
FT   sig_peptide     complement(258640..258711)
FT                   /locus_tag="Nham_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(258873..261698)
FT                   /locus_tag="Nham_0235"
FT   CDS_pept        complement(258873..261698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0235"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61135"
FT                   /db_xref="GOA:Q1QRL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL2"
FT                   /protein_id="ABE61135.1"
FT                   /translation="MLEKESVGLEAFLAGGGEMADLTRRFDWAGTSVGAPEIWPQSLRT
FT                   AVRIILNTNHPMLIWWGPDLIQFYNDGFRQTLGPERHPGALGERGRDCWGEVWDIVGPQ
FT                   IEHVMAGRGATWHEDQLVPVTRHGRLEQVYWTYGFSPIDEDHGVGGVLVVCRDVTREHL
FT                   AKVALQERETELARVQAIGRIGGLEVDLHTGHRSRKSPEYLKIHGLPPEAVNESHEDWL
FT                   RRVHPDDRAVAEGQFIDAVRGGDREYAVRYRIIRPSDGETRWISARSVIERDADGKAIR
FT                   LFGAHTDITDQVEAVRAIRQREEEFRALAEALPHHVWTAKPDGELNWCNTRVYDYVGAK
FT                   PDELVGNDWNKVVHPDDASAAAAAWTHAVATGDPYEIEFRLRGADGSYHWFLARAVPAR
FT                   DEDGRITRWIGTNTDVHDQKLFAGKLAELNATLAERVEEKTRERDRIWNVSQDLLLVTD
FT                   HDGICRSVNPAWTRTLGWSEAVLLGRTAEWIEHPDDIIKTRVEVRRLARGKATVRFENR
FT                   LRHKDGSYRWLSWTAVPDQNLIYAVARDITAEKAATERLRAAEEALRQSQKMEAVGQLT
FT                   GGIAHDFNNLLTGIVGSLDLMQTRLNQGRTDRAGRYIEAAMASANRAAALTHRLLAFAR
FT                   RQPLVPKPVDANHLVLSLEDLLRRTIGEAIDLEIAPSGRLWQTLCDPNQLESALLNLAI
FT                   NARDAMPGGGKLAIATANMTVGAADAGSSAVRPGDYVCITVTDTGTGMTAEVAARAFDP
FT                   FFTTKPIGQGTGLGLSMIYGFARQSNGHIAFDTAPGRGTSIRLCLPRHDDVAEADQASP
FT                   ANKDRTAATGETVLVVEDEPVVRGVIIEMLHDQGYLTREAADGVAGLRILQLDKPVDLL
FT                   LTDIGLPGMNGRQLADQARELRPDLKILFMTGYAENAANAEGFLLPGMDMITKPFDLGH
FT                   LSQRVRDIISG"
FT   gene            complement(261958..262962)
FT                   /locus_tag="Nham_0236"
FT   CDS_pept        complement(261958..262962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0236"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61136"
FT                   /db_xref="GOA:Q1QRL1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRL1"
FT                   /protein_id="ABE61136.1"
FT                   /translation="MCSGFPPASRFSKYWNGSHGMFKRIAMLAIAMGLFGAIAAHADAT
FT                   IPSKDIANARDNALLKRYEGSFIMSYEKLAFTDFKVPLSKLEKAGNDRRDRMNNQVFKP
FT                   KEEIEIEGARTRIAYLLPAERSPLEVLRNYQDVVKAAGGEVLYACKGEECGGDPERSSD
FT                   GGGDGYVTVQAFQLKDDLYCKALNERTVALVHIVEPKPREQKMVVVKADEMARSIGATG
FT                   RIALYGIFFDTAKADLKPESNPTLAEIAGLLNADPKLAVLIVGHTDNQGAFDYNLDLSR
FT                   RRAEAVVKTLAANFRVEPRRLRAAGVGMMAPAASNDAEDGRAKNRRVEVVKLN"
FT   sig_peptide     complement(262834..262962)
FT                   /locus_tag="Nham_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.990 at
FT                   residue 43"
FT   gene            complement(263148..264071)
FT                   /locus_tag="Nham_0237"
FT   CDS_pept        complement(263148..264071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0237"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61137"
FT                   /db_xref="GOA:Q1QRL0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRL0"
FT                   /protein_id="ABE61137.1"
FT                   /translation="MSYFRTAILLAGLTGLFMGVGYLIGGAAGAMIALVVAAATNMFAY
FT                   WNSDRMVLSMYGAHEVDAGTAPDLHRLVAELAARAALPMPRVFLMDNPQPNAFATGRNP
FT                   ENAAVAVTTGLMQSLRREELAGVIAHELAHIKHHDTLLMTITATIAGAISMLAQFGMFF
FT                   GGGNRGNNGPGIIGSLAMMILAPLGAMLVQMAISRTREYAADEMGARICGQPMWLASAL
FT                   AKIDDAAHQVPNREAERAPATAHMFIINPLSGHGMDNLFATHPSTENRIAALQRLAGQS
FT                   GSATPDPAPAPRGPWNGGAPRRGPWG"
FT   sig_peptide     complement(263955..264071)
FT                   /locus_tag="Nham_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.587 at
FT                   residue 39"
FT   gene            complement(264185..264736)
FT                   /locus_tag="Nham_0238"
FT   CDS_pept        complement(264185..264736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0238"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61138"
FT                   /db_xref="GOA:Q1QRK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK9"
FT                   /protein_id="ABE61138.1"
FT                   /translation="MPDPVIRAANEADLPAITAIYDHAVRFGTATFELDPPDLTEMTRR
FT                   FGALRDGGFPYLVAELAGAVVGYAYAGPYRPRPAYRFTVENSIYLAPASHRRGVGIQLL
FT                   RRLIAECEARGYRQMIAVIGDSANAGSIGVHVRAGFKMIGTHPSVGLKFGRWLDTVMMQ
FT                   LALGDGSATIPTGEATRNPG"
FT   gene            complement(264818..266176)
FT                   /locus_tag="Nham_0239"
FT   CDS_pept        complement(264818..266176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0239"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61139"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK8"
FT                   /protein_id="ABE61139.1"
FT                   /translation="MKRILLGVLLAGTAMSAQAADLAPRPYTKAPVMAPVYDWTGFYLG
FT                   VNAGLGLGRDRTVNDFGDGTGNSTYLQPLGAIGGGQIGYNWQTNSFLGPLVLGVEADIQ
FT                   GADMTDNRTNINGVQYNQKLDWFGTARGRIGLVNGPTLTYLTGGYAYGNVSTRGVADGV
FT                   PFAFSGNRSGWTWGSGVEAALGGNWTGKIEYLYVDLGNRTDVFDGGAQALHSELRENIF
FT                   RAGLNYRIGGNSTYAPVATANWNGFYLGGNVGSGTGRDRTTVTNLATGESAAFNLAPDG
FT                   FIGGVQAGYNWQAGNIVYGLETDFQGSTMEDNKTCIGCEPGASLNFNAKLQWLGTVRGR
FT                   LGYAVGPSLFYATGGFAYGNVKTAINEVNFSDTRTGWTVGGGIETPFTLFGLFGPNWTS
FT                   TTEYLYVDLGKSTNGFTLANTTGEPGALQTGVQEHIFRTGLNYHFNTPVVARY"
FT   sig_peptide     complement(266117..266176)
FT                   /locus_tag="Nham_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            266479..269040
FT                   /locus_tag="Nham_0240"
FT   CDS_pept        266479..269040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0240"
FT                   /product="ATP dependent helicase, Lhr family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61140"
FT                   /db_xref="GOA:Q1QRK7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK7"
FT                   /protein_id="ABE61140.1"
FT                   /translation="MGIADREEEQPALPDDFLRWFAARRWSPRAHQLALLQKARAGRSA
FT                   LLIAPTGAGKTLAGFLPTLVELSCFPSPTGAEGSETRGLHTLYISPLKALAVDIARNLE
FT                   APIAEMTLPIKVETRTGDTPMLRRQRQRRYPPDILLTTPEQMALLLASDDAPFLFSSLQ
FT                   RVVLDELHALVTSKRGDLLSLALAQLWRLAPRMRTIGLSATVAEPESLARFLVPQPEGK
FT                   IVSADIVVAGGAAAPIVEMLDTRERLPWAGHSARHALGEIYDLIRRNRTTLVFVNTRSQ
FT                   AEMLFQDLWRVNDDGLAIALHHGSLDVAQRRKVEQAMTEGRLRGVVCTSSLDLGVDWGD
FT                   VDLVINIGAPKGASRLMQRIGRANHRLDEASRAVLVPANRFEVLECRVAIDAVNENAQD
FT                   TPPLRTGALDVLAQHVLGCACGAPFHADQLYDEVRTAAPYAALTRADFDDVIDFVATGG
FT                   YALKSYERFARIRQDKANSSESRWRVANPKVRQSYRLNVGTIVEEAMLKVKLVRSRHGG
FT                   QNRGKGSTGTIARGGRMLGEIEEYFIEGLVVGDTFVFGGEIVRYEVLVEDQVYVSRAND
FT                   DSPKVPSYMGGKFPLSTYLAERVRNLLDDKRAWSSLPDQVRQWLSLQSHFSRVPHAREM
FT                   VVETFPRAGKHYLVCYPFEGRLAHQTLGMLLTRRLERMRVRPLGFVANEYALAVWMLGD
FT                   TSSMIGQGRLNLDALFDPDMLGDDLEAWLAESALMKRTFRSCAIISGLIARRSTSDEKT
FT                   RRQVLFSTDLVYDVLRKHQPDHLLLRAARTDAAAGLLDIRRLSDMLARIRGRITHKPLD
FT                   RISPLAVPVMLEIGREAIYGEASDELLAEAAEELVREATGT"
FT   gene            269081..269776
FT                   /locus_tag="Nham_0241"
FT   CDS_pept        269081..269776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0241"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61141"
FT                   /db_xref="GOA:Q1QRK6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK6"
FT                   /protein_id="ABE61141.1"
FT                   /translation="MPGLVPAMTARIEIVSVAGVSFVADLSGALYWEHERLLVVSDLHL
FT                   EKGSSFAMRGVLLPPYDTVATLGRLAAVVARFDPRTVIALGDSFHDRDAHERLIAPDRD
FT                   ALSALQARCDWIWISGNHDPALPDDLGGAIASEVAIGAIVFRHEPTGAFGEIAGHLHPK
FT                   ARVSTRGRSIERRCFASDGARVVMPAFGAYAGGLSIRDEAFARLFSADFIAHVLGDRRM
FT                   HAIAAARCY"
FT   gene            complement(269777..270640)
FT                   /locus_tag="Nham_0242"
FT   CDS_pept        complement(269777..270640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0242"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61142"
FT                   /db_xref="GOA:Q1QRK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK5"
FT                   /protein_id="ABE61142.1"
FT                   /translation="MLDLELLRSFVSVVDAGGFTRAGERVHRTQSTVSQQIKRLEDDFG
FT                   RPLLNRVGKKVIPTEDGELLLAYARRLLALAEETRDVLARPKGDGVVRLGIPEDFAAYR
FT                   LTELLASFMRSRPGLRLDVRADQGKYLRRELERGELDLALLKRPAGEKGGISTWPERVH
FT                   WVTSKAHPVNPATHSVPLIGFPPGCLYRAGAIHAIESAGRAWHMAYTSSSLAGIQAAVA
FT                   AGLGLSILSEIAIQPGHRVLTAKDGFAPIDKTEVALVAAPEASPATLRVADLLADFCNS
FT                   VQKAAA"
FT   gene            270738..271676
FT                   /locus_tag="Nham_0243"
FT   CDS_pept        270738..271676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0243"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61143"
FT                   /db_xref="GOA:Q1QRK4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK4"
FT                   /protein_id="ABE61143.1"
FT                   /translation="MTVVPSSLASPAAAPRPAFNTLPLAIGAFCLLWSFAFVAGKVGVT
FT                   DCPPLILLAARFLLAGILIFGIAVLRGEGWSLSRRDVAIFAVLGVANNAMYLGLGYTGL
FT                   QTVSAGLSGLIVSANPVFTAVLAAVFLGESLTWRKVMGLLLGIAGVAFIVWHRMSVGTD
FT                   SLHGILFTLASLASIVAGTILFKVLAPKGNLWLGNGVQSLAGGLALLPFASALSDVSDI
FT                   VPSWRLLAAFVYLVLCGSILAYVLWFHLLKVCGATAASAYHFLMPPLAILFAWLVLGEH
FT                   VAARDLLGIVPVALGIYLVTRPAAGPAQHAS"
FT   gene            complement(271734..272531)
FT                   /locus_tag="Nham_0244"
FT   CDS_pept        complement(271734..272531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61144"
FT                   /db_xref="GOA:Q1QRK3"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK3"
FT                   /protein_id="ABE61144.1"
FT                   /translation="MRTRAACSTIGLMLVLLLGSTFVAGDARAEHLIVSVSNHRVTVTP
FT                   NYSGEELVLFGSIERDGGAPVPRAGYDLVVTISGPRVDMVTRRKERTLGIWVNADSRQF
FT                   LQVPSYLAVFANRPLDKIAAPDILRRQQLGLNNVLLTQRVGPDYADVVASDPFRRAFIR
FT                   LRAEHGLYRENTAAVTFLTPTLFRAGIPLPAEVPTGTYTIGIKLLAGGALIAKTDTAFE
FT                   IVKVGFEQFVATAARQHGLIYGLATALMALTAGWMASIVFRKD"
FT   sig_peptide     complement(272454..272531)
FT                   /locus_tag="Nham_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.589 at
FT                   residue 26"
FT   gene            complement(272528..273454)
FT                   /locus_tag="Nham_0245"
FT   CDS_pept        complement(272528..273454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0245"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61145"
FT                   /db_xref="GOA:Q1QRK2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRK2"
FT                   /protein_id="ABE61145.1"
FT                   /translation="MQLYLPIADLPVNVFLILAMGAAVGFVSGMFGIGGGFLMTPLLIF
FT                   VGIAPAVAVATVASHIAASSFSGALSYWRKRAIDPILALVLLSGAMAGTMLGVWTFTLL
FT                   RSLGQLDLLIALSYMVLLSGVGAAMFWEGLRAMLRTRQGQTVPLRRSGGHGWIHGLPLK
FT                   VRFKRSKIYLSVIPVVAIGLFIGFIGAIMGIGGGFILVPLLIYLLRVPTSTVIGTSMII
FT                   TLITMTLATVLHAATNHLVDVVLALILMTGGVSGAQFGARAGQRIRGEHLRLLLGLLIL
FT                   AVGIRFAVELGIRPADLYTVRETMGGP"
FT   gene            complement(273863..274588)
FT                   /locus_tag="Nham_0246"
FT   CDS_pept        complement(273863..274588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0246"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61146"
FT                   /db_xref="GOA:Q1QKF9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QKF9"
FT                   /protein_id="ABE61146.1"
FT                   /translation="MGQHQVKRLLSSEHFSVDGTLIEAWASIKSFRRKDGGDQDSDGPG
FT                   RNAERSFHNEKRCNETHQSTTDPEARLYKKGGGQPAKLCYIGHALMENRNGLAVLGGVS
FT                   RATGTAERDQALALIDCHRGQSERRITLGADKAYDVTAFVEDLRRRSVTPHIAIDGHLS
FT                   KTGKPRKTAIDQRTLRHAGYAVSQRCRKRIEEVFGWIKASAGLAKIKLRGRDRVNATFT
FT                   LALAAYNLIRLPKLLAAAA"
FT   gene            complement(274623..274973)
FT                   /locus_tag="Nham_0247"
FT   CDS_pept        complement(274623..274973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0247"
FT                   /product="ISGsu3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61147"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QKG0"
FT                   /protein_id="ABE61147.1"
FT                   /translation="MRGSDERSGSLFSYVDLEARIRSDHPLRTIRQIANAALNDLSRDF
FT                   DKLYTAFGRPSIAPEKLLRAMLLQAFYGIRSERQLMERLEFDLLLRWFVGLGVDDPVWG
FT                   PLDLLEEPRPIA"
FT   gene            complement(275056..278316)
FT                   /locus_tag="Nham_0248"
FT   CDS_pept        complement(275056..278316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0248"
FT                   /product="Sel1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61148"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ9"
FT                   /protein_id="ABE61148.1"
FT                   /translation="MNSRGSWSEDGIEPSVRERAEAAARRAGVSLNEWLSSTVGGAMPD
FT                   SRLAQSPVPSQDSHQDNHDVADIHQRLDSITRQIDQLSSPATRGEPAVARQLNDAISRL
FT                   DARLARVSAQAPADDSQHRADRVERAAAEVYSRSPRPDVASLEFAIAEVAARQHELDGA
FT                   GAMPPRSSPPVVPAMTTSRPAPDFSGLEQQLFKITSQIESLQRPDGIEQSIAAFRSELA
FT                   GIRHVITEALPRRAIESIENEIRSLSQRIDDVRQNGSDGQALANIERALNEIYDALRSL
FT                   KPAEQLAGFDEAIRNLGNKIDTIVRSSGDSGMMQQLENAIGALRGIVSNVASNDALARL
FT                   SDDLTLLSSKVDQLGRSEGNSDSFAALEQRVVAALTATLENRERPASGGSSEQLEEAVQ
FT                   ALSDRLDSLPAGHDSSSALAHLEQRVSLLLERLETAGGHSGTNLAGTNLGRVEEGLQDI
FT                   LRHLERQQAGLAALTESGPRSTGPTMDSEVVEAIKRELSEMRFCQSETDRHTQDSLEAV
FT                   HNTLGHVVDRLAMIEGDLRAVRAMPAAQAGPARGAIPEPPAGLPPRPELPNPVLSQMAA
FT                   PQPAAAASASASIPPRAIGDILISRDTFDPGHGPQSATVRPPQPRPAIDPDLPPDHPLE
FT                   PGTRPEGRPASPSERIAASESAIGDIAEPPREQSGSSFIAAARRAAQAAAAAAPSSDKA
FT                   GRTKVAIEPARPATGGSSITSKIRSLLVGASVVAIVLGSFQLAMSLFDGTSRTAVSETS
FT                   PVAATAAKPPADAEAAPAPATAIPAMPSMTSPTPIDRQSMISPPSGGSVAPAESPSDTA
FT                   PLSRPETASTEVTGTIPVAPTSVPLERVAIPRSESLPDSIGGPMLRTAALHGDAAAAFE
FT                   VGVRYAEGKGVAVNYDEAAKWYDRAAQAGVVPAMFRLGTLHEKGLGASKDVDAARRYYM
FT                   QAAERGNAKAMHNLAVLDADGGGKGANYTSAAQWFRKAAERGVADSQFNLGILYARGIG
FT                   IEQNLAESYKWFSLAAAQGDADSARKRDEVAKRLDPQSLAAARLAVQTFTPKPQPDDAV
FT                   KVVSPAGGWDGAAAMPQAKTKTARSATAKSAMAKQAVR"
FT   gene            278750..279238
FT                   /locus_tag="Nham_0249"
FT   CDS_pept        278750..279238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0249"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61149"
FT                   /db_xref="GOA:Q1QRJ8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ8"
FT                   /protein_id="ABE61149.1"
FT                   /translation="MRRKPSIEAAAAWIRLMRVQSRVLDTVEHELKKAGFPPLACYDAL
FT                   FELSRAPAGELRPVELEKQMLRPQYATSRLIDRLVDEGLAVRRECKVDKRGQFVAITDA
FT                   GRALQKRMWQAYSAAIEKHVGSKLSDADATKLCGLLDRLGCSCNEAQALAVRDGASAR"
FT   gene            279339..280709
FT                   /locus_tag="Nham_0250"
FT   CDS_pept        279339..280709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0250"
FT                   /product="glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61150"
FT                   /db_xref="GOA:Q1QRJ7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ7"
FT                   /protein_id="ABE61150.1"
FT                   /translation="MARDQIDMTPLQSRNELVAWLEAGVKPASEFRIGTEHEKTPFTLQ
FT                   GHDPVPYEGSRGIGALLEGMKLLLGWEPIMEQGNIIGLHDVTGGGAISLEPGGQFELSG
FT                   APVETVHQTQAELAAHLAQVKEIATPLGIGFLGLGMTPSWSRAQIPMMPKGRYRIMSGY
FT                   MPKVGQYGLDMMLRTCTVQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPN
FT                   GFLSFRSEIWRDTDNARAGMIPWAFEDGMGFERWVDYALDVPMYFVKRDENYIDVSGSS
FT                   FRDFFDGRNKAIPGERPTLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFW
FT                   VGLLYDTTSLEAAWDIAKRWNAQERQALRDDVSRMGFKARIKGRYLFEIARECLVLAHA
FT                   GLRRRGHVDHLGRDESRHLEPLDQILDSGRSPAEEMLEKFNGAWGGSVEPAYSEYAF"
FT   gene            280821..281438
FT                   /locus_tag="Nham_0251"
FT   CDS_pept        280821..281438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61151"
FT                   /db_xref="GOA:Q1QRJ6"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ6"
FT                   /protein_id="ABE61151.1"
FT                   /translation="MSPLRALPSGYAVLRHVLKVHALKVGLILLAALSSIAGPVAPPAH
FT                   AQTNFDRPGADYLRMPLRSGDPADCALACERDRRCRAWSFSYPSERSETAVCWLKNAVA
FT                   PRIANPCCVSGVRGAGVIERRIGPVETSTDRSGGDYRGFEIKKDERADADQICRHACDA
FT                   DSKCRAWTYARPGYAGKAARCFLKKEIKPPRRRPGFTSGVVR"
FT   sig_peptide     280821..280961
FT                   /locus_tag="Nham_0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.997 at
FT                   residue 47"
FT   gene            complement(281663..282430)
FT                   /locus_tag="Nham_0252"
FT   CDS_pept        complement(281663..282430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0252"
FT                   /product="signal peptidase I, Serine peptidase, MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61152"
FT                   /db_xref="GOA:Q1QRJ5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ5"
FT                   /protein_id="ABE61152.1"
FT                   /translation="MSAETSTPSTVRRWGGQIVQIAAIVLVVLVAKGALAEPFYVPSAS
FT                   MEPTLLIGDALLASKYPYGYSTASLPIHVSFPETSRVFGELPKRGDVVVFRWPGDRSQV
FT                   WVKRVIGLPGDRIQMRGGQVWINGQATALKPDGLGEAEDDNGSSEPARRYVETLPGGIS
FT                   HPIFKIHDNGRLDDTVEVTVPPGHLFVMGDNRDNSADSRVPVSQGGVGLLPTDNLVGRV
FT                   DAIVGSWDMGIRSQPVWTWLSGFRLARFFTAVH"
FT   gene            complement(282427..283854)
FT                   /locus_tag="Nham_0253"
FT   CDS_pept        complement(282427..283854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0253"
FT                   /product="microcin-processing peptidase 2, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61153"
FT                   /db_xref="GOA:Q1QRJ4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ4"
FT                   /protein_id="ABE61153.1"
FT                   /translation="MTSPAATSLLDRADLDRDSVRDEVARGLKGADDGELFLEYSQSEA
FT                   LMFDNGRLKQATYDTSQGFGLRAVKGDAVGYAHSSDVSLPALIRAADAVGAVRGGYQGT
FT                   FAAAPAHTNVRLYVDDNPLDGLGFETKVKLLTEIDAYVRDKDPRVRQVSVSLGATWQVV
FT                   EIMRPDGESYRDIRPLVRVNISVVAGQGDRQETGSHGYGGREGYARFIETKAWRSAADG
FT                   AIRQALVNLESVPAPAGEMDVVLGPGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLMGQQ
FT                   VAARGVTVVDDGTISARRGSLSIDDEGTPTGRTVLIEDGVLIGYMQDRQNARLMGMKPT
FT                   GNGRRQDYAHVPMPRMTNTYMPAGDRDPAEILASVKNGIYAANFGGGQVDITSGKYVFQ
FT                   CTEAYKIENGKIGAPLKGAMLIGNGPTDLHRITMIGNDIALDDGIGTCGKNGQGVPVGV
FT                   GQPTLRMERITVGGTGG"
FT   gene            complement(284077..284637)
FT                   /locus_tag="Nham_0254"
FT   CDS_pept        complement(284077..284637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0254"
FT                   /product="Invasion associated locus B"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61154"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRJ3"
FT                   /protein_id="ABE61154.1"
FT                   /translation="MRPSKRHIRHAPGRIAVAKRQPTRVLTGWIAALIVLGFAGAACAQ
FT                   GAVKSVHGDWQIRCDTPPGAKAEQCALIQSVVAEDRSNAGLTVIVLKTADQKSRLMRVV
FT                   APLGVLLPSGLGLKLDNVDVGRAGFVRCLPNGCVAEVVLDDKLLGQLRSAKTATFIIFE
FT                   TPEEGIGFPLSLNGLGEGYDKLP"
FT   sig_peptide     complement(284503..284637)
FT                   /locus_tag="Nham_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.951 at
FT                   residue 45"
FT   gene            285079..285936
FT                   /locus_tag="Nham_0255"
FT   CDS_pept        285079..285936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0255"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61155"
FT                   /db_xref="GOA:Q1QHV5"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QHV5"
FT                   /protein_id="ABE61155.1"
FT                   /translation="MKMSKGQIGRRFSRRFLGVAFGMAALAAGGSVSAEELVGQPNAWG
FT                   LDLQAAASPVMESIAKMHSGLVVVITLITLLVTALLVVAMLKFNARANPVPSKTTHNTM
FT                   IEVAWTIIPVLILVGIAVPSFRLLFEQLDIPKADLTVKATGKQWYWSYTYPDNGKFEFD
FT                   SLMAEDKKPRMLAVDNEMVVPVNKVVVVQVTGADVIHSFGVPAFGIKVDAIPGRLNETW
FT                   FKATKTGMFYGQCSELCGRDHAFMPIAVRVVSEQDFAAWVETAKKKFASNPANAVASAA
FT                   DVMH"
FT   sig_peptide     285079..285183
FT                   /locus_tag="Nham_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.967 at
FT                   residue 35"
FT   gene            286019..287632
FT                   /locus_tag="Nham_0256"
FT   CDS_pept        286019..287632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0256"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61156"
FT                   /db_xref="GOA:Q1QHV6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QHV6"
FT                   /protein_id="ABE61156.1"
FT                   /translation="MATATAHDHAHDDDHAHHPTGWRRFAYSTNHKDIGTMYLVFALVA
FT                   GLIGGLMSMGIRAELMFPGVQVFHPAHEYNVFVTNHGLIMIFFMVMPAMIGGFGNWFVP
FT                   LMIGAPDMAFPRMNNISFWLLPAALALLLISTFVEGEPGSSGAGTGWTLYPPLSTSGHP
FT                   GPAVDFGILSIHLAGASSILGAINFITTIFNMRAPGMTMHKMPLFVWSILVTVFLLLLA
FT                   LPVLAGAITMLLTDRNFGTTFFAPDGGGDPVLFQHLFWFFGHPEVYILILPGFGMISHV
FT                   ISTFSKKPIFGYLGMAYAMVAIGGVGFVVWAHHMYTVGMVSSAQAYFVAATMVIAVPTG
FT                   VKVFSWIATMWGGSIEFRAPMLFAIGFIFLFTVGGVTGVVLANAGVDRVMQETYYVIAH
FT                   FHYVMGIAAVFAIFAGWYYWFPKMSGYMYNETIAKLHFWLMFIGANVLFFPQHFLGLQG
FT                   MMRRSVDYPDAFAGWNEISSYGAFIAGSGVLVFLYGLIDAFARKQKAADNPWGEGATTL
FT                   EWTLSSPPPFHQFGTLPKVQ"
FT   gene            287696..288682
FT                   /locus_tag="Nham_0257"
FT   CDS_pept        287696..288682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0257"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61157"
FT                   /db_xref="GOA:Q1QHV7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QHV7"
FT                   /protein_id="ABE61157.1"
FT                   /translation="MRRARRAAYLNKVSCVLPVVDQNAIELPPRISEASVADYFALLKP
FT                   RVMSLVIFTALVGLMIAPGHVHPVLGFTAILCIAVGAGASGALNMALEGDIDVLMSRTA
FT                   NRPIPRGRITRGEAMGFGLTLSFFSVMTLGALVNWYAGGLLAFTIFFYVVIYTMGLKRR
FT                   TAQNIVIGGAAGALPPVVAWAAATGSLSVEPLLLFLIIFFWTPPHFWALALFRSDDYAR
FT                   AGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWVYGVTSLVLGAGMLVLAI
FT                   NVYRHRTGSTALRATRRLFAFSILYLFALFAVLLLDVLAKAVAPLIW"
FT   gene            288699..288863
FT                   /locus_tag="Nham_0258"
FT   CDS_pept        288699..288863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0258"
FT                   /product="CoxF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61158"
FT                   /db_xref="GOA:Q1QHV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QHV8"
FT                   /protein_id="ABE61158.1"
FT                   /translation="MDNKPKPDEIVLTEAQKKRRRERSIAIACALGILVVLFFAVTLVK
FT                   GPGVIVRPM"
FT   gene            288869..289519
FT                   /locus_tag="Nham_0259"
FT   CDS_pept        288869..289519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0259"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61159"
FT                   /db_xref="GOA:Q1QHV9"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QHV9"
FT                   /protein_id="ABE61159.1"
FT                   /translation="MTDAPQHPQQPATGTPATPKAAPRVGRDVRIGATCGLLVALMVGA
FT                   AYAAVPFYNWFCRATGFNGTTQVAKVAPSAAPLARTVAVRFDSNISGGLPWKFEPEQTE
FT                   INVRIGEVATVYYTVTNHAATATTGQAAYNVTPLTVGSYFTKINCFCFTEQTLAPGEKR
FT                   EMAVVFYVDPSFAADSENDGVRTITLSYTFFPVKDAAPKPVAASEPDRPGGSI"
FT   gene            289622..290476
FT                   /locus_tag="Nham_0260"
FT   CDS_pept        289622..290476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0260"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61160"
FT                   /db_xref="GOA:Q1QHW0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QHW0"
FT                   /protein_id="ABE61160.1"
FT                   /translation="MATAQVKHDYHLVDPSPWPIVGATAAFVMAVGAILWMHHLTAVAP
FT                   IIFGIGVVGVLYTMASWWADVIREAEHKGDHTRVVQISHRYGMILFITSEVMFFVAWFW
FT                   AFFNSALFPGDPVHATREVLFGGVWPPKGIETFDPWHLPLLNTLLLLTSGTTVTWAHHA
FT                   LLNGDRKGLKWGLILTIALGATFTCVQAYEYSEAAFSFAGNVYGATFFMATGFHGFHVL
FT                   VGTIFLIVCLFRANAGHFTPTQHLGFEFAAWYWHFVDVVWLFLFVCIYVWGNGASAMAH
FT                   AAH"
FT   gene            290551..290940
FT                   /locus_tag="Nham_0261"
FT   CDS_pept        290551..290940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0261"
FT                   /product="protein of unknown function DUF983"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61161"
FT                   /db_xref="GOA:Q1QHW1"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QHW1"
FT                   /protein_id="ABE61161.1"
FT                   /translation="MSNFYARATLFEAILRGVACKCPRCGKGKLFSGFLTLRPSCQRCE
FT                   LDYAFIDSGDGPAVFIILIGGFIVVGCALIVEVKYQPPYWVHAALWIPLILAVTLAPLR
FT                   AMKSLLISLQFHHKAAEGRSIRPNP"
FT   gene            291372..292790
FT                   /locus_tag="Nham_0262"
FT   CDS_pept        291372..292790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0262"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61162"
FT                   /db_xref="GOA:Q1QRI5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRI5"
FT                   /protein_id="ABE61162.1"
FT                   /translation="MTHYISTRGETQKLRFCDVMLAGLARDGGLYVPEVWPQLTPDTIA
FT                   GFFGRPYWEVAVEVIRPFVAGDISDADLGRMANEAYATFRHPAVVPLDQIGPNQFMLEL
FT                   FHGPTLAFKDVAMQLLSRLMDHVLAQRGRRTTIVVATSGDTGGAAVDAFANRANVDLIV
FT                   LFPDGRISEVQRRMMTTTGASNVHALAVKGTFDDCQAIVKGLFNNHRFRDEVSLSGVNS
FT                   INWARIVAQVVYYFTSAVALGAPARTVDFTVPTGNFGDIFAGYVAKKMGLPVRCLRIAA
FT                   NVNDILVRTLKTGIYEVREVRATASPSMDIQVSSNFERLLFEATGRDAAQVRALMASLA
FT                   QSGRFVLPDPVLAEIRRDFDVGRSDETETAAAIRAAWREAGDLVDPHTAVALAIADRDT
FT                   SDSKIPNIVLATAHAAKFPDAVEAACGARPQLPAWLDGLMTRPERITVVNNDQVEIERF
FT                   VLSVSRAAKHGVAG"
FT   gene            292787..294076
FT                   /locus_tag="Nham_0263"
FT   CDS_pept        292787..294076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0263"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61163"
FT                   /db_xref="GOA:Q1QRI4"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRI4"
FT                   /protein_id="ABE61163.1"
FT                   /translation="MSVDVTKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPNEHGI
FT                   SHLLEHMAFKGTTTRSAREIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLS
FT                   DILSNPNFAADELEREKSVIEQEIGAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTPET
FT                   LKRFNGDSLHGYLATHYRGPNMVVAAAGAVEHKAVVAEVERRFASFDAAPAPKPQAAKF
FT                   GKGGSKVVHRDLEQAHLTLALEGLPQTDRSLFSLQVFTHLIGGGMSSRLFQEVREKRGL
FT                   CYSIYAFHAPYADTGFFGLYTGTDPSDAPEMMEVVVDVINEAVETLTDTEIARAKAQMK
FT                   AGLLMALESCSARAEQLARHILVYGRPQSVAELMARIDAVSIESTRDVARDILTRSRPA
FT                   VVALGSGRGLDTAVAFAEGLTPSKAKILLH"
FT   gene            294254..294838
FT                   /locus_tag="Nham_0264"
FT   CDS_pept        294254..294838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0264"
FT                   /product="[SSU ribosomal protein S5P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61164"
FT                   /db_xref="GOA:Q1QRI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRI3"
FT                   /protein_id="ABE61164.1"
FT                   /translation="MALFRLPSSAPALMPRGRGLLLRAPEVSDFLQWTRLREYSRAYLT
FT                   PWEPIWPSDDLTRAGFRRRLRRYAEDIAGDKSYPFIVFRESDGVMLGGVTLANVRRGIV
FT                   QAGTIGYWIGEPYAGQGYMTAALRVLLPTLFGELNLHRIEAACIPSNAPSIRVLEKCGF
FT                   TREGLARRYLCINGIWQDHLLFGMLHEDFHG"
FT   gene            294997..295683
FT                   /locus_tag="Nham_0265"
FT   CDS_pept        294997..295683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61165"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRI2"
FT                   /protein_id="ABE61165.1"
FT                   /translation="MVPVADSTDAPEPAVAGPLRRFPFGLVTMVAVFGIVAASPTQAQS
FT                   LGDRFKDMFGIKSQPERAAPASGETASAPSDLSCPPVTIRAGASTYAVGLPGKPASGTD
FT                   LRYQAIIGETARECDYNTDTHQIAIKVGIQGRVIVGPAGAPPTVEVPLRVAVVEDGVSA
FT                   KTIATKAYTITVNVPGVEGGTYSFVSDDIAYPAPQGAVADRYVFYIGFDPQALKPEPRA
FT                   RSKRQR"
FT   gene            complement(295916..296401)
FT                   /locus_tag="Nham_0266"
FT   CDS_pept        complement(295916..296401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0266"
FT                   /product="H+-transporting two-sector ATPase, B/B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61166"
FT                   /db_xref="GOA:Q1QRI1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRI1"
FT                   /protein_id="ABE61166.1"
FT                   /translation="MFAEPETWVAIAFVILMGVFAYVGVHRTVLTTLDRRSARIKGELD
FT                   DARRLKDEAAKLLADYRARHASAEREAQDIIASAKAEAERIAAEAKVKMEDFVARRTKS
FT                   AEGKIASAEAQAIADVRAAAADAAVAAAAAILSQSVKGQVADDLLANGVNEVRAKLN"
FT   gene            complement(296409..296966)
FT                   /locus_tag="Nham_0267"
FT   CDS_pept        complement(296409..296966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0267"
FT                   /product="H+-transporting two-sector ATPase, B/B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61167"
FT                   /db_xref="GOA:Q1QRI0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRI0"
FT                   /protein_id="ABE61167.1"
FT                   /translation="MADSHGNAKGATAHTEAGGGHKAPFPPFQKDTFASQLVSLTIAFV
FT                   ALYLISSRLALPRVRKTIDDRQNKIEGDIAQAQTLKNESDAALKAYEVELAAARTRAQA
FT                   IGNETREKLNAEADTERKALEKRLSAKLADAEKTIASTRTAAMSNVRGIASDAATAIVQ
FT                   QLTGAMPDRKLVDSAVEASMKG"
FT   gene            complement(297030..297257)
FT                   /locus_tag="Nham_0268"
FT   CDS_pept        complement(297030..297257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0268"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61168"
FT                   /db_xref="GOA:Q1QRH9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH9"
FT                   /protein_id="ABE61168.1"
FT                   /translation="MDPLAAKYIGAGIACIGMGGAGAGVGIIFGNYLAAAVRNPSAAQG
FT                   QFGNLIFGFAVTEALGIFSLLIALLLLFAL"
FT   gene            complement(297316..298059)
FT                   /locus_tag="Nham_0269"
FT   CDS_pept        complement(297316..298059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0269"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61169"
FT                   /db_xref="GOA:Q1QRH8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRH8"
FT                   /protein_id="ABE61169.1"
FT                   /translation="MMDPIHQFNIETIFTIGHIGGQEIAFTNSSAYMLVAVVLTSLLML
FT                   ATGRKLVPGRMQSIAEISYEFVADTIHTTAGKDGMKFFPFVFTIFMLVTVSNLVGIVPY
FT                   TFTISSHIIVTAALAFLVFFTVLIYGFYKNGLRFFKLFVPSGIPIVILPLVVAIEVISF
FT                   LSRPVSHSVRLFANMLAGHITLKVFASFVTMLGAMGIVGVFGAVLPLALVVALTALELL
FT                   VAFLQAYVFTILTCIYINDAIHPGH"
FT   gene            complement(298127..298510)
FT                   /locus_tag="Nham_0270"
FT   CDS_pept        complement(298127..298510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0270"
FT                   /product="FoF1 ATP synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61170"
FT                   /db_xref="GOA:Q1QRH7"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH7"
FT                   /protein_id="ABE61170.1"
FT                   /translation="MADGTDKNSSGHGDREHSAPDEAALSERLGNLDQRLSKLQGARKN
FT                   ETDQFGDGSGNGAARASAMARGFRLSSELIAGVVVGAVIGWGFDRLLSTSPWGLIVFFL
FT                   LGFAAGVINVMRSAGVVPEQTDR"
FT   gene            299075..299629
FT                   /locus_tag="Nham_0271"
FT   CDS_pept        299075..299629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH6"
FT                   /protein_id="ABE61171.1"
FT                   /translation="MSAATSPLRLSRIPATAALAACLAAPALAQATPDVENGRYTLTPM
FT                   SGGFVRLDTRTGVVSHCGDKGNGWACYALPEERAALDKEIGRLLAENEKLKAQLAAREP
FT                   TASGKTQQALPKADSLRPGAPKAGVPKADQPKSADANRNSIEIPLPSDRDMDRVMSFVE
FT                   RAWRRLIEMAGRVHRDASGGI"
FT   sig_peptide     299075..299164
FT                   /locus_tag="Nham_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.921 at
FT                   residue 30"
FT   gene            299819..300235
FT                   /locus_tag="Nham_0272"
FT   CDS_pept        299819..300235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61172"
FT                   /db_xref="GOA:Q1QRH5"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH5"
FT                   /protein_id="ABE61172.1"
FT                   /translation="MRFSKILLAALAVGTTSILFQPAMAAPLTVDRSLATPAATPQPVR
FT                   YRHHGWHRHHHHHGWHHHGWRRGHYGYGPGYYGYGPGPVFGGLAAGAMIGSAIAGSQAR
FT                   APRSDDAYCFRRFKSYDPRSGTYLGYDGNRHPCP"
FT   sig_peptide     299819..299896
FT                   /locus_tag="Nham_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            300484..301179
FT                   /locus_tag="Nham_0273"
FT   CDS_pept        300484..301179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0273"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61173"
FT                   /db_xref="GOA:Q1QRH4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH4"
FT                   /protein_id="ABE61173.1"
FT                   /translation="MREPVDSMTASDSTRIVIADDHPLFRDALRQAVASIMPAQIDEAG
FT                   TFEELTARLEQEADVDLILLDLSMPGISGFSGLIYLRAQYSAIPVVVVSASDDVATIRR
FT                   SMDFGASGFIPKRLGVDALRTAILKVIEGDIWIPPDVDLSAAADPEMTRLRDRLVTLTP
FT                   QQVRVLMMLSEGLLNKQIAYELGVSEATIKAHVSAILQKLGVDSRTQAVIAAARIAGDQ
FT                   WRQSEPSAG"
FT   gene            complement(301267..304776)
FT                   /locus_tag="Nham_0274"
FT   CDS_pept        complement(301267..304776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0274"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61174"
FT                   /db_xref="GOA:Q1QRH3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH3"
FT                   /protein_id="ABE61174.1"
FT                   /translation="MLHDWGVIAAAIGYIGFLFLVASYGDRAPKFGRGPAGPLIYPLSL
FT                   AVYCTSWTFFGSVGLATRTGPEFLAIYVGPVLLIAFCTPLLRRIIQLAKSQNITSVADF
FT                   IAARYGKSQAVAATVAVIAMIGSIPYISLQLKAVASSLGTILIDDQAIAKIPVINDIAL
FT                   IVTIALALFAVLFGTRQTDATEHQHGLMLAIATESIVKLVAFIAAGVFVTFWMFSPVEL
FT                   VERALKSPEAMRAIEYTPSIGNFLTMTLLSFLAIMLLPRQFHVSVVENSSDAEVGRARW
FT                   LFPLYLVAINIFVVPIALAGLVTFPFGNSDMYVLALPIEGQSRLLSIAVFIGGLSAGTA
FT                   MVIVECVALAIMVSNDIVVPLVLQRSPAARGGRKDFGNFLLKTRRLAIFAIMIMAYLYY
FT                   RALGSAQLAAIGLLSFAAIAQLAPVFLGGLVWRRATARGAMGGMLAGFAVWAYTLFLPS
FT                   LLDGTTVGTMLLQHGPFGIGELKPQALFGVNLPPLMHGVLWSLSLNVLTYVALSLTRQP
FT                   SSIERVQAGIFAPHALAPLTPPFRRWRSMVTVQDILGTVAQYLGPERARQSFKAFAAAR
FT                   RLNLDPAAPADFELLQHAEHLIASSIGAASSRLVISLLLRRRTVSAKAALKLLDDAHAA
FT                   LHFNREMLQTALNHVRQGIAVFNTDLQLICSNRQFGNILGLPPQIVQIGIPLTEILEFL
FT                   GTIDKSQIDREAAKQTRLTAYTTEGQPYLERRPDRNIVIEVRANRMPDGGLVITFSDVT
FT                   PSFEAAEALERANATLEKRVRDRTEELTRLNSELARAKSIAEEANISKTRFLAAAGHDI
FT                   LQPLNAARLYVTSLVERRSGGEDSRLVQNIDDSLEAIEEILGALLDISRLDAGAITTSI
FT                   TSFRVGDLMRSLEIEFAPMARARQVRLTFVPSSLPIASDRMLLRRLLQNLISNAIKYTP
FT                   HGRVLIGCRRRGESLRINVYDTGVGIPILKRGEIFKEFHRLEQGARIARGLGLGLSIVQ
FT                   RLARVLDLTIALDSNRGGGSLFSVTIPIAPAINQTAHATAVTSSTPLSHAPMSGTLIVC
FT                   IENDLAILDGMKTLLTSWDARVIAVTDHESAIAAIEAAGGPITGLLVDYHLDRGNGIAT
FT                   IREIRRKFGETIPAILITADRSPHVREAAQLERVSVLNKPLKPASLRALIGQWRSQQIA
FT                   AAE"
FT   gene            304967..305565
FT                   /pseudo
FT                   /locus_tag="Nham_0275"
FT   gene            complement(305768..306997)
FT                   /locus_tag="Nham_0276"
FT   CDS_pept        complement(305768..306997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0276"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61175"
FT                   /db_xref="GOA:Q1QRH2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH2"
FT                   /protein_id="ABE61175.1"
FT                   /translation="MDYSKFFSNALDRLHDERRYRVFADLERIAGRFPYATWHSPKGPR
FT                   NVVIWCSNDYLGIGQHPKVVGAMVETATRVGTGAGGTRNIAGNHHPLVQLEQELADLHG
FT                   KPAALVFTSGYVSNQTGISTLAKLIPNCLILSDALNHNSMIEGIRQSGCERIVFRHNDV
FT                   AHLEELLRAADPDRPKLIACESLYSMDGDVAPLAKICDLAERYGAMTYVDEVHAVGMYG
FT                   PRGGGIAEREGVMHRIDVLEGTLAKAFGCLGGYIAGNSDIIDAVRSYAPGFIFTTSLPP
FT                   AICSAATAAIRHLKSSTWERERHQERAARTKASLIAAGLPVMVSSTHIVPLFVGNPERC
FT                   KQASDMLLHDHGIYIQPINYPTVAKGMERLRITPSPYHDDALVDQLAEALLQVWERLDL
FT                   PLQAKSMAAE"
FT   gene            complement(307289..308311)
FT                   /locus_tag="Nham_0277"
FT   CDS_pept        complement(307289..308311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0277"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61176"
FT                   /db_xref="GOA:Q1QRH1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRH1"
FT                   /protein_id="ABE61176.1"
FT                   /translation="MDAASVSFGSGHDLSSQPRHDWTRSEAETLYNLPFADLIFQAQTL
FT                   HRRHFDPNHVETANLLSIKTGGCPEDCGYCSQSAHYDSGVKATKLMDREAVIETARRAR
FT                   DAGASRFCMAAAWRNPKDRDLDRVCDMVSAVKELGLETCATLGMLTPDQARRLHDAGLD
FT                   FYNHNVDTSPEFYGNIITTRTMQDRIDTLAHAREAGLKVCCGGIIGLGEQVGDRLGMLM
FT                   LLANLPAHPESVPINMWNEVKSVPVNDTAERPDPIALVRMIAVARIMMPRSVVRLSAGR
FT                   QYMTDELQALCFLAGANSIFIGDVLLTTKNPQTARDAALLDRLGIRSRLDDAKAAAPPH
FT                   "
FT   gene            complement(308769..309506)
FT                   /locus_tag="Nham_0278"
FT   CDS_pept        complement(308769..309506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0278"
FT                   /product="OmpA-like transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61177"
FT                   /db_xref="GOA:Q1QRH0"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRH0"
FT                   /protein_id="ABE61177.1"
FT                   /translation="MTGPTNGCSDIEFLENVMKKILLASVAIVGMAAIVPAQAADLAAR
FT                   PYTKAPVYEAAPIYNWTGFYLGGHVGGAFGGDHNLAAPGFTRNGNDGVFMGGGQIGYDY
FT                   QFSPNWVFGIGANYSFLDTNDHPFVNRGLGSVTGRLGYTWGPALLYAKGGYAWADTRNT
FT                   NGFGGDTFSNNRIGRDGFTVGGGLEYMFTQNWSGLIEYQYYDFGTTRTTFRNQDVRFRN
FT                   DEHTIKVGLNYRFNWGAPVGPRY"
FT   sig_peptide     complement(309387..309506)
FT                   /locus_tag="Nham_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.986 at
FT                   residue 40"
FT   gene            complement(309962..311176)
FT                   /pseudo
FT                   /locus_tag="Nham_0279"
FT   gene            complement(311426..311668)
FT                   /locus_tag="Nham_0280"
FT   CDS_pept        complement(311426..311668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61178"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG9"
FT                   /protein_id="ABE61178.1"
FT                   /translation="MTRRTHRAAGKSPSPYHSPHNTRSPEPEQPGLVRRQHRRADIAPG
FT                   LAPQHQHFVIVASTRFQLFNARGDAAGRHGDTIKR"
FT   gene            311997..312251
FT                   /locus_tag="Nham_0281"
FT   CDS_pept        311997..312251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG8"
FT                   /protein_id="ABE61179.1"
FT                   /translation="MHHRKADGSLMADFSNRLEKLELKSARHSRPRLSPERRKLLTDCA
FT                   VLHGDQQASQVLSECRPTNIPSSNEQRAAAIAAGLRVDS"
FT   gene            complement(312683..313237)
FT                   /locus_tag="Nham_0282"
FT   CDS_pept        complement(312683..313237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0282"
FT                   /product="Resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61180"
FT                   /db_xref="GOA:Q1QRG7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG7"
FT                   /protein_id="ABE61180.1"
FT                   /translation="MSNADNLPATVLGRKAVVYVRQSTQAQVETNTESRRRQYELVETA
FT                   RAHGFRSIEVIDDDLGRSASGMSERPGFDRLVAWLCAGDVGAVLCFDASRLARNGRDWH
FT                   HLLELRGLVEARVIDLDGVYDPSRPNDRLLLGMKGSISEFELGVLRARMLDAARAKARR
FT                   GELRISVPLGYLWSREYVNKG"
FT   gene            313607..313891
FT                   /locus_tag="Nham_0283"
FT   CDS_pept        313607..313891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG6"
FT                   /protein_id="ABE61181.1"
FT                   /translation="MYKLTPTRRSRGHAAIATAATPDIRAARAATLAEMDRKRQLALAE
FT                   DEVAQAREVLEKAKSLSAEQAALDVAMARLTELQTAQTSDNGSKKTKAA"
FT   sig_peptide     313607..313696
FT                   /locus_tag="Nham_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.873) with cleavage site probability 0.865 at
FT                   residue 30"
FT   gene            complement(313901..315592)
FT                   /locus_tag="Nham_0284"
FT   CDS_pept        complement(313901..315592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0284"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61182"
FT                   /db_xref="GOA:Q1QRG5"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG5"
FT                   /protein_id="ABE61182.1"
FT                   /translation="MVSLKRSMTTRARSALPQFRVRVPATVVDSLRVLLYLSERAGPPF
FT                   AKVVKIGETVEFSLGTTDSVVPAARQDDALDHLRRLFDLTATIPVQLSHRDMVALSGET
FT                   YRLYIKANEENPGEPMAWRMHKALHRAVVEGRIANPPPATLSADDATAATDLFGSGDLT
FT                   AAVNALPAGQHDGLEDRFGLLADWVLIRSRLNLTTDDRRRFLQLVGTASLDASWQLRRN
FT                   SEGDYSPDPKAARFPAMETVTAGQPRQTITGLFDLWWTEAKALGRSQSTHDGYKNGIDR
FT                   LVEFLEHDDAKRITADDALRFKDHCLKTVTPKTFRDADLPGLKSVFGWGLTNRKIAANT
FT                   FATVTIKREKKIVVRSPGFTDEEAAAIFRHCLAYQHKPKENAKTAAAKRWGPLIAAYTS
FT                   CRIAEALQLRKADVFEESGYSVMRFTPEAGSIKTGIYRLVPIHSHLIDLGFLIFVDESS
FT                   DGPLFATGSYKRVFDFVRGVVTDPNVQPNHGWRHRLKTVARNLGLDPRVVDAIQGHAAR
FT                   TASDGYGDVSVVAMALVMDKILRYRSSTRKMPGPRKQPRRESVSER"
FT   gene            complement(315665..315739)
FT                   /locus_tag="Nham_R0005"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(315665..315739)
FT                   /locus_tag="Nham_R0005"
FT                   /product="tRNA-Thr"
FT   gene            316402..317691
FT                   /locus_tag="Nham_0285"
FT   CDS_pept        316402..317691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0285"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61183"
FT                   /db_xref="GOA:Q1QRG4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRG4"
FT                   /protein_id="ABE61183.1"
FT                   /translation="MDRIRIVGGNKLNGTIPISGAKNAALPLMIAALLTEETLILDNVP
FT                   RLADVAQLQRILGNHGVDIMSAGKRSGDHEYQGQTLHISAANVIDTTAPYELVSKMRAS
FT                   FWVIAPLLARMHETKVSLPGGCAIGTRPVDLLIMALEKLGAEVAIDGGYVIAKAPGGLT
FT                   GAEVDFPKVTVSGTHVALMAATLAKGTTVITNAACEPEIVDVADCLNKMGARVSGAGTP
FT                   RIVIEGVSRLGGARHTVLPDRIETGTYAMAVAMTGGDVLLRGARPELLQSALDVLTEAG
FT                   AVITPNNEGIRVARNGAGINPVIVSTAPFPGFPTDLQAQLMALMTRAKGSSHITETIFE
FT                   NRFMHVQELARFGARIHLDGETATIEGIGILRGAPVMATDLRASVSLVIAGLAAEGETM
FT                   VNRVYHLDRGFERLEEKLSGCGASIERISD"
FT   gene            317895..319190
FT                   /locus_tag="Nham_0286"
FT   CDS_pept        317895..319190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0286"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61184"
FT                   /db_xref="GOA:Q1QRG3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG3"
FT                   /protein_id="ABE61184.1"
FT                   /translation="MPIRIDSRSADFASRFKAFLATKREVSADIETATRAIVDDVAARG
FT                   DVALIEATRKFDRLSVDAAGLRFTAAEIDAAVEACDTATLDALNLARDRIELFHRRQLP
FT                   KDDRFTDALGVELGSRWTAIEAVGLYVPGGSAAYPSSVLMNAVPAMVAGVARVVMVVPS
FT                   PDGRINPLVLAAARLGGVSEIYRVGGAQAVAALAYGTATIAPVAKIVGPGNAYVAAAKR
FT                   LVFGKVGIDMIAGPSEVLVIADDTGNAGWIAADLLAQAEHDANAQSILITDSDALAADV
FT                   ERAVDTQLATLPRADIARASWTDFGAIILVRSLGEAVTLADAIAAEHLEIMTADPESLA
FT                   ARIRNAGAIFLGPHTPEAIGDYVGGSNHVLPTARSARFSSGLGVLDFMKRTSILRCGPD
FT                   QLRALGPAAMTLGKAEGLDAHARSVGVRLNLQ"
FT   gene            319187..319681
FT                   /locus_tag="Nham_0287"
FT   CDS_pept        319187..319681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0287"
FT                   /product="Uncharacterized conserved protein UCP032146"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61185"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRG2"
FT                   /protein_id="ABE61185.1"
FT                   /translation="MSKTPPKEDSRNRIVAVMLDEDSIGRSGPDIEHERAIAIYDLVEK
FT                   NLFAPEGAGGGPFTLRIAITGNRLMFDIRREDDAPVVTHLLSLTPFRRIVKDYFMICDS
FT                   YYQAIRTATPDKIEAIDMGRRGIHDEGSRTLQERLNGKVRVDFETARRLFTLISVLHWK
FT                   G"
FT   gene            319776..320243
FT                   /locus_tag="Nham_0288"
FT   CDS_pept        319776..320243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0288"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61186"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG1"
FT                   /protein_id="ABE61186.1"
FT                   /translation="MAAPARVHNPQSVLFACAHNSVRSPMAASLLQHMFPRTLYVKSAG
FT                   VRTGQLDPFAVAVMAELGQDISKHRPMTFEEIEDWEGLNFDLIITLSPEAHHKALELTR
FT                   TIAAVVEYWPTPDPTSIEGNREQRMQAYRNVCDGLLSRIRKRFARGGGVGL"
FT   gene            320355..321692
FT                   /locus_tag="Nham_0289"
FT   CDS_pept        320355..321692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0289"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61187"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRG0"
FT                   /protein_id="ABE61187.1"
FT                   /translation="MVDTRSKWEDELGRWLKPFLDRLGHKARRRMCPLYVSGLIGPGDR
FT                   KSVQPMAARLAPNDYDQLHHFIADGVWDAAPLESELLIQADRLVGGKDAVLVIDDTAMP
FT                   KKGDRSVGVAPQYASSLGKTANCQTLVSLTLARGEVPVMVALRLFVPESWTSNPVRLKR
FT                   AGVPVEHRAARTKPEIALAEIDRVMAAGMRFGCVLADAGYGLSAPFRQGLTTRGLAWAV
FT                   GIPRHLKVYPVGVKLIWPVAGRGRPRKRHIPDILSRAAEDMLANAKWQNVSWRNGTKGR
FT                   LEARFAAVRVRTADGPPQRIKDMGQQHLPGDEAWLIGEHRTSGEKKYYLANLPAKTKLR
FT                   ALAATIKARWICEQAHQQLKEELGLDHFKGRSWQGLHRHALMTMIAYAFLQHRRLAQAG
FT                   RKKKNQRSTASAEPAGRTPSHRRSHRSTTTSAVRILPKTNRRKAAA"
FT   gene            321785..322429
FT                   /pseudo
FT                   /locus_tag="Nham_0290"
FT   gene            322473..323579
FT                   /pseudo
FT                   /locus_tag="Nham_0291"
FT   gene            323887..324510
FT                   /locus_tag="Nham_0292"
FT   CDS_pept        323887..324510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0292"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61188"
FT                   /db_xref="GOA:Q1QRF9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRF9"
FT                   /protein_id="ABE61188.1"
FT                   /translation="MTGRLKLVLASGSPRRLSLLNQAGIDPDALRPADVDETPERGELP
FT                   RACANRLARAKADATLKAVQLDDDLRGSFILAADTVVAVGRRILPKADLADEASQCLRL
FT                   LSGRNHRVYTAVCLVTPKGNCRQRLIETRVRFKRLTEEDIRGYVGSGEWRGKAGGYAVQ
FT                   GIAGSFVVKLVGSYTNVVGLPLYESVSLLGGEGFPIRSGWLNAG"
FT   gene            324500..324682
FT                   /locus_tag="Nham_0293"
FT   CDS_pept        324500..324682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0293"
FT                   /product="protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61189"
FT                   /db_xref="GOA:Q1QRF8"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QRF8"
FT                   /protein_id="ABE61189.1"
FT                   /translation="MPARKPAGARPEKPCPICGKPAVAASRPFCSERCRDVDLNRWLSG
FT                   SYVIPVSKTDGEDAE"
FT   gene            324825..324900
FT                   /locus_tag="Nham_R0006"
FT                   /note="tRNA-Phe1"
FT   tRNA            324825..324900
FT                   /locus_tag="Nham_R0006"
FT                   /product="tRNA-Phe"
FT   gene            325063..326262
FT                   /locus_tag="Nham_0294"
FT   CDS_pept        325063..326262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0294"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61190"
FT                   /db_xref="GOA:Q1QRF7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF7"
FT                   /protein_id="ABE61190.1"
FT                   /translation="MLTQLAITAAKPKAKPYKLSDGAGLSLLVETGGGKLWRFRYHFGG
FT                   KEKMLSFGAYPEVTLAQARAKRDEARQTLAGGIDPAQKRKEDKVAASISAANTFGVVAA
FT                   EYIDRLEKEGAAPSTVSKNKWLLQDLASPLTKRPIADILPAEILDLCKRVEKSGRRDTA
FT                   RRLRGTIGSVFRYAVVTLRAQSDPTYALRGALLKPEVNHRAAIVDEAKLGALMVNIDQY
FT                   DGWPTLRAALLLLALTMTRPGDVRHMRKSEIIFPKALWRIPAERMKMRRPHDVPLSKQA
FT                   LAIIREVWDLTAGNGLLLPSIRSAIKPLSENAMNSALRRMGYSKEEATAHGFRSSASTI
FT                   LNERGFNPDVIEAALAHQDEDDVRRAYNRATYLPERAKLMQDWADLLDEFRTLSLRHVA
FT                   "
FT   gene            327478..328680
FT                   /locus_tag="Nham_0295"
FT   CDS_pept        327478..328680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF6"
FT                   /protein_id="ABE61191.1"
FT                   /translation="MSLPEDRCTARAASFEQMHSYIIGKSGVGKSTFLENHALENEGSF
FT                   AFLDPHGDSAEKLADTIDCIFWEPSDTEHVIGFNVLENVPEPQRHLVAAQVVSSFKAIW
FT                   GDSWGPRLEWILYNSVSLLLDNNGSLLDIPKLLTDSGYLSKCLRPLHKRLIKNPTDHAA
FT                   GARRNFWLYEFDALQPRERAAAISPVLNKVGQLAANPVLSGILRHNTIDISRIMNRGQR
FT                   LVVNLSKGQLGEEPSHLLGALLVSAFAQAAEGRANIPFAERRPFTLYVDEFQNFATNNF
FT                   SRILSEARKYRLDLVLAHQFLGQLPDLLRQAVFGNVGRFISFKIGSEDAPVIARELGFP
FT                   ATAEELIDLNRFEAWERSTSIMPKQFKTAAPIAGRGRLAAVRRRTWSRYTTATRLSKRS
FT                   Y"
FT   gene            328825..329229
FT                   /locus_tag="Nham_0296"
FT   CDS_pept        328825..329229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61192"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF5"
FT                   /protein_id="ABE61192.1"
FT                   /translation="MRVSIACIEKSRVLFFPVAPRTRVSVRLILERDEDIIIRHYGFQS
FT                   HVLVSRKPTVVIDEREEADGRGHVRVAKDKREIDNNIRLRAFMGKDAEWQFPHPSAANA
FT                   FIAELRQGFLKFKEFLVANGAPAQGDIFDV"
FT   gene            329222..332593
FT                   /locus_tag="Nham_0297"
FT   CDS_pept        329222..332593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61193"
FT                   /db_xref="GOA:Q1QRF4"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF4"
FT                   /protein_id="ABE61193.1"
FT                   /translation="MYRILIAALLSMLPISSYAAKGYFTELPSGQWLVFTPEQVGRYAK
FT                   ADREYCAVALKRGIEQNARLNNEPQDCLEGVAFGPAVGEGPVLTLGAGFDSRIPGLRTR
FT                   LSVPSWVGQHDALVLDEYVSSALELYQWAHGLPETGTLDAVTVGTLDRNVRTTSVPNDQ
FT                   QALTNIEPQPAPESELAETQTETRTPLLEKSTAAPLPMQAGPMIAPQVPPSTAMIDLRS
FT                   LSQFLFALTILFLVFRGRLAIDWALNVGGPRVASAARSPRVKSFLLRAWDALNRIYAFL
FT                   KGSPVVPKAVGVAGGLIAYFFNEPRRLAAWGLVIWFALSVLLSLSIGNAPGLFGWFIVG
FT                   LFFLAQADYHFLILRGENRVLAYKKAARIIVFVIFPLFFTSLVLVGFLALGSPKQQGAG
FT                   VLAILIGLPTAILYFCFLRAYRDAEWASLCKYEKMYASAGDGFTSIDLAQRILSQLPST
FT                   SLRVEPVIEALKEELLGGMPEPPESRFDLHDHAAYRAMLEQLSFATPEAEDLFVEMVVA
FT                   ALMTIVPKFPKPAGAPMFTTRMEDPLSAVCDFMQCLIHPRAVQLRVLERLRTAFNRNVG
FT                   ELQARKAGLTIDAALELALKDTPLLDLFRSHLPYELEISDEFLYGGIHICAPPGGMKTQ
FT                   LTQTLVLHLAHYFNDPALIVVDSQGPILDLLERKFAPQLGASFLRIHPHKAPININPFD
FT                   VDFSGMTEAEQGSAITSVADFFVALFATGSSELSGKMKTLFDQVVRLFLVGIPAVQKRT
FT                   ATMRDLHDFMASSQPWAKYKAEIEYLDDDGRMFFDKHNISGYSDTRLQVHQRLYEVLRD
FT                   PAIRKMLCAERNELDLDRYLDGPGMVLVDTSGNLGFENAAFFGRLFILLAQQSMMRRIP
FT                   APTGDPYPAFLLCDEAHEYFKAEGVLRQFIYQGRKRRFGIVLTHHQYSQAPGALQDALE
FT                   HMAVHFTTRVAPNDMARLSGIFHAPPSFLQAQRPEPVKAPKLPKWIDYALYYPSLEHAI
FT                   SVRLAYGNLENFDTSNMYRGARNRSQQGNSGQQNSKQSQSPPPPRPDPVGSKDVEWNHT
FT                   ISPIKAKNGCTIADFKMPDGTLADIVIRPGTVDGTKLRFKGRSGQGGDFFLKIIVPPMP
FT                   EQSDREDMDMGAAPWP"
FT   sig_peptide     329222..329281
FT                   /locus_tag="Nham_0297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 20"
FT   gene            332707..333642
FT                   /locus_tag="Nham_0298"
FT   CDS_pept        332707..333642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61194"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF3"
FT                   /protein_id="ABE61194.1"
FT                   /translation="MSQATKRLNRWSDEPIRGKDGKPRAAKIVDTDYPVFERFNRYRDM
FT                   GTSFIVAFNKTNPIALQARLNLLSREPNRYLYRPLQQRNVPNENYKDQSYRVADKAVAL
FT                   MRKRSAWRDDIEPFGDSKFYPHSRMTNDAIQSLELFAPKMIWRHEIPKATNRLPVEVSC
FT                   TLPNGAFASAKFDYQNDSHGPFGINYGGSARFLSLESEHHGEVDANNLERPSFLKKFLA
FT                   IRYIAQHELYRTEWGLPHLLSLFVCTDQHEIDRRKAIVMRETGGKGASYVLFQVVPAVD
FT                   ESMTSVKPMPELYEGPWQRAGYPDFYLSQP"
FT   gene            334182..334670
FT                   /locus_tag="Nham_0299"
FT   CDS_pept        334182..334670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0299"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61195"
FT                   /db_xref="GOA:Q1QRF2"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF2"
FT                   /protein_id="ABE61195.1"
FT                   /translation="MPDILDLLVYEPTTGVLYKKHKLGRKHYSGYIICEIGGKHHAIHR
FT                   LIWQLERGPIPEGFFVDHIDGNRSNNRLDNLRLVTMEGNAHNMAMTSRNKSGRIGVCWA
FT                   PSQKTWFAYINVDKKLKILGRTKTKQEAINLREEAERKYGYHQNHGRRATPKDVALAA"
FT   gene            complement(334671..334883)
FT                   /locus_tag="Nham_0300"
FT   CDS_pept        complement(334671..334883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF1"
FT                   /protein_id="ABE61196.1"
FT                   /translation="MPNGNPPVVKFRLGSVTASVWQNEKHYNVTLAKSYKDGEEWKETD
FT                   SFGGGDLMNAVRVLQRAESFISDQH"
FT   gene            335082..335732
FT                   /locus_tag="Nham_0301"
FT   CDS_pept        335082..335732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61197"
FT                   /db_xref="GOA:Q1QRF0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRF0"
FT                   /protein_id="ABE61197.1"
FT                   /translation="MPFVDFAEIRERLSIEDAAEMLPVKWKSEGQQLRADCPVHGGERS
FT                   LIITPAKGLFVCKATTDAKKGGDCIALCAHVMQTTNFEAGQYLAQQIGTLARKSTVNSD
FT                   SNSTVSKERATVPQKREGGTASAQPAPNFDPVAFAAKLVFSEEVAALGFSEEDAEHFGV
FT                   GFYRGKVYAPLRHPTGEIACFYDYSNGTLKLPARARWLEESAPNVIPFGKKTA"
FT   gene            336851..337783
FT                   /locus_tag="Nham_0302"
FT   CDS_pept        336851..337783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61198"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE9"
FT                   /protein_id="ABE61198.1"
FT                   /translation="MKLQTIKCSDGYFLKDAVGLRFGKEDVTATWNREWFKVSSVEGRQ
FT                   VYRVTLATQRLSGYSLKPEFVATDAMPSSVGVDFFAYSDDKQNNAHLRGLYEPTYEPVP
FT                   EKAEPIEIELEIIATVDGELVQKAMNFPVYGTYSHEGKRWSVTEQSIQVSLLDRITAPS
FT                   LLHQEVPCQLSSEDSFKIIRTHVKDNIDPKVAAITSDYDFCLTVQKKIKLAEPEPYTRD
FT                   ANFSFFGRRRKPRMVTDYRTERKLVVYETAPLRGGEVYKGYTKTEPFTGHNVQELKQNI
FT                   EAYLKELMAEINKPLVDCPNCKGHGVMTA"
FT   gene            complement(337780..338496)
FT                   /locus_tag="Nham_0303"
FT   CDS_pept        complement(337780..338496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61199"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE8"
FT                   /protein_id="ABE61199.1"
FT                   /translation="MRQVHFRASRAYPLVSANKEARVSYTVIKTIKGRQYYYEQTARYR
FT                   NGKRTPLMRYIGPVDPKRQRKRIALSDIFRALFEVGGYVAVKGTKRPDYKVKDIESGRT
FT                   CQMRQANLKALYKQYGVDLSSPQAFSATSAHLSQAQRQELMHKVLAAGRAARAPKAPEA
FT                   KFDWSGLEAKMAANKAARQTAQDAPGRTQEAPAKNFTVDDEIEAREAKFEAAVDEYNAG
FT                   TTAAPDAPAPDDAPES"
FT   gene            338590..338937
FT                   /locus_tag="Nham_0304"
FT   CDS_pept        338590..338937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61200"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE7"
FT                   /protein_id="ABE61200.1"
FT                   /translation="MSHKIELRLETFVCGLFIIQPRHNEADFETLIGEFLAPSVKRQFT
FT                   EAYHDLEGSKGGCFCRDDQTPWVIVAFGSDPDTIRRTTLHEVVHLAEKLTCTREMRARF
FT                   VEHVYFALRLP"
FT   gene            339098..339466
FT                   /locus_tag="Nham_0305"
FT   CDS_pept        339098..339466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61201"
FT                   /db_xref="InterPro:IPR010024"
FT                   /db_xref="InterPro:IPR019096"
FT                   /db_xref="InterPro:IPR023385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE6"
FT                   /protein_id="ABE61201.1"
FT                   /translation="MINVCTLEMMIDTDERYISKSEGWYGENNRIEFSLSDVKPMQFTG
FT                   LRDKNGTEIYEGDIIHCTAGMHTLERNFQTDEKKVITFDDGAFRYDGITLGDMVNAHMS
FT                   DYTFEIIGNIYENPELLK"
FT   gene            339511..340377
FT                   /locus_tag="Nham_0306"
FT   CDS_pept        339511..340377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0306"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61202"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE5"
FT                   /protein_id="ABE61202.1"
FT                   /translation="MGVQQLYEQVTRTIISEIEAGNLPPWLQPWKAGKRGGIIPINAVT
FT                   KKSYNGLNVLMLWAERQEKQYALAEWLTYKQCQEAGGQVRKGEKSTPGIYVNKQVIEKG
FT                   TEEERLVPFMRQFALFNVAQCDGLPQNEPIADLPEHERNEQAEAFFAAIGATTRWGEPK
FT                   AAYSPSLDIIVMPERGAFLNPESLYATWAHEHIHLTGHKSRLDRDLKSRFDQDAYAFEE
FT                   LVAEIGAAMTCAHLQVKGELRHASYVDHWLRVLKQDSRAILSAASMASKATDYLRAFSE
FT                   TKQEEAA"
FT   gene            340648..340911
FT                   /locus_tag="Nham_0307"
FT   CDS_pept        340648..340911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61203"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE4"
FT                   /protein_id="ABE61203.1"
FT                   /translation="MEKEWPTGGGYYSSYEKEGEDIAAEFGLTLNDQAVWSDRFFNHLD
FT                   VANWHKPPTLDVVIERAAGFKKEHPLCPYSSHWLVEDFARRL"
FT   gene            340991..341329
FT                   /locus_tag="Nham_0308"
FT   CDS_pept        340991..341329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0308"
FT                   /product="endodeoxyribonuclease RusA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61204"
FT                   /db_xref="GOA:Q1QRE3"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE3"
FT                   /protein_id="ABE61204.1"
FT                   /translation="MLSIILEGQPVSVNQLYRGRRFLTTDGKRTKLLNAVSARKQYRGA
FT                   PLEGPVCVELQVYFKSKASSDIDNVCKAALDSLTGILWKDDRQIQELHAYKLQDKLRPR
FT                   IELTLSQL"
FT   gene            341665..342351
FT                   /locus_tag="Nham_0309"
FT   CDS_pept        341665..342351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61205"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE2"
FT                   /protein_id="ABE61205.1"
FT                   /translation="MTGPELETFCEEINGGASIGATVLFQFINLAKAMVEQTRPWVALL
FT                   YTDTSKTVATGNTWQTAIDLSTVARFNRFYGETPIKVFDGNNSFQRYRQVPFNERLLYR
FT                   NTPGTFVYDEANKTLYLNGTVQFAGTLYIDHIKDSPEITNDDSSSWIFPSWAHPLLGFY
FT                   AVAINKGGVDYDDINARMAPENRAQAKVITDRLEWLDNEKQLQAQQNIDPYQSDDAWRP
FT                   GAIYIS"
FT   gene            342348..342707
FT                   /locus_tag="Nham_0310"
FT   CDS_pept        342348..342707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61206"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE1"
FT                   /protein_id="ABE61206.1"
FT                   /translation="MKKILVPIFTEEYKIWVYIGSRAELVKAAAKYIGETEAKFDKEFV
FT                   GRGQALDYIDKGLYPLIIVDGRLPVRTALATLAHEASHSMDSLERYIGIKDKHGEFRAH
FT                   GIAAVVRTVSKHLQK"
FT   gene            342710..344599
FT                   /locus_tag="Nham_0311"
FT   CDS_pept        342710..344599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRE0"
FT                   /protein_id="ABE61207.1"
FT                   /translation="MRIPDYTVSQFSGLNTFIKDLKTLKPGVATDSLNWVTGKYGDHIE
FT                   LRRGSALLGNTRVNGAGKITGLGVGTRYDGVQVPFWSRGRKLEYYNAATDDRAEVGSDI
FT                   LPVTADGEDCWFSPYANLAGSMMYAGSPNSGIYKIPVANPGSAVDQLVNNFRFGILRFG
FT                   QGRAFAGQRNGTTAGNLDKTGLYLSDIDKANLSLYTQTTAEAVGSSGGTHYAGTLAVVT
FT                   GKKTCMYVAVKEAGGETLTDDRNGTLVGTQGSLGTINYATGAYDVTFNHATAGAVTADY
FT                   YTEDATSDGPLDFDTSSTGAGKAKIFRQDDGGAFMAVLPFLDVEYAFHLLKTYAVTTTI
FT                   DDTSATNLPYRNIGIPNPRAAKETPDGILCIDVSNPSDPKVRRLEIGQNTNNLTIVPTS
FT                   IFDAVDLSAHAFDYAVAFRWGDYEIVCCQELTNGMANAYNSVMYVRNVYSHAIDKLDFR
FT                   ASCLDIFNGALIGGDPISSNVYTLFSGFDDDEAAIENYWQDGQLNLGTDRLKRAHYMRV
FT                   TGHIMKDQSINVSLVLDDGQPVEAFTIEGDGDYVDQGINTPIGSYTIGSKVVGGRGEAT
FT                   AHPFDVTFPIHTDRFQNISVRFRAMGIGHAAVNSYSYRDIRDKGSRSLPIKTI"
FT   gene            complement(344586..344912)
FT                   /locus_tag="Nham_0312"
FT   CDS_pept        complement(344586..344912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0312"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61208"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD9"
FT                   /protein_id="ABE61208.1"
FT                   /translation="MDVLKQEFQVELFNAYKRAKDEAKYHATIFIQMLTDRGGLETAKF
FT                   LINSPKVSDGYTALYERERLDLTVEAIVAENSKWHPLFTTEEIDRCHKRLAQYGYTPRL
FT                   SKSS"
FT   gene            344959..346329
FT                   /locus_tag="Nham_0313"
FT   CDS_pept        344959..346329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61209"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD8"
FT                   /protein_id="ABE61209.1"
FT                   /translation="MLHAIASAFIGVATFISSLFGAAPATGPSLGAALPSGTAVFETSL
FT                   QSRISSTDTSLTLVSNSVRGGSALSGYNCFTVDEGRTDAEYVCGTISGTSVTSLTRGID
FT                   PATGTSTNSTLKFAHRVGSDVKITDFPLLQILRNQANGADAYEHALTYAAGVTPANTGD
FT                   LTDKEYVDGVAFSGAGVIDASTIAKGVVELATGAEAAASTASGGSGPLALPASLATSTY
FT                   NSATAGNVVPVTDAATKAIDQNFLPATTTKVFQFASSTYIGFFPAYTIGKNSQIFTSTG
FT                   TSTFAVPSGITKVQVQVQGAGGGSDLAGSGAGGTCIKTVDVSATTSVQVFVGAGGAAGT
FT                   SGGTGTAGGWSTFGTNGFYCSANGGSGSGTASSPGSGGAATSGDLNITGQAGSPVFDGA
FT                   TARGGDGGSSMLGFGGRGVAATSGANPGTGYGSGAGGANAGNTGGTSGGNGIVIVRW"
FT   sig_peptide     344959..345054
FT                   /locus_tag="Nham_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.487 at
FT                   residue 32"
FT   gene            346336..347844
FT                   /locus_tag="Nham_0314"
FT   CDS_pept        346336..347844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61210"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD7"
FT                   /protein_id="ABE61210.1"
FT                   /translation="MPTATPYKNPDEASAGLGAAFAPTNDAQKAAIASAAAMVPGQNPV
FT                   VSPIQRTIDPGADAATKYLDTFQAPETADQIAERLRQGSQGSIDAINKVYDDQVNANNV
FT                   VGQERLAQDNAISVLSGLTGSTEAGRTRGAVLDKNDKETQAINNERLLKLQSLYSQISQ
FT                   QAIDQAQQQREDATKSANDIVTRRKDAQAQTLDTLKSIAAGGLVDFDSFKSSPQNAQVY
FT                   QHALDAVGGSEQALRGLFAVNRPQDQLVGTPTRVGDHFIQAYQNPITGKVSYDKVEVPG
FT                   GLPAQYNNFQKIGDSIVAIPDGWDGDTSKLKVIAGGSSDGSSGAPGDNPQLYAGLSTKT
FT                   ATAVRAQVAAFKTEPLVQNFGIIQEGRNFAGSLSNTTKNPADDQGLIYALAKALDPGSV
FT                   VREGEYATAQKYSQSWINAYGKGVSQAIMGTGFLSEQARRNIKDTIEARYKASLQSYTH
FT                   LEGQYQTGINNLTGRDDGAKFVRDYQTSSDSSGGSDSDPLGLGI"
FT   gene            347848..349305
FT                   /locus_tag="Nham_0315"
FT   CDS_pept        347848..349305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61211"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD6"
FT                   /protein_id="ABE61211.1"
FT                   /translation="MPTTQAQPQPSAKLSADQFAQSIKAKYPQYASVDNATLTQKMLAK
FT                   YPQYADKVDTAPAQKPGILPRIASDVSQSFNERSQNVAQSKADVQSGKQGLFHGLLQSA
FT                   GQAAGLVGDTLFAAGKEAVRSVAPSAIPAVKGVLTSIASSKPVQDIAKAGGDFAAKHPV
FT                   IAKDAAAIGNIASILPIGKIGQVAAKGAQVGLKAAGTAAAKTGERVIASQAAKTASRTT
FT                   ETAFRDALDISRPKMTSKLEQQAFNEGRVGKQGIFKPAAVAPSAQETRVAEALQPLVEE
FT                   GRVSPKFAPAKNREEINIEVSRINHEVEQHAHDPRFNQPFNETQLRTRLKAAKNDLSIV
FT                   FASDPTIERTYDAVADALVKSVGKKNIAGLFAARKSFDGIPAVKKLLDGLKGADGENLR
FT                   REVVLTVRGAANDLIGDYLPVYKDAMRRETSLLRASENIGTKIRGITQEGRAMSFLKTP
FT                   KGKLLKQAAIGAGVAGGAISGGEAILR"
FT   gene            349822..350184
FT                   /locus_tag="Nham_0316"
FT   CDS_pept        349822..350184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61212"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD5"
FT                   /protein_id="ABE61212.1"
FT                   /translation="MLQVATFLVPAEQDKANEFLKAHKPVGNINFNKDTIVVFYEDDPA
FT                   ADIVELLESVGNAKFQQGIALHMLKRDIAGLNPVHNKGKYEELDNAIRATQEAMDDQDA
FT                   KADYLKGLIEEKRAAK"
FT   gene            350187..350573
FT                   /locus_tag="Nham_0317"
FT   CDS_pept        350187..350573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61213"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD4"
FT                   /protein_id="ABE61213.1"
FT                   /translation="MARGTKENPTLKQQRAIQLLYTEVTRPTGKSIVQILKDAGYAEES
FT                   ARQWTNIMAGLRPHLKPALDWMEIHRQKVMAKMDEHLEYATYDELRKSLASLTEAIQLL
FT                   GGKPTANIAISAEVRHRIDELIED"
FT   gene            350726..352225
FT                   /locus_tag="Nham_0318"
FT   CDS_pept        350726..352225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0318"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61214"
FT                   /db_xref="GOA:Q1QGP4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QGP4"
FT                   /protein_id="ABE61214.1"
FT                   /translation="MLIVETIARIRREHFIKGKTIKEIARDLKVSRNTVRKVLRSGETS
FT                   FEYERAVQPRPKLGRWAADLDGLLASNAAKSAREQLTLIRVFEELRGRGYDGGYDAVRR
FT                   YARRWSQERGQSTAAAYVPLSFAPGEAYQFDWSHEVVLLHGVTVIVKVAHVRLCHSRML
FT                   FARAYPRETQEMVFDAHDRAFALFKGTCGRGIYDNMKTAVETIFVGKGRLYNRRFMQMC
FT                   SHYLVDPVACTPASGWEKGQVENQVGLVRERFFTPRLRFKTLDELNAWLLDKCIAYAKA
FT                   HRHPELTEQTVWEVFEAERPKLVPYAGRFDGFHAVPASVSKTCLVRFDNNKYSVTANAV
FT                   GRPVEVQAYADRIVIRQDGRIVAEHPRSFGRGETTYDPWHYVPVLARKPGALRNGAPFK
FT                   DWVLPAAIERVRRKLAGADDGNRQMVDILNAVLTDGLPAVEAACAEAIAHSVHSADVVL
FT                   NILARQREPAPPANILTPAALTLRHAPIADCARYDNLRRPV"
FT   gene            352225..353088
FT                   /locus_tag="Nham_0319"
FT   CDS_pept        352225..353088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0319"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61215"
FT                   /db_xref="GOA:Q1QGP5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QGP5"
FT                   /protein_id="ABE61215.1"
FT                   /translation="MERTQLFDLMSELKLYGMKAAFDEIMATAVKRQHEPQRIVGDLLN
FT                   AEINEKQARSIKYQLTIAKLPLAKDLDGFQFEGTPINQTLVNDLAGGGFIAQQRNAVLV
FT                   GGTGTGKTHLAIAIARSCIRSGARGRFYNVVDLVNRLEIETRNGRQGRIAEHLTRMDFI
FT                   VLDELGYLPFAQSGGQLLFHLVSRLYERTSIVVTTNLAFGEWPSVFGDAKMTTALLDRL
FT                   THHCDIVETGNDSWRFKSRDDDQTTRARSVSAIPASSDGPSATAKSRRSKGSNLDADTG
FT                   SNFGAD"
FT   gene            complement(353245..353643)
FT                   /locus_tag="Nham_0320"
FT   CDS_pept        complement(353245..353643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61216"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD1"
FT                   /protein_id="ABE61216.1"
FT                   /translation="MVFRAQIKDDGKFDFGSDYNLARFKAWCKEHPGKWVRIEEQVSVR
FT                   SLSQHNFYWVYLGFVSHETGHTPEELHEWAKKKFLPRKFATVFGEEVAVTPTTKTLTKL
FT                   AFGEYLERICAETGVPLPNPQEAGYLPH"
FT   gene            complement(353645..353869)
FT                   /locus_tag="Nham_0321"
FT   CDS_pept        complement(353645..353869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61217"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRD0"
FT                   /protein_id="ABE61217.1"
FT                   /translation="MKKFNVSVPRKYEKDGETKTAWGNVGKLVYFEATDSKEEGFILEL
FT                   NMFPDTKFGVFPDKPREEKSANEASIDLD"
FT   gene            complement(353870..354598)
FT                   /locus_tag="Nham_0322"
FT   CDS_pept        complement(353870..354598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61218"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC9"
FT                   /protein_id="ABE61218.1"
FT                   /translation="MDLKELKKKIPYQWRVQSYSKNKSSASCVAYIDVRDVMELLDEVC
FT                   GPENWQSDFRDVGGQVYGGVGIRQYRTIKGPSGDDMQLFDEESEWVWKWDTGSESNVEK
FT                   EKGQASDAFKRAAVKWGIGRFLYDLEIAHVKTDGPLTDSHKYPFVVDDSGNRVWDLTKH
FT                   MNNGSRTAPAAPKVSKPAVVSAAEAKEAALKKEIVDLCHVKSEIPLLTKEDIKAFILKA
FT                   TALEYGEAKNAEIIERLKVI"
FT   gene            355588..355890
FT                   /locus_tag="Nham_0323"
FT   CDS_pept        355588..355890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61219"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC8"
FT                   /protein_id="ABE61219.1"
FT                   /translation="MYVATQLLCIWHLGIVVVSRCEQRIARFCYAYATITLMKKMTKAE
FT                   AGRKGAIIRWSRISKKKRSEIMRRVAYARYETCEVCEFRAANIGYPSKCPKHSKL"
FT   gene            complement(356016..356792)
FT                   /locus_tag="Nham_0324"
FT   CDS_pept        complement(356016..356792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61220"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC7"
FT                   /protein_id="ABE61220.1"
FT                   /translation="MSEPKDFVSLQHFLFETPIYTPLKLQPGHFPRGDNLRGYCPHCKD
FT                   ESIFKVRFGNTPSIPSNEVMAEFQCKCVQNESHVLRFNLRIYRDTVEKCGQFPSYATIE
FT                   QGSIKGLRKLIPGEDGAELARAIGLASHGVGIGSFVYVRRIFERVIKRKFEELRDSENW
FT                   PVDALDGKRLDERIQLMKDHLPDFLVRNQKLYGILSLGIHELNEQDCLDFFTIAYSSIK
FT                   FILDEDRRKREEKAERAEAERAIAGYKPPISEAQAS"
FT   gene            complement(356920..358089)
FT                   /locus_tag="Nham_0325"
FT   CDS_pept        complement(356920..358089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0325"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61221"
FT                   /db_xref="GOA:Q1QRC6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC6"
FT                   /protein_id="ABE61221.1"
FT                   /translation="MPRPNPPRLTKDTDRHGNIRWYVRTLDGPKVRLRDEYGTPAFWQA
FT                   YRDVLAGNIKPPPPSTRIERKPFDKASLAWLCSQYYTSAEYKQLNERTRYVRRATLDHI
FT                   CAADGEKPYKLLLPKHIRARRDARADRPESANGMIKALRQVFAFAIENDYVALNPAQAV
FT                   PYLKAKGDGHHSWSLEEIEKFEKKHPIGTMARLALALLLYTGQRRSDVIVLGPALVREG
FT                   WLHFTQFKGREHKPITLDIPIIPELQRVIDATACGKDTYLLNGLGRPFTAAGFGNWFHD
FT                   RCKDAKVPGRAHGLRKAAASRLAELGSSEHEIMAITGHTTSKEVMRYTKAARQKVLAAA
FT                   AMARLKPKSEIAVTFPPETDPKSGGKKVPPKSLKNMEVTNLMVPGAEPH"
FT   gene            complement(358090..358329)
FT                   /locus_tag="Nham_0326"
FT   CDS_pept        complement(358090..358329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61222"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC5"
FT                   /protein_id="ABE61222.1"
FT                   /translation="MTTTHANDNQRGGIVPRGLRRVDAATYICISPSLFDDMVKDGRMP
FT                   SPRMINSRTVWDRFELDEAFEALPRKEAANPWDA"
FT   gene            complement(358338..358868)
FT                   /locus_tag="Nham_0327"
FT   CDS_pept        complement(358338..358868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61223"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC4"
FT                   /protein_id="ABE61223.1"
FT                   /translation="MSDFDLSYALQQTLEFRQRTAERHQNDGRNYTAIALIEKLLSETP
FT                   SADKLESLREAFEAYENEELLAVIDVDNPAPLNNTITGRLGSIGFTWHPAGIDEVVHGI
FT                   AMEARLARKAMEDARNEAVVSDVIAAMGAETKVFPKSKVDDAFEVMMERACERDAARQR
FT                   GETPPPPLSVKIG"
FT   gene            complement(358937..359347)
FT                   /locus_tag="Nham_0328"
FT   CDS_pept        complement(358937..359347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61224"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC3"
FT                   /protein_id="ABE61224.1"
FT                   /translation="MLALFRDLTTTFEAKENAGGNSDYDEYEAARNVAKTISFVRPVTA
FT                   MEALAQIVFLYDEATDIDQANEWTEARCKEWSDRMTRRAFALAYWIERTHAIDRREYAL
FT                   ANYCSDTLASSVLPHAPAESWHRGGANTKTLT"
FT   gene            359516..360127
FT                   /locus_tag="Nham_0329"
FT   CDS_pept        359516..360127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61225"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC2"
FT                   /protein_id="ABE61225.1"
FT                   /translation="MATEAEIYVATPKQLVEKIAEETGVPIGTAILHDRNLLTAGLRSE
FT                   GQRGRGKSVVTFEDAANLLIAVAGSRNVKDSAETVRLYAPLKATAPLVFNDQGKDIVRG
FT                   ETFGDALAALLEALPADRDSYRDPEHGSVEVTIYGPNPAARIIWKVGERGGTIDYRPPH
FT                   KRGAKRMFADLEFISKFTQVTIGHVGEMVAAEGSDPRPKN"
FT   gene            360182..361186
FT                   /locus_tag="Nham_0330"
FT   CDS_pept        360182..361186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0330"
FT                   /product="Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61226"
FT                   /db_xref="GOA:Q1QRC1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC1"
FT                   /protein_id="ABE61226.1"
FT                   /translation="MSNSDFIVLDVETANADYASICQIGLVEVVAGEVVSQEAILVNPD
FT                   DYFDGFNTSIHGITADHVCGAPLFHEVHAALSQRLSGSIIVHHGPFDRVSISRACERCG
FT                   IESFDVQWLDNQRVVRRVWEQFSKSGYALKSLAAFFGIEFQHHDALQDAIATNEIFRRA
FT                   LNESGTTAADWLSRIKQSLPTTAKTISGDGNPDGPFSGETIVFTGELNIPRSEAADIAK
FT                   RLGFRVEDGVTKRTTVLCAGVQDRTKTGGYDKSSKHRKAESLAGLGQDIRILSEGDFWA
FT                   IVPKPMRPNVKTERPPSERSNHRGQLIVSLSLEDLFTDEELQRMLTGMPLSDA"
FT   gene            361194..362111
FT                   /locus_tag="Nham_0331"
FT   CDS_pept        361194..362111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61227"
FT                   /db_xref="GOA:Q1QRC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRC0"
FT                   /protein_id="ABE61227.1"
FT                   /translation="MPHLSPARYDCDGGAMHRFRTPELFLGCFLTVAVFAAGMLFVQWP
FT                   YPHQPAYQISAPAAQAESKEKQAESNPAGWSDWLLKDAAGFFTFGLVAVGVGQALLFFI
FT                   QLSLMRKGMTDSTIGIRAARRSAVATVAQARVARDSAIKLQRPYIFVFGVTEFKPAQTA
FT                   FSIDYTVANYGTIPAILEEVFVGFVTSDTTAPELPSRIGDDHDLCTSPILEAGGVRRSL
FT                   TSIVPTGMDSKAPVNISDDAGGWYPARSEPDWVVPPGHEVFFRVVVRYRGPFSSGHETS
FT                   ATWLCERGRKRLIQRGGEDYNYNR"
FT   gene            complement(362135..362470)
FT                   /locus_tag="Nham_0332"
FT   CDS_pept        complement(362135..362470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61228"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB9"
FT                   /protein_id="ABE61228.1"
FT                   /translation="MTTAGELREKVELQALVTVPDGAGGSTQSWETVVTASAAIKVLKA
FT                   GEAVMQGRLATEQTLVVTLRWQPALADALTTWKLKNSRTGNLYGIKSITPDVRRAWVDI
FT                   LCQTDTL"
FT   gene            complement(362467..364095)
FT                   /locus_tag="Nham_0333"
FT   CDS_pept        complement(362467..364095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0333"
FT                   /product="phage Terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61229"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB8"
FT                   /protein_id="ABE61229.1"
FT                   /translation="MTAKSTFPEWIYDGSEILDPFGYGERAVTFLRRLKHPKSTLPGKA
FT                   FQLDPWQERIVRRIYGPRHDDGRRIVNTVVMLLPRGNRKTSLGAALALLHTIGPERMPG
FT                   SEVIFSASDRKQSGIAFKEARGIVQADKRLVKATKVYDAFNSAKKIAYPKDSVELEIIS
FT                   ADAPSSEGRTPAFVLADETHIWRGKDLWTVLTNGLDKIDNSLLVVTTTAGRGTDNIGYE
FT                   IIDRARKIARGEIVDPTVLPVLFEAEPDCDYTSEEVWRRVNPGSPHGYPSIEGFRRHVK
FT                   RAQDNPTERSSLKRYKLNIWEDSSSSPFVDMLVYDEGEGEIDVAALEGQPCWLGVDLSS
FT                   SIDLSVVIACFRDGDDYVVQPHFFCPQDNLRQRQEATGAPYIEWARKGLITATPGNVID
FT                   FRVVEERIRELCQTYSVQEIACDPAMARNLLNNLLEDGLPAIEHRQGSLSMMPAIAELQ
FT                   RAIIGRKFKHGGHPVLRFCFANVEAETNAAGHIVRFTKQKKWLSIDGAQASAMSVNRAS
FT                   AGGSAATTSLYDDPEWETALQGFNA"
FT   gene            complement(364098..364511)
FT                   /locus_tag="Nham_0334"
FT   CDS_pept        complement(364098..364511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0334"
FT                   /product="phage terminase, small subunit, putative, P27"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61230"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB7"
FT                   /protein_id="ABE61230.1"
FT                   /translation="MKHTAGRKATPQPIADAIRTVPQPPKHFPPAAKAEWKRVMPVLVE
FT                   RRVISVADLHAVERFCEAAADIVDARAAIAQYGAYVENRLGELKRNPAFATLREATGES
FT                   RRWAAELGLSPSSRSRAGVHEDQDADDDSPLSM"
FT   gene            complement(365205..365558)
FT                   /locus_tag="Nham_0335"
FT   CDS_pept        complement(365205..365558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0335"
FT                   /product="HNH nuclease / phage PHI-105 holin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61231"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB6"
FT                   /protein_id="ABE61231.1"
FT                   /translation="MPFAAPRLCTCGRVVPAGKRCECSIKRKAERDKLRPAAPQRGYDA
FT                   EWRRLSKAYLAEPGNDVCADCGRPAVLVAHRVSIRKAPHLRLVRSNWKPSCIACNNRQN
FT                   IACEGGFGRPIKQ"
FT   gene            complement(365784..366170)
FT                   /locus_tag="Nham_0336"
FT   CDS_pept        complement(365784..366170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61232"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB5"
FT                   /protein_id="ABE61232.1"
FT                   /translation="MRDIANNIGVDQTLSPVDYAATTKGTAVDLQGFNSAAVIVNTGAI
FT                   TTAGLYVVKVQESDTTTDGDFTDVVAGDLVGTLPASLAATSTYKQGYIGNKRYIRAVIT
FT                   KTSGTSIVAGAIVVKGNAADKPVA"
FT   gene            complement(366230..367378)
FT                   /locus_tag="Nham_0337"
FT   CDS_pept        complement(366230..367378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0337"
FT                   /product="phage major capsid protein, HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61233"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QLS4"
FT                   /protein_id="ABE61233.1"
FT                   /translation="MTFHFLETKSAADVDEGDPSIVEVKSALTALTEDVKKATAPVADL
FT                   TKRLDEIETKINRPAIHTEKKDEISDERKAFTGYLRRGKETLQPDEIKSLRVADDTSGG
FT                   YLAPAEFSAEVVKGIVEMSPIRQAARVGSTSSGEVLLPKRTGRPTGSWVGETDARPGTE
FT                   SSYGQIEVPIHEMACYVDVSQRLLEDAAVNVESEVASDLSEEFGRLEGLGFSQGDGVKK
FT                   PIGIMEAAGVAYTATGNASTLGTAPADTLIDVFYSLPAYYRNRGVWLMNSKTIAAVRKL
FT                   KDGSTGAYLWQPGLAQGDPATILGRPLIEDPTMDDIGSAAEPILFGSVSDAYRIYDRLN
FT                   LSIMRDPYSQATSGVVRFHARRRTGGALVLADALRKIKCATS"
FT   gene            complement(367386..367919)
FT                   /locus_tag="Nham_0338"
FT   CDS_pept        complement(367386..367919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0338"
FT                   /product="prohead peptidase, Unknown type peptidase, MEROPS
FT                   family U35"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61234"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB3"
FT                   /protein_id="ABE61234.1"
FT                   /translation="MKNLETGVVQLDVKSVGDDGVFSGYASLFGITDLGRDIVTRGAFT
FT                   KSLKQKSASRVKMLREHDQTEPIGVWTEIVEDTKGLRVSGRLVLDTVKGRETHALLKAG
FT                   ALDGLSIGYRTKSARFDKAKGTRMLDEVELHEISVVTFPMLPSATVEAVKSNGPTTFRA
FT                   LVDAINSARTSINS"
FT   gene            complement(367916..369139)
FT                   /locus_tag="Nham_0339"
FT   CDS_pept        complement(367916..369139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0339"
FT                   /product="Phage portal protein, HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61235"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB2"
FT                   /protein_id="ABE61235.1"
FT                   /translation="MGWFSRKSAPVAEVKSELTDCTSDSWAALCDAFAISASGVTVTVD
FT                   ALMRCPPAEAAVSITSNSTAGVSCRLLQDDADDSERAAKQHPAYQLVHGFSNEWMSAGE
FT                   IRRRVTLDAIIFGDGFALVTRTADRPAEILYVPRQVVVLEYKPDGEPVYRIDGREYGPA
FT                   DVIHLQTPNPSNPLQQRGLGLLHTGRDAIGLAILLERSASQLFKNNSRPGGVLSFKGSL
FT                   NPVAAGRIAQMWRSAHGGDKSGGIAVIDNEGKYEPIAFSSVDSQAIEQRAFVVSEISRL
FT                   TRVPATLLSDMSRATWSNSVQLDLQFVKYGLQPWLRAWCDAYARTLLTPEERATMHFEF
FT                   DLSQLLMADPAARATAFGQYRSAGVMTANDVRRELNLPPLPDGDVLASPHVQSPANDNT
FT                   QPPKDQAA"
FT   gene            complement(369340..369606)
FT                   /locus_tag="Nham_0340"
FT   CDS_pept        complement(369340..369606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB1"
FT                   /protein_id="ABE61236.1"
FT                   /translation="MRHPHLLEIPMTIKVNSPAAYNGRLVKVASISGAEAEVVWIGRDG
FT                   EIEVRDVWVGELVSFDDAMNPQTSWSAASALEHESKIRAWRAE"
FT   gene            complement(369585..370481)
FT                   /locus_tag="Nham_0341"
FT   CDS_pept        complement(369585..370481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRB0"
FT                   /protein_id="ABE61237.1"
FT                   /translation="MKAAIASGMSDRQATLTVPGAPSDAAWSRYLQNRPERAAEIAEVR
FT                   HAKGKPSFDRIAANFDALIKLIGEGHSAVTAGRELGINGDRLTEYLLAHPQKRPAYVAA
FT                   MVKRAKVLGIRSTTIKGMPRRKDFTEAEFDAALALIARSTAPDLATALRRADLPRNGSL
FT                   QRRARKDPAFRGRLDRAYSAHGASTHYLRYIKDPTEPRMLLASLLADKDFAAGFNRFKS
FT                   QRYDRHDLAQEYCLAVLEGRLSKADLKKNKAMNDIRKRALGNSLAFTSLDAPSHGDGDS
FT                   RYSVGDTIASPCGIHTY"
FT   gene            complement(370827..371612)
FT                   /locus_tag="Nham_0342"
FT   CDS_pept        complement(370827..371612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61238"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA9"
FT                   /protein_id="ABE61238.1"
FT                   /translation="MQHANDNTPRTPEQHRAYVASLRQDDDETEVRARARHWPTFGRLK
FT                   RADRWLEIQTLERYADDEGIAMPEGNLHHANDNSPVNEDGRMEIGRVDSRLVDARLDEE
FT                   NPTADEIAAAAWADEKDRKEGRPEMATRIQFGAYGKIVAVKVRGRYRLLEETFSESRGA
FT                   EDEKASLGAGYGLKNELPDAQDEAARRMDHEAMKRRLGDETCRLVELACGDATSEEIGE
FT                   MHGTAGKTAERLGVRLVDIAIGKLMAAYAARDAADREAA"
FT   gene            complement(371760..373799)
FT                   /locus_tag="Nham_0343"
FT   CDS_pept        complement(371760..373799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0343"
FT                   /product="RecA-family ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61239"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039459"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA8"
FT                   /protein_id="ABE61239.1"
FT                   /translation="MNALQAKQTFTDPVRTHVEMLHDLAAGIDGVFVVSAYNVSLPKGG
FT                   GTITKHNVGDVNGMVEAIAAHSDTPGANVYTGLHLMKTGLARGKRGTRSDVVAVLGLVA
FT                   DMDADTGNAGNLPFEPSYIIETSPGNQQPVWLFDKPLTVTEAVPLAAALKRATGSDHGT
FT                   ADVDHVWRIPGTKNWPNEAKLKRGRSAEPAPVRYLHEWRGDLMNVDELRAALEPWASAP
FT                   ANEAKPVQLGELPDIDGVVASPKLAALLAADDVEDRSKHASRVVEQMMFDGHDVETAAA
FT                   LFLSASGNWSARYQGKGARDDFARMWGKFQKPDYSGLADGLLRKSDPPIAANDNEPKSR
FT                   FNLTWFDDIEADKPKAWVIKNVLGRGEHTLISGLPGTGKSVVATDGACHVAAGMEWFGR
FT                   KTTQGLVLFVAAERKALTERRMMAFRKHHGVKDVPLLVLGGRLDLTSSLADAKALAGIV
FT                   QQAEIDCGQKCVWIIIDTLTRVFGAGDQNTSKDMGRFIQACDELIRLTGAHVTVVHHTA
FT                   WSGERGKGAIDLDGAVDASFMVVKNSGTYTLKCDGANDGDEGTIATFTMQSVELAKDED
FT                   GEPTTAPVVVPGESLADRLALKGHTKGVLAALNSIIEDDGIEPEGSDFPEGIMVVKEKQ
FT                   WRAAYYEAESGASVETLKKRFGRAKKDLLAKGQVKQIGQWYWPS"
FT   gene            complement(374272..375360)
FT                   /locus_tag="Nham_0344"
FT   CDS_pept        complement(374272..375360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61240"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA7"
FT                   /protein_id="ABE61240.1"
FT                   /translation="MSVSAKISRRAFATGLAVVAFGRKVSLAQGFAGLGGEASGFAAVT
FT                   PGRSFVFPADHAPHPDYRIEWWYLTANLSDAEGRAYGAQWTLFRQAMQPGPQRDGWANQ
FT                   QIWMGHAAVTRADTHRYSETFARGGVGQAGAEADPFRAWIDSWQMRGLDGMSAMNIAPL
FT                   QINATGADFSYTLRLDADKALVLEGDAGYSRKSERGQASYYYSQPYFTADGTVTIDGKS
FT                   VSVSGQAWMDREWSSQPLAPDQTGWDWFSLHLGTGEKLMLFRLRQTDAKPSFAGNWIGP
FT                   DGQSVALSPESIEMTPIAMTEVADRKLPTSWRIAVRDRGLAIETLPLYARSWMGTSFSY
FT                   WEGPVSFTGTHRGIGYLEMTGY"
FT   sig_peptide     complement(375274..375360)
FT                   /locus_tag="Nham_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.912) with cleavage site probability 0.809 at
FT                   residue 29"
FT   gene            complement(375350..377809)
FT                   /locus_tag="Nham_0345"
FT   CDS_pept        complement(375350..377809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0345"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61241"
FT                   /db_xref="GOA:Q1QRA6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA6"
FT                   /protein_id="ABE61241.1"
FT                   /translation="MKQGFWILAVLLSHWRRHPLQLTTLMIGLISATALWSGVQALNQQ
FT                   ARISYDRAAAVFGGARIAMLVGQQDTFPQQLFVDLRRAGWPVSPVLEGRVRIHGKTFRL
FT                   LGIEPVTFPAEAGSIPAIGTSDLTSFIAPPGETLVAPETLTELTGTEGTALRTDDGALL
FT                   PPLKVQAQLAPGVVIVDIGVAQSLLHLPDQLSRLSIGKTRSTHAPLEAVTGDKLRYVAP
FT                   DAETDLERLTDSFHLNLSAFGLLSFLVGLFIVYSAIGLAFEQRMPMLRTLRACGASSRM
FT                   LNGVLLIELLVLALAAGLIGLACGYLIAAALLPNVAASLQGLYGARLPGQLTLRPEWWA
FT                   AGLAMSALGTLVAATTSLLRVVRLPVLAMAQPYAWQQAQRRWLRWQGLCAVAMLVTAVA
FT                   VLTIGDSLVSGFAVLAALLLGAALTLPVLLGFVLHAGERSTRRPLVMWFWADSRQQLPG
FT                   LSLALMALLLALAVNVGVGTMVESFSKTFATWLDGRLAADVYVNARDDAQARDIETRLR
FT                   ARPEVTAILPSGRAETEIGGWPVEVLGLADHATYRDRWPLLRSQANAWDEVKSGQAALI
FT                   SEQLARKLKLRLGDRLTISTPGGNWPVDIAAIYADYGNPKGQIAVNIVAFTSRFPDLPR
FT                   TRFGLRVTPGKIAPLIDDMRKTFHLDESRLSDQSTLKAESTRIFNRTFAVTAALNTFTL
FT                   GVAGVALLTSLLTLSNSRLPQLAPLWALGLTRRQLAGIELLKTLSVAFVTAMLALPLGL
FT                   LVAWCLIAVVNVRAFGWRLPFHVFPLHLIELLGVAMLASLLAMLVPVLKLMRMPPATLI
FT                   KVFADER"
FT   sig_peptide     complement(377684..377809)
FT                   /locus_tag="Nham_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.848) with cleavage site probability 0.630 at
FT                   residue 42"
FT   gene            complement(377806..378489)
FT                   /locus_tag="Nham_0346"
FT   CDS_pept        complement(377806..378489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0346"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61242"
FT                   /db_xref="GOA:Q1QRA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA5"
FT                   /protein_id="ABE61242.1"
FT                   /translation="MCVPTPSKAPMLDVQNLTKTYRSAQERITVLRGACLRVDAGESVA
FT                   LTGESGSGKSTLLHLIAGLDQADGGSIRLNETEVTALADRGRAALRRDRLGLVFQQFNL
FT                   IPSLTVADNLAFQSRIAGRHNSQWQSELVDRLGLGDLLNRYPEQLSGGQQQRVAIGRAL
FT                   AVRPPLLLADEPTGNLDEATADEVMDLARDLIKRTGCSFLMVTHSARLAATLDRQVLLS
FT                   AGLIS"
FT   gene            complement(378592..379356)
FT                   /locus_tag="Nham_0347"
FT   CDS_pept        complement(378592..379356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0347"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61243"
FT                   /db_xref="GOA:Q1QRA4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA4"
FT                   /protein_id="ABE61243.1"
FT                   /translation="MMLDYVTYIVLAVVVIAFLSSSIRILREYERGIIFTLGRFTGVKG
FT                   PGLIILIPFVQQMVKADLRVMVQDVPPQDVISRDNVSVKVNAVLYFRIIDPERAIIKVE
FT                   NFMAATSQLAQTTLRSVLGKHELDEMLAERDKLNAAIQEILDQQTDAWGIKVTNIEIKD
FT                   IDLNENMVRAIAKQAEAERLRRAKVINAMGEQQAAEKLVEAGRILAQEPQAMQLRYFAA
FT                   LHDIAGERSSTVVFPLPMDLLSHLKPRPDGTS"
FT   gene            complement(379353..380750)
FT                   /locus_tag="Nham_0348"
FT   CDS_pept        complement(379353..380750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0348"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61244"
FT                   /db_xref="GOA:Q1QRA3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA3"
FT                   /protein_id="ABE61244.1"
FT                   /translation="MQAVQATLAVALAAAALVFSPLPASTEENGKLVLTIAIDGAIGPA
FT                   TTGYVKDALAKARERHAEAVILRLNTPGGLASSMREIIADVLASPVPVIGYVAPSGAHA
FT                   ASAGTYILYATHIAAMAPGTNLGAATPVQIGSPVPGLPGIPDKGDKDKKNGSQQPEPTD
FT                   AMTAKVTNDAVAFIRSLAELRGRNADWAEKAVREAASLSASAALQAGVVELIARSPAEL
FT                   LRKVDGRTVDLVNGDRRHLATKDATIETIDPGWVSQFLSIITDPNVALILLLVGTYGLL
FT                   FEFMSPGAVAPGVVGTICLLLGLYALNLLPISYAGLGLMMLGIALLTIEAFNPTVVLGL
FT                   GGVIAFVLGALMLFRNEASGYRLSWTFVGIVASMFTGLVLIVLGSLRRARKGPAQVGAQ
FT                   AMRGLPAEVLDWNDIEGHVFTQGERWQARSTEAFKPGDTVEVASITDLTLTVRRRPALR
FT                   GGEGGVR"
FT   sig_peptide     complement(380670..380750)
FT                   /locus_tag="Nham_0348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            381121..383289
FT                   /locus_tag="Nham_0349"
FT   CDS_pept        381121..383289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0349"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61245"
FT                   /db_xref="GOA:Q1QRA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA2"
FT                   /protein_id="ABE61245.1"
FT                   /translation="MEHGQSHRAVQSERHAAVRLLKALMVASVLLPMALFAITAWVDYR
FT                   NFERITNERIDRSLDILHEHSLKVLETTERAYAEVNEVVRGMSDNDIRLNEAALNKRLK
FT                   QIVTGTPQMQGIEIIDRDGHPLVSSNGLLTPGDIDFSKAEYFTALKSREGGTYVSTINA
FT                   PRPGVPGYFISLSQRRPWDDGTFNGVISIAVPTSYFENFYAHISDTVDYFALVRADGHF
FT                   LARYPVVSPASLLSFDDDKDFRTRIAHGHDYSIYTAESPYDHITRRIGYRKIAGYPLYV
FT                   LVGVEWKAIVSEWLRYNINYLIFGAPLMVFLFAVLGLALRRTQRLYDESERREAVENAL
FT                   RHAQRMEAIGQLTGGVAHDFNNLLMIISGSVQRLRRELTDKKSLRLLDMIGTATHRGET
FT                   LTRHLLTYSRRQTLTPEVIDLAQRLPVLRELLTRSLRTDIEINVEVPDTVCAVRVDPSE
FT                   FELAILNLAVNAKDAMPNGGALSMSARPVTLKGDASEEGLSGDFVAVYVADTGQGIPAD
FT                   VMMRVFEPFFTTKDVSKGTGLGLSQVYGFAKQSGGTATVTSTEGQGTTVTLYLPRSLEQ
FT                   PQPAEPPLQAPAQAEAAGTVLLVEDDVDVADVGASYMRQLGYRVRSVADVQAALAALQV
FT                   DAQVDLVFSDIMMPGGRNGLDLAREIGERFPHIPVLLTTGYSASAQDAARYGVVVLQKP
FT                   YDLESLRRHVREAMEQARVPPAALGVAG"
FT   gene            383484..384362
FT                   /locus_tag="Nham_0350"
FT   CDS_pept        383484..384362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0350"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61246"
FT                   /db_xref="GOA:Q1QRA1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA1"
FT                   /protein_id="ABE61246.1"
FT                   /translation="MELLSNQILAGIATGAIYACMALALVMIYQAIGHLNFAQGEMAMF
FT                   STFMAWQMIQWGMPYWAAFVLTLMLSFIGGIVIERLLFRPLAKAPILTNLAGFLALFAI
FT                   VSSVAGLIWDFTIKPFPSPFGASPFLGSQLISTHQAGMIGVILLVLAILFFFFRFTRIG
FT                   LAMRAAAIQPESARLVGINTSWMIALGWGMAAAVGAVAGMLIAPVVFLEPNMMGGVLIY
FT                   GFAAAVLGGLSSPLGAVVGGFLVGIFENLVGTYIPGAGNELKLPLALALIVIVLVVKPS
FT                   GLFGHTVVRQV"
FT   sig_peptide     383484..383558
FT                   /locus_tag="Nham_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.725) with cleavage site probability 0.685 at
FT                   residue 25"
FT   gene            384365..385402
FT                   /locus_tag="Nham_0351"
FT   CDS_pept        384365..385402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0351"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61247"
FT                   /db_xref="GOA:Q1QRA0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QRA0"
FT                   /protein_id="ABE61247.1"
FT                   /translation="MSANRESAAGAPAVDTGSGQAVTLGTATSIVILLLLLAVPLFFKN
FT                   FIIFQLTTVLIYGIAVLALNILTGGSGQFSLGHSAFYALGAYTSAILIEHAGMNYALTL
FT                   PISGVVCFAMGFLFGLPALRLSGVYLALATFALAVATPQLLKLGVLEPWTGGVQGLTVD
FT                   KPDAPFGLPVSQDAWLYYFTLVVAIAIYIASVNLLSSRSGRAMMAIRDNEIAASAMGIN
FT                   VALYKTLAFGISAGITGIAGGLGAIAVQYVAPDSFTIQLAIALFLGMVVGGVGWLPGSI
FT                   VGAAFIVFIPNVAESVSKGLSGAVSGILLFVVIFLAPNGARQVALAFQAMIGGFKKNHG
FT                   GSNVC"
FT   gene            385392..386624
FT                   /locus_tag="Nham_0352"
FT   CDS_pept        385392..386624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0352"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61248"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR99"
FT                   /protein_id="ABE61248.1"
FT                   /translation="MSARQRLRTAALSAAIIAFAAASGSALAEGKYDSGASDTEIRIGS
FT                   TMPYSGPASAYGVIGKTEAAYFRMVNDKGGINGRKIDFISYDDAYSPPKAVEQTRKLIE
FT                   SDDVLFTFNALGTATQTAVQKYMNGKKAPQLFVASGASKWNDPKQFPWTMGWQPSYRVE
FT                   ARIFAKYILKTRPDARVAVFYANDDFGKDYVSGLKDIFGERWSSIVAAKESYENSEPSI
FT                   ASHIVRLKDSGADVLVNISTPKFAAQAIKKAAEIGWKPMQLLTNVSISSGAVMKPAGVE
FT                   ASEGVLSAGYLKDASDPQWVNDEDMKTFTAFVDKYMPGANLSDTHLIYGFAVAQTVEQV
FT                   LRQCGDDLTRENVMKQAASLKDFVPSTLMPGIRINTGAADFAPIEQLRMMQFKNGRWVF
FT                   FGDTIGAGTGG"
FT   sig_peptide     385392..385478
FT                   /locus_tag="Nham_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            complement(386729..387919)
FT                   /locus_tag="Nham_0353"
FT   CDS_pept        complement(386729..387919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR98"
FT                   /protein_id="ABE61249.1"
FT                   /translation="MRSQAIRRCNPIIVCALLLAPLTAISGITAAPATGAMAQAATPAA
FT                   IADYRRKLNAYQEARAAFEEEAGAYWNAIADKRRIRNARRRDHQPVTLDDYVLVQPPLY
FT                   DGPKQPVNPEPEEERPPRQRKYIPVVADLLKAAAEQFQFVPQRPASEMDFKRAYARLAR
FT                   AYGLTREQAVRIYSFETGGNGNHDMQSGLSASRPGSRAISTAIGYNQLLTTNSVELLAE
FT                   QGHDILRALGAKAARLSGSQRGAMERKIAVVRRMAAYARSVPDTWSAHEKLADTPKGWA
FT                   IHALVLDIDVGPLLQTHKLLTSIIFARNKGYTRPLTAAELEMMNLTGDGTGLDMVTMPQ
FT                   AMRERVPTANFFQRRGYERNPVAIRHNTVAKLLAVTDARMDSNSAKPGARELAAAF"
FT   sig_peptide     complement(387803..387919)
FT                   /locus_tag="Nham_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.668 at
FT                   residue 39"
FT   gene            388072..389154
FT                   /locus_tag="Nham_0354"
FT   CDS_pept        388072..389154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0354"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61250"
FT                   /db_xref="GOA:Q1QR97"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR97"
FT                   /protein_id="ABE61250.1"
FT                   /translation="MTPADASCLQSLKLRVVGSQDEIINAFYGRILSFPGFKEMIGQTC
FT                   EREKIDIGQLVAHINEVQFKHWQRFFDGRPDKAFKDFANRIGIAHEKCLLSSDLYVASS
FT                   AVILGNFLGLALDQHLDDAGQAATVKASLSAIVRMFFLDISHAISAYDNAAARTAFQHV
FT                   SEPLLNAFEVEVAGDLKSMAGAAEDLNRTVKNIVDVNLGNMQRCRDIVSSIEALTRNLA
FT                   DLAQTTRQIENFVKVITDVSRKTKLLALNAAIEAARSGEYGRGFKVVANEVKALTNEAE
FT                   KATRDVTRQASEIQDAIDHAIRQVSGSQRLVQEIDAGMTTESESIGAQSAAVSEISTTL
FT                   AAVSESARGLRERFKTLNAA"
FT   gene            complement(389203..389907)
FT                   /locus_tag="Nham_0355"
FT   CDS_pept        complement(389203..389907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0355"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61251"
FT                   /db_xref="GOA:Q1QR96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR96"
FT                   /protein_id="ABE61251.1"
FT                   /translation="MLDIRNLRAWYGQVQALRGLEFHLSEGSMTALLGANGAGKTTTLR
FT                   AICNMVRTTGTITFEGKPLEGLSTESIARLGIAHVPQGRGIFTTMTVEENLQLGAISRS
FT                   DKPGIISDIERMYGHFPVLKERHRQQAGTLSGGEQQMLAVARALMLRPRLILLDEPSFG
FT                   LAPLIVRDVFRILGKINREDKVTILVVEQNAQLALKLADTAYVIETGRIVMSGSAADIA
FT                   NNEGVRRSYLGY"
FT   gene            complement(389913..390785)
FT                   /locus_tag="Nham_0356"
FT   CDS_pept        complement(389913..390785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0356"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61252"
FT                   /db_xref="GOA:Q1QR95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR95"
FT                   /protein_id="ABE61252.1"
FT                   /translation="MSAFRTASGDARPPPEHCTPRGSPPVTKGQSAQRHAPLLAVRDLG
FT                   VVFGGIVALNGVSFDMYPGQILGLIGPNGAGKTTLFNCLSRLYQPSRGDILLEGVSILT
FT                   RPPHRIAEIGISRTFQNVALFPNLSVIDNVRVGTHSRTSSNIVSDSLKLGWVRRGEAAL
FT                   NHKVDEILGYLDLRDVAHTVVAGLPFVTQKRVELARALAAEPKILLLDEPAGGLNHEDV
FT                   HGLGDLIRRIRDERDMTVLLVEHHMGLVMSIADHVVALNFGRKLAEGTPSQVQSDPGVI
FT                   EAYLGRKDR"
FT   gene            391060..393183
FT                   /locus_tag="Nham_0357"
FT   CDS_pept        391060..393183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0357"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase / short chain
FT                   enoyl-CoA hydratase"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61253"
FT                   /db_xref="GOA:Q1QR94"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR94"
FT                   /protein_id="ABE61253.1"
FT                   /translation="MSEVVRLERHDGIAIVTVDSPPVNALGAAVRRGILECAQTAVADP
FT                   AVKAIVLACAGRTFIAGADITEFGKPTQPPALAEVVAALENSPKPTVAAIHGTALGGGL
FT                   EVALGCHFRVAVKDARLGLPEVKLGLLPGAGGTQRLPRAVGPELAVKMIVGGEPVGATE
FT                   ALKQGLIDAIVEGPASGGEAFACRVLAERRPLRRLRDDDSRLMAAKANRSIFTDAVAAV
FT                   TKRARGLEAPFAAAEAVGLSLDTPFDEALKQERELFLKLMNGDQSKAQRYAFFAEREAA
FT                   RVAGVPEGTKPRKVERVAIIGAGTMGGGIAMSFANAGIPVTLIEMGDESLKRGLGVMRK
FT                   NFEATAARGGIAADEPARRMGLVTGVVGLEHVKDADLVIEAVFETMAVKKEVFATLDKF
FT                   ARSGAVLASNTSYLNINEIASVTKRPQDVLGMHFFSPANVMKLCEIVRGAKTAPDVLVT
FT                   AVAVARRIAKVPVVVGVCDGFVGNRMLAARSRQADKLLFEGALPRQVDAVATRFGMPMG
FT                   PFAMDDLAGLDIGWRSRRDRGVKSEIADALCEAGRFGQKTGKGYYKYEGGSRAPLPDPD
FT                   VETLIVDACARLGLRRREIGDNEILERLVYPTVNEGARILEEGIAARPGDIDVVWLYGY
FT                   GWPIYRGGPMYYADQVGLRHIADRLSYYAEATNDPSLEPAPLLKRLAAEGRTFASPAAG
FT                   RKSTQTLATGGRR"
FT   gene            393180..394367
FT                   /locus_tag="Nham_0358"
FT   CDS_pept        393180..394367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0358"
FT                   /product="Acetyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61254"
FT                   /db_xref="GOA:Q1QR93"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR93"
FT                   /protein_id="ABE61254.1"
FT                   /translation="MTEAVIVSTARTPIGKAYRGALNATEGATLFGHAIGEAVARAKLD
FT                   PNEIEDVVMGAAMQQGATGGNIARKALLRAGLPVTVAGTTIDRQCASGLQAIALAARSV
FT                   LFDGVGIAVGGGGESISLVQNEHANTFHSQDPALLAIKSEVYMPMIDTAEVVAKRYNIS
FT                   REAQDEYALESQRRIAAAQQGGRFKDELAPISTRMAVVNKETREVSFKDVTLSQDEGPR
FT                   PDTTAQGLAGLKPVRGEGFTITAGNASQLSDGASATVIMSDKEAARRGLKPLGIFRGFV
FT                   AAGCEPDEMGIGPVFAVPRLLKRHGLKVDDIDLWELNEAFAVQVIYCRDRLGIDPQKLN
FT                   VDGGAIAVGHPYGMTGARLAGHALIEGRRRKARYAVVTMCVGGGMGAAGLFEVVQ"
FT   gene            complement(394509..394913)
FT                   /locus_tag="Nham_0359"
FT   CDS_pept        complement(394509..394913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR92"
FT                   /protein_id="ABE61255.1"
FT                   /translation="MRLAKIILAGSALTIVSAMASAQTTPAIKETPPPPGTQKGLVTVV
FT                   NRLDNTIAIRAEQDNKDGAKAPDKTKPDEAKPDDAKSDGAKAEGATTQFKIDHKLSETV
FT                   HAGDKVKFSVSEGGDPKTNTEKTITKIEAE"
FT   sig_peptide     complement(394845..394913)
FT                   /locus_tag="Nham_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 23"
FT   gene            395130..396641
FT                   /locus_tag="Nham_0360"
FT   CDS_pept        395130..396641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0360"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61256"
FT                   /db_xref="GOA:Q1QR91"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR91"
FT                   /protein_id="ABE61256.1"
FT                   /translation="MVTHVLAIDQGTTSSRAILFRADTSIAAIAQQEFPQHFPASGWVE
FT                   HEPEDIWTSTVATCREAMNKAGVTPKDIAAIGITNQRETTVVWDRATGQAMHRAVVWQD
FT                   RRTADICARLKAEGHEPAISAKTGLIVDPYFSGTKIAWILDSVPGARARASRGDLLFGT
FT                   VDCYLLWRLTGGKVHATDATNASRTLLFDIHTGQWDEELLKILRVPRAMLPEVKDSSAH
FT                   FGDSVADLFGAPISIRGIAGDQQAAVVGQACFAPGMIKSTYGTGCFALLNTGATPVASK
FT                   NKLLTTIAYQLNGKRTYALEGSIFVAGSAVQWLRDGLGLIKQASETGPLADRSDATQSV
FT                   YLVPAFVGMGAPYWNPNVRGALFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPD
FT                   AAAAHTVLRVDGGMTASDWTMQRLADLLDAPVDRPVIQETTALGAAYLAGLSAGVYPEP
FT                   SKFADNWRLERRFKPAMSAATRTRKLKGWAAAVRGVLASDGGEGR"
FT   gene            396748..397458
FT                   /locus_tag="Nham_0361"
FT   CDS_pept        396748..397458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0361"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61257"
FT                   /db_xref="GOA:Q1QR90"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR90"
FT                   /protein_id="ABE61257.1"
FT                   /translation="MLNRRLFCQCASLALFAGASSESARAEPAECAVFTPDRQKHISPN
FT                   EAIARLKAGNDRFVGGTTVNCDLMAQVRETAKKQAPFAAIVGCIDSRVPPELVFDQRIG
FT                   DVFCARIAGNFINDDIIGSLEFATEVSGARAIVVLGHSSCGAIKGAIDGVRLGHLTGAL
FT                   AHIRPAVSATKAVGKPSSKNDAFVRAVAETNARMAAVALTERSPILKALAAKGELHIAA
FT                   AMHDLATGRVSWLS"
FT   sig_peptide     396748..396828
FT                   /locus_tag="Nham_0361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 27"
FT   gene            complement(397546..397971)
FT                   /locus_tag="Nham_0362"
FT   CDS_pept        complement(397546..397971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0362"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61258"
FT                   /db_xref="GOA:Q1QR89"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR89"
FT                   /protein_id="ABE61258.1"
FT                   /translation="MDASSVAVALLHSSADAIIAADRDGNITFWNPGAVRIFGFTADEA
FT                   TGRSLDLIIPEKQRARHWAGYREVMRTGQSRYSGGDILAVPALRKDGRRISLEFTIVPV
FT                   KDAAGRMTGLVSVLRDVTARFEEIRELRRKAAAAPQT"
FT   gene            complement(397975..401760)
FT                   /locus_tag="Nham_0363"
FT   CDS_pept        complement(397975..401760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0363"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61259"
FT                   /db_xref="GOA:Q1QR88"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR88"
FT                   /protein_id="ABE61259.1"
FT                   /translation="MGTMIQALQFDEAAFRGERFKDFHRDVRGNNDLLILTQPKAIEDI
FT                   HAQYLRAGADLVAANTFSSTSIAQADYEMSDLAYELNREGAKLARAAAMRVSAEDGKPR
FT                   FVVGAIGPTNRTASISPDVANPGYRAVTFDDLRKAYGEQINGLLDGGADLLLVETIFDT
FT                   LNAKAALYAIAEIGEARGIDVPVMISGTITDKSGRLLSGQLPEAFWNSIRHAKPITVGF
FT                   NCALGAEDMRAHIADIGRVADTLVCAYPNAGLPNEFGQYDESPDYMARLVGEFAASGLV
FT                   NIVGGCCGTTPDHIAAIAAAVAPHTPRVIPAIEPRLRLSGLEPFTLTSDIPFVNVGERT
FT                   NVTGSARFRKLIKADDYAAALQVARDQVENGAQIIDVNMDEGLLDSEAAIVTFLNLVAS
FT                   EPDIARVPIMVDSSKFSVIEAGLKCIQGKPVVNSISMKEGEEKFIREATIARRHGAAVV
FT                   VMAFDEVGQADTFARKTEICKRAYDILVNRLDFPPEDIIFDPNIFAIATGLEEHNNYGV
FT                   DFIEATGWIRQNLPHAHISGGVSNLSFSFRGNEPVREAMHSVFLYHAIKAGMDMGIVNA
FT                   GQMIIYDDIDPELRQTCEDVILNRDAGASERLLQLAEKFRGAGKEAKEKDLSWREWPVE
FT                   KRLAHALVNGITEYIEEDTEAVRLTVERPLNVIEGPLMAGMNVVGDLFGDGKMFLPQVV
FT                   KSARVMKQAVAYLMPFMEEEKARNQAAGVASESSNSAGKIVLATVKGDVHDIGKNIVSI
FT                   VLQCNNYEVIDLGVMVPAAKIIETAKAEKADIVGLSGLITPSLDEMGHFAAELERQGLD
FT                   LPLLIGGATTSRVHTAVKIDPNYRNGPVVHVNDASRAVGVVASLMSPERREAYAAGVRA
FT                   EYAKISAAHFRAQQDKKRLPLAAARANAVPIDWSTYRPVKPTFLGTKAFADYPLEELVE
FT                   VIDWTPFFQVWELSGRYPAILDDKVVGETARALYDDARKMLDRIVKEKWFKASGVIGLW
FT                   PANRIGDDIAVYSDETRTTQIATYHTLRQQLEKREGRHNAALADFIAPQETGIADYIGG
FT                   FAVTAGIGEDEIAVRFKNANDDYSSILVKALADRLAEAFAERMHQRVRKEFWGYARDEA
FT                   LTNDQLIKEDYVGIRPAPGYPAQPDHTEKATLFRLLDATCSTGVELTESFAMWPGSSVS
FT                   GLYYSHPESQYFGVGKIERDQVEDYAARKGMEVAEIERWLASILNYIPGQSGKAAATPV
FT                   PAPTPANDASADVANHPPGCQCAVHLQLRKTKARAG"
FT   gene            complement(401985..402899)
FT                   /locus_tag="Nham_0364"
FT   CDS_pept        complement(401985..402899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0364"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61260"
FT                   /db_xref="GOA:Q1QR87"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR87"
FT                   /protein_id="ABE61260.1"
FT                   /translation="MTDASAPVHNGPAAQKRPAISFEFFPPKTEEMERNLWDTITRLTP
FT                   LAPNFVSVTYGAGGSTRERTHSTIARILSETELRPAAHLTCVGAARGEIDEIVSRYHDI
FT                   GVRHIVALRGDPPGGIGTAYSTHPDGYRSSADLVAGIKRQYGDIEVSVSAYPEKHPESR
FT                   DIDADIDVLKAKVDAGAARAITQVFFDNDLYLRYLDRVRARGIFIPIVPGIMPMHNFRQ
FT                   ARAFVTKAGTTVPSWLAEKFEGLDDDPETRKLVAATVAAGQVQKLAKRGVDTFHFYTMN
FT                   RADLVFTVCHLLGIRPDAAQKAA"
FT   gene            complement(403237..404097)
FT                   /locus_tag="Nham_0365"
FT   CDS_pept        complement(403237..404097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0365"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61261"
FT                   /db_xref="GOA:Q1QR86"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR86"
FT                   /protein_id="ABE61261.1"
FT                   /translation="MTKTMTIAFQGEPGANSHIAIAEAYPDAEPLPCATFEDALAAIAS
FT                   GEADLGMIPIENSVAGRVADIHYLLPQSGLFIVGEYFLPIRHQLMAPRGATLAGIKTVE
FT                   SHVHALGQCRRIIRKLGIRPIVSGDTAGAARIVAERGDRSCASIASRLAAQIHHLDILA
FT                   EDVEDEAHNTTRFVVLAREADWAKQGSGPLVTSFVFRVRNLPAALYKAMGGFATNGVNM
FT                   TKLESYMVDGNFFATQFYADVEGHPDDRGLAFALEELNFFSKEFRIVGVYPGHPFRATF
FT                   REQAD"
FT   gene            complement(404142..404297)
FT                   /locus_tag="Nham_0366"
FT   CDS_pept        complement(404142..404297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0366"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61262"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR85"
FT                   /protein_id="ABE61262.1"
FT                   /translation="MRRSGEKDIRAFIERHNENPRPYRWTKSADEILASVKRFCQKTQQ
FT                   TLCHEF"
FT   gene            complement(405242..405463)
FT                   /locus_tag="Nham_0367"
FT   CDS_pept        complement(405242..405463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0367"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61263"
FT                   /db_xref="GOA:Q1QR84"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR84"
FT                   /protein_id="ABE61263.1"
FT                   /translation="MVMEIYVATGTVKWFNATKGFGFIQPDSGGKDVFVHISAVERAGL
FT                   SSLNEGAKVSYEVVANRGKESAEDLRVG"
FT   gene            complement(405872..406249)
FT                   /locus_tag="Nham_0368"
FT   CDS_pept        complement(405872..406249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61264"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR83"
FT                   /protein_id="ABE61264.1"
FT                   /translation="MENGMTALTTISHGDALTLSSLEIAGLTGRAHRNVMRDIRSMLNA
FT                   LKIEPVGGETRFGSTYLDAKGQVRECFNLPKHERMDEIGSRPFHEWTPAELRGGLAGLP
FT                   AGGSGNQDQVWALLRGPEVPR"
FT   gene            complement(406390..406812)
FT                   /pseudo
FT                   /locus_tag="Nham_0369"
FT   gene            complement(406815..407066)
FT                   /locus_tag="Nham_0370"
FT   CDS_pept        complement(406815..407066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR82"
FT                   /protein_id="ABE61265.1"
FT                   /translation="MVNDEVAAKRGGREITQSERDWYDAADDAETVAADRFVSTAPATM
FT                   AGLAAAIAWLLEYDRQCTLDTSGQFLRTLAASPLLVGG"
FT   gene            407939..410801
FT                   /pseudo
FT                   /locus_tag="Nham_0371"
FT   gene            complement(411696..412349)
FT                   /pseudo
FT                   /locus_tag="Nham_0372"
FT   gene            412657..413339
FT                   /pseudo
FT                   /locus_tag="Nham_0373"
FT   gene            complement(413490..413918)
FT                   /locus_tag="Nham_0374"
FT   CDS_pept        complement(413490..413918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61266"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR81"
FT                   /protein_id="ABE61266.1"
FT                   /translation="MRMLWPRSMLFSIFLILVGLFTLVAAGALPWWDDHRAKAAVHRGE
FT                   AKMVEGPVNDWRLTRSRQARSKGSKVHYNYFEHFTVGGVAFHLTWGNLEAGFNNQGSDD
FT                   GKQHTRIADGDNVRIWYLPPDKLISTPRIVRFETAAAP"
FT   sig_peptide     complement(413835..413918)
FT                   /locus_tag="Nham_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.609 at
FT                   residue 28"
FT   gene            complement(414093..414652)
FT                   /pseudo
FT                   /locus_tag="Nham_0375"
FT   gene            complement(414838..415614)
FT                   /locus_tag="Nham_0376"
FT   CDS_pept        complement(414838..415614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0376"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61267"
FT                   /db_xref="GOA:Q1QR80"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR80"
FT                   /protein_id="ABE61267.1"
FT                   /translation="MTKTRTLVLIPARMAATRLPGKPLLDIGGLPMVVHVLRRAETAGI
FT                   GRVAVATDTPEIAAAVTAHGGEAIMTRADHPSGSDRVFEALDRLDPDGRIETIINLQGD
FT                   FPTIRPDIIRDVLKPLADPAVDIATLAAEIHSDEEATNPNVVKAVGSPVAPRRLRALYF
FT                   TRATAPHGDGPRYHHIGLYAYRRKALQRFVELPPSPLERQERLEQLRALEGGMRIDIMI
FT                   VDDVPRGVDTAADLETARRILASVPIPKLAYPRSNL"
FT   gene            415847..416401
FT                   /locus_tag="Nham_0377"
FT   CDS_pept        415847..416401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0377"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61268"
FT                   /db_xref="GOA:Q1QR79"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR79"
FT                   /protein_id="ABE61268.1"
FT                   /translation="MGVSDINKFLGVLLGTCIVLLVMNFVAQAIFAPVVPAKPGFKIDV
FT                   KVKQEPAAADKEAKPAAEVPIGKLLQTASAEEGAAAAKKCAACHTFEKGGPNRVGPNLY
FT                   GIVGEPRGQGRGFNFSAAMKAKGGTWTFDELNKFLTNPKGYIPGTAMSFAGVPKDSERA
FT                   DIIAYLNKNSDKPEPLPAASK"
FT   sig_peptide     415847..415936
FT                   /locus_tag="Nham_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.810) with cleavage site probability 0.722 at
FT                   residue 30"
FT   gene            416792..418771
FT                   /locus_tag="Nham_0378"
FT   CDS_pept        416792..418771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0378"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61269"
FT                   /db_xref="GOA:Q1QR78"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR78"
FT                   /protein_id="ABE61269.1"
FT                   /translation="MVFRQAAHTLADHALVPRPTARRKPALAFTRRRLLHGGALIAAAP
FT                   AIKVLTGASPIEAARAQAAPVDLKWRHGLSLFGDVKYPEGFKHFDYVNPDAPSGGAVRQ
FT                   IGLGTFDNFNPVVSGVKGSIALAVGLIYESLTLPSLDEVSTEYGALAESVAYPDDFSYV
FT                   VYRLRKEARWHDGKPVTPDDVIFSLDSLKMHHPQYAAYYRHVVKAEKTGERDVTFTFDA
FT                   PGNRELPQIVGQLMVLPKHWWEGTDDAGKRRDISATTLEPPLGSAAYRIKSFEAARSVT
FT                   LERVKDYWGLNSNFNVGRNNFDELRYDYFRDGTVALEAFKGGQVDWRTENSAKNWATAY
FT                   DFPAVKEGRVVLEEFPNRSSGVMQAFAPNIRREKFSDPRVRRALNFAFDFETMNQQLFF
FT                   GQYTRIASYFEGTELASSGLPEGRELEILEPVRAEVPPEVFTAPYSNPVGGSSEAVRAN
FT                   LREGMKLLKDAGYEVRGGKQVDGKTGAPFEIELLAEDPSFERVLLSYKPSLERMGITVS
FT                   IRTIDSTQYENRLRTWDFDMVVASWGESLSPGNEQREFWGSRAADMPGSRNIVGIKNPA
FT                   IDKLIERVIFATDRADLVAATHALDRVLLWNNYVVPQWTYSKVRTARWDRFGRPAEMPK
FT                   YGLSAFPALWWYDAGKAAKVGNRS"
FT   gene            418786..420672
FT                   /locus_tag="Nham_0379"
FT   CDS_pept        418786..420672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0379"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61270"
FT                   /db_xref="GOA:Q1QR77"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR77"
FT                   /protein_id="ABE61270.1"
FT                   /translation="MRQPSRRQVIGLGVGAASAAWFLPAIAAPAAGAETESQGESHGMS
FT                   AFGDLKYPADFHHFDYVNADAPKGGLFSTIPSSRAFNQSFQTFNSLNAFILKGDGAQGM
FT                   GMTFTSLMARAGDEPDAMYGLAAKSVRISADGLTYRFAMRPEARFHDGQKLTARDAAFS
FT                   LMVLKTKGHPLITQQMRDMVKAEAPDDTTLIVTFAPKRGRDVPPFVAGLPIFSQAYYTA
FT                   HPFEESTLDVPLGSGPYKVGRFESNRFIEFDRVKDWWGADLPVNRGSYNFDTVRFDFYR
FT                   DRDVAFEGFTGRSYLYREEFTSRIWNTRYDFPAMTEGRVKREQLPDETPSGAQGWFINT
FT                   RRDKFKDPRVREALDCAFDFEWTNKSIMYGAYVRTVSPFQNSDLMASGLPSPEEAALLE
FT                   PFRGKVPDEVFGMPFVPPVSDGSGQDRKLLRKAAQLLNDAGFHIKDGKRMTPRGEVFRV
FT                   EFLLDEPAFQAHHMPYIKNLGTLGIEATLRLVDPVQARARRDDFDFDMMIERFGFSTVP
FT                   GDSLRPFFSSRAARTKGSNNLAGISDPEVDSLMEQVIAADTRARLVFAARALDRVIRAG
FT                   RYWVPQWYSNAHRLAYWDLFGHPPNLPKYLGVMAPDIWWSSPAKPASSGQAK"
FT   sig_peptide     418786..418869
FT                   /locus_tag="Nham_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.786 at
FT                   residue 28"
FT   gene            420675..421784
FT                   /locus_tag="Nham_0380"
FT   CDS_pept        420675..421784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0380"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61271"
FT                   /db_xref="GOA:Q1QR76"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR76"
FT                   /protein_id="ABE61271.1"
FT                   /translation="MSAYIARRILLMIPTLLGILFVSFVVVQFAPGGPVERVIAQLSGA
FT                   DTGAMSRISGSSGGDFGARGQVGASSDAINSKYRGAQGLDPAFIKSLEKQFGFDKPAPE
FT                   RFLLMVWNFSRFDFGKSYFRDTTVIQLIKEKLPVSMSLGIWMTLLTYLISIPLGIRKAV
FT                   RDGSRFDTWTSAVIIVGFAIPGFLFAILLIILFAGGSFFSIFPLRGLTSDGWSQFPWYW
FT                   KILDYFWHLTLPIISMALGAFATMTLLTKNSFLDEIRKQYVMTARAKGCGERQVLYNHV
FT                   FRNAMLIVIAGFPGAFVHAFFSGSLLIETIFSLDGLGLLGFESVLNRDYPVVFGTLFIF
FT                   SLVGLAINLISDLTYMWIDPRIDFEAREV"
FT   sig_peptide     420675..420758
FT                   /locus_tag="Nham_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.750) with cleavage site probability 0.436 at
FT                   residue 28"
FT   gene            421790..422962
FT                   /locus_tag="Nham_0381"
FT   CDS_pept        421790..422962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0381"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61272"
FT                   /db_xref="GOA:Q1QR75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR75"
FT                   /protein_id="ABE61272.1"
FT                   /translation="MTSPKPIEAEAVSPLGEAVPPTRHSLRLSPLNRRRWQSFKSNRRG
FT                   YWSLWIFLILFFISLFAELIANDRPFLIRFDGHLYFPAFVTYPETAFGGDFETAADYRD
FT                   PYLQKLIANKGGTIVWPLIRYSYDTHNLDLPTPAPSKPTWLLTEAECKDVVQRKHLTGC
FT                   RDLEYNWLGTDDQGRDVVARLIYGFRISVLFGLCLTIVSSVIGIAAGGVQGYFGGWVDL
FT                   GFQRFIEVWTAIPSLYLLLILSSVLVPGFFVLLGILLLFSWVSLVGLVRAEFLRGRNFE
FT                   YIMAARALGVSNATIMFRHLLPNAMVATMTFLPFIVSSSVMTLTALDFLGFGLPPGSPS
FT                   LGEMLAQGKANVQAPWLGFTGFFALAIMLSLLIFIGEAVRDAFDPRKTFR"
FT   gene            422969..424600
FT                   /locus_tag="Nham_0382"
FT   CDS_pept        422969..424600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0382"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61273"
FT                   /db_xref="GOA:Q1QR74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR74"
FT                   /protein_id="ABE61273.1"
FT                   /translation="MGAIDQPLLDVRDLSVAFHHGSGPSVAVDRISFEIKRGECVALVG
FT                   ESGSGKSVSALSILKLLPYPAASHPSGNIRFKGRELLGMSEREIRSIRGNDISIIFQEP
FT                   MTSLNPLHTVEAQISEIMLLHGGVRGAAARQRTLELLTQVGIPDPETRLASYPHQLSGG
FT                   QRQRVMIAMALANEPDLLIADEPTTALDVTVQAQILALLADIRARLGMSLLFITHDLGI
FT                   VRRIADRVCVMNGGKIVEKGPVEQVFEEPRHPYTRELLAAEPKPDPAPPRPESPVVIAA
FT                   DDLKVWFPIRRGLLRKTVGHIKAVDGVTLKVRKGETLGVVGESGSGKTTLGLALLRLIS
FT                   SDGPIVFLSKNIQGLRFKAMRPFRRDMQIVFQDPFGALSPRMSVGDIVAEGLSVHQRSL
FT                   SDTEREARVVKALKDVGLDPATRFRYPHEFSGGQRQRISIARAVVLEPNFVVLDEPTSA
FT                   LDMLFQAQMVDLLRDLQRKRDLTYMFISHDLRVVASLASHLIVMRHGKVVEEGPASHLF
FT                   KNPKSDYTRALFAAAFRLETAPGESK"
FT   gene            complement(424602..425447)
FT                   /locus_tag="Nham_0383"
FT   CDS_pept        complement(424602..425447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0383"
FT                   /product="NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61274"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR73"
FT                   /protein_id="ABE61274.1"
FT                   /translation="MDDPRLTPARPEVAARYLEGTIEAARFADGEEWEVVDAVVPLRRQ
FT                   PLPDAMLDTQALRGERVTVYDHNSEGWAWGQLNGDGYVGWLPDRALARPGAAPTHKVIA
FT                   LRTFAFPGPSIKLQPAETLSLGARLTVQRHDGDFAVAAGHLHIPAVHVAPLDDIAVDFV
FT                   TVAEMFTGTPYLWGGKTSLGIDCSGLVQVALNASGIGCPRDSDMQERALGRTLSPVEAQ
FT                   QPRRGDLMFWKGHVAIVRDATTLVHANAHHMATAIERIDEAITRIKAAGSEVTSVKRLD
FT                   "
FT   gene            complement(425440..426822)
FT                   /locus_tag="Nham_0384"
FT   CDS_pept        complement(425440..426822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0384"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61275"
FT                   /db_xref="GOA:Q1QR72"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR72"
FT                   /protein_id="ABE61275.1"
FT                   /translation="MHPAFATVPAEEAVPITFVAKATWETMGVPLDAPARRFAEASGFA
FT                   AKPGQYLALPAANGDVSHILLGLGDASDLARDPFLAGKLPGLLPAGTFRFANAPDDMHL
FT                   AALAFALGSYRFDRYRKADAQKATLVPPEGVDIADISRMADAATLARDLINTPANDMGP
FT                   GELAAAAESLAQRFGAKFGCIVGDDLRQRNFPLIHAVGMASPRAPRLIDIAWGDPAHPK
FT                   VTLVGKGVCFDTGGVDLKTASGMQIMKKDMGGAANVLALALMIMDAKLKVRLRVLIPAV
FT                   ENSVAGNAFRPLDIFPSRKGPTVEIGNTDAEGRLVLADALALADEEKPDLLIDLGTLTG
FT                   AARVALGPDIPPFYTSDDALALDVARCAQAENDPLWRMPLWPAYDAWLDSKVADINNAP
FT                   SGGFAGSIVCALFLQRFVEAAKNWLHVDIYGWTPSAKPARPEGGECQAARAIYRLLSER
FT                   YG"
FT   gene            426973..427782
FT                   /locus_tag="Nham_0385"
FT   CDS_pept        426973..427782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0385"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61276"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR71"
FT                   /protein_id="ABE61276.1"
FT                   /translation="MRQQSCLARLLASAAVTAMLAAGLAGCQTAGMSDVTGSLGARTEA
FT                   NPATDPHRTAEVYGERFRANPKDPDVALKYGQALRAIGQRAQAVAVLERAAILNPGNKA
FT                   VLAGWGRALADNGQSQQAFDVLGRAHTPANPDWRILSVQGTTLDKLGRHDDARRYYASA
FT                   LRIRPDEPSVLSNLGMSYVLTKELAKAEEVLRRAYASARADSRIRQNLALVVGLQGRFD
FT                   EAESIVKADLPANEAEANVAYLKQMLGRGANARAGAGDVLGPDSRKS"
FT   sig_peptide     426973..427065
FT                   /locus_tag="Nham_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.356 at
FT                   residue 31"
FT   gene            complement(427875..428852)
FT                   /locus_tag="Nham_0386"
FT   CDS_pept        complement(427875..428852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0386"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61277"
FT                   /db_xref="GOA:Q1QR70"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR70"
FT                   /protein_id="ABE61277.1"
FT                   /translation="MLDFLIEKLHDPQFMTMVLAAIAASATVYTLITPFFAAEGLTKRM
FT                   KAVASERERIRQRERERLAKSEKVSLRQAPKQFVSKVVEDLNLGKWVAQEAAREKLVMA
FT                   GYRGQAPYVTFLFFRMVTPIVMLIGAIVYVFLLSHMQQSTPIKIGICIGAAFFGLQAPM
FT                   LFLKNAITKRQISIKRAFPDALDLLLICIESGMSIEVAFRKVSTEIGSQSVALAEEFTL
FT                   TTAELSYLQDRKVAYENLAKRTGVEGVKSVCLALQQSERYGTPLAQSLRVMAQENRDMR
FT                   MTEAEKKAAALPPKLTVPMIVFFLPVLFVVILGPTGIKIAAQMH"
FT   gene            complement(428862..429836)
FT                   /locus_tag="Nham_0387"
FT   CDS_pept        complement(428862..429836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0387"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61278"
FT                   /db_xref="GOA:Q1QR69"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR69"
FT                   /protein_id="ABE61278.1"
FT                   /translation="MNLQTLAMAFMAATAVGGVAWVFLYPALSGEAKAEKRRSAFARTA
FT                   PAVRQVDRAQRSRREQIEGSLREIEQRQKRDSKITLNDRIAQAGLSWSKEKFLIVSGIF
FT                   GAVCFAVPMFSGAGPIAAVGLAFAAGFGLPRWLLGFLKTRREKAFLRALPDAVDVIVRG
FT                   IKAGLPLFESIKVVAADSPEPLKSEFAAIIETQAIGMPLGEACARLYERMPVPEANFFG
FT                   IVIAIQQKSGGNLSEALGNLSKVLRDRKKMAEKIQAMSMEAKASAAIIGSLPPVVMMLV
FT                   YLTTPDYIAMLWTHPTGRLMLAGCVLWMSAGIFVMKKMINFDF"
FT   sig_peptide     complement(429768..429836)
FT                   /locus_tag="Nham_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.440 at
FT                   residue 23"
FT   gene            complement(429849..431318)
FT                   /locus_tag="Nham_0388"
FT   CDS_pept        complement(429849..431318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0388"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61279"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR68"
FT                   /protein_id="ABE61279.1"
FT                   /translation="MFGKRSGPEDDARKMAGLTLEATPAIQNVRAPAEIASPTVASPPL
FT                   APARSAPHTPAIDARRSETYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEI
FT                   IAIKNIVMSIAEQEELLDDICNDVLGYGPLEPLLSRDDIADIMVNGAGTVFIEVAGKIQ
FT                   RTGIRFRDNQQLLNICQRIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALT
FT                   IRKFRKDKLTLDQLVKFGAITPEGGTILQIIGRCRANVLISGGTGSGKTTLLNCLTNYI
FT                   DHDERIITCEDAAELQLQQPHVVRLETRPPNIEGEGQVSMRELVRNCLRMRPERIIVGE
FT                   VRGPEAFDLLQAMNTGHDGSMGTLHANNPREALSRCESMITMGGFALPSRTIREMICAS
FT                   IDIIIQAARLRDGSRRITHITEVMGMEGDTIITQDIFIYDLLGEDANGNVVGRHRSTGI
FT                   GRPRFWERARYYNEEKRLAAALDAAEVKVEI"
FT   gene            complement(431340..432608)
FT                   /locus_tag="Nham_0389"
FT   CDS_pept        complement(431340..432608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0389"
FT                   /product="pilus assembly protein CpaE"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61280"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR67"
FT                   /protein_id="ABE61280.1"
FT                   /translation="MISYPRQDAEEPTASASPKADDHIAPAPRVSVQAFCETMETATAV
FT                   QAAGEDRRLGKAHLKIQMGGMAAAAEAYRSAPTPNVIILETEERGDILAGLDQLATVCD
FT                   AGTRVIVIGRVNDVTLYRELVKRGVSDYVIAPVTAVDIVRAVCGLFSAPEAKAVGRIIA
FT                   VAGAKGGVGASTIAHNVAWAIARDLALDSVVADLDLAFGTAGLDFNQDPPQGIADAVFS
FT                   PDRIDTAFVDRLLSKCTDHLSLLAAPATLDRVYDFGTEAFDSILDTLRTTMPCIVLDIP
FT                   HQWSGWTKRALIGADDILIVATPDLASLRNTKNLFDLLKAARPNDRPPLYCLNQVGVPK
FT                   RPEISASEFAKAIESQPIVSIPFDPQLFGSAANNGQMIAEIAANHRITDMFLQIAQRLT
FT                   GRGETKKPRKSFLPPFIEKLRAK"
FT   gene            complement(432605..433345)
FT                   /locus_tag="Nham_0390"
FT   CDS_pept        complement(432605..433345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0390"
FT                   /product="pilus assembly protein CpaD"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61281"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR66"
FT                   /protein_id="ABE61281.1"
FT                   /translation="MTSADSAERYRSLRVAVLIAGLAAALGACTHTSQEATTASIPNDY
FT                   RLRHPIAIQEANRTVNIFVGNTRGGLSASQRADVVGLASVWLREGTGAIVAEAPMGTSN
FT                   ARAAADSLREVRSLLTAAGVPPRGIIVRHYHPADPRLFATIRLTYPQIAAVAGPCGVWP
FT                   EDLGPSIKNKGYLDNKPYWNFGCASQRNLAAMVDNPSDLVQPRPETPTYTARRTYALDK
FT                   YRQGQSSATVYPDADKSKISSVGQ"
FT   sig_peptide     complement(433238..433345)
FT                   /locus_tag="Nham_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.606 at
FT                   residue 36"
FT   gene            complement(433367..434827)
FT                   /locus_tag="Nham_0391"
FT   CDS_pept        complement(433367..434827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0391"
FT                   /product="type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61282"
FT                   /db_xref="GOA:Q1QR65"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR65"
FT                   /protein_id="ABE61282.1"
FT                   /translation="MTWTINPTPLQAIVARSLSFAAIAAFTLNPALTPVFASDYRVPAA
FT                   TAGAKMHAQSLSLGIGKSVVVDLPRDVKDVLVADPKIANAVVRSAQRAYIIGAAVGQTN
FT                   IIFFDGSGQQISAYDIAVTRDLNGLRAALKQILPNADIKIDGLGDGVVLSGWAQSPVES
FT                   QQAADLAARLAGGADKVVNSIAVRGRDQVMLKVVVAEVQRDIIKQLGVDLSANLSYGTA
FT                   VVNFNNSNPFLATGSALVPGNSVVGGFGKSIINGVTMPTVQATLRAMENSGVIRTLAEP
FT                   SLTAISGESANFLAGGEFPIPSGVSCTNGTCTPTVTFKKFGISLNFTPVVLSEGRISLR
FT                   VATEASEVNNENAIQISGTAVPSIKTRRADTTLEIPSGGSMVMAGLIKQQTKQSISGMP
FT                   GVSQIPVLGTLFRSRDYVNNNTELMILVTPYVVRAVAQKDLSRPDDGFADASDPQADLL
FT                   GSINRIYGVPGRAEPARQYRGTYGFITD"
FT   sig_peptide     complement(434714..434827)
FT                   /locus_tag="Nham_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.912) with cleavage site probability 0.739 at
FT                   residue 38"
FT   gene            complement(434843..435625)
FT                   /locus_tag="Nham_0392"
FT   CDS_pept        complement(434843..435625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0392"
FT                   /product="Flp pilus assembly CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61283"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR64"
FT                   /protein_id="ABE61283.1"
FT                   /translation="MNTARIVVLTIAVGAGGLAAYLASGSDKKPQPAQTAQLQTVDVLV
FT                   AKSDIPLGQAVTANDVAWQAWPANSASSSFIRRDQRPDATTQLAGSIARSPFIAGEPIR
FT                   ELKLVSAKGSGFMAAILPTGMRAISTEISPETGAGGFILPNDRVDVILSQRDKNPDHPN
FT                   ANSVNSETILSNVRVLAVDQTIEEKNGQKVVVGKTATLELKPEQAEMLARSRQMGTLSL
FT                   ALRSLADANAPESSTDDQRRDSINIVRYGVPTQTTVQR"
FT   sig_peptide     complement(435557..435625)
FT                   /locus_tag="Nham_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.379 at
FT                   residue 23"
FT   gene            complement(435753..436277)
FT                   /locus_tag="Nham_0393"
FT   CDS_pept        complement(435753..436277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0393"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61284"
FT                   /db_xref="GOA:Q1QR63"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR63"
FT                   /protein_id="ABE61284.1"
FT                   /translation="MALDVARLLLFPALMAFAAASDLLTMTISNRVSLLLVAGFLVVAA
FT                   LSGMSLHDMLLHAGAGLAVLLVAFTCFAMGWVGGGDAKVAAAAALWFGFGHLLEYLVYA
FT                   SLFGGALTLLLLQFRQWPLPALFYSQDWLLRLHGKDTGIPYGIALALGALLIYPETGWI
FT                   KAVDLARFALH"
FT   sig_peptide     complement(436215..436277)
FT                   /locus_tag="Nham_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.547 at
FT                   residue 21"
FT   gene            complement(436603..436773)
FT                   /locus_tag="Nham_0394"
FT   CDS_pept        complement(436603..436773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0394"
FT                   /product="Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61285"
FT                   /db_xref="GOA:Q1QR62"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR62"
FT                   /protein_id="ABE61285.1"
FT                   /translation="MKNLVKRFAKDESGATAIEYGLIAAGIAVAIISAVNLVGTNLISK
FT                   FTQVSDQLAKP"
FT   gene            437096..437581
FT                   /locus_tag="Nham_0395"
FT   CDS_pept        437096..437581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61286"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR61"
FT                   /protein_id="ABE61286.1"
FT                   /translation="MWFKFLRGRSRASVVGLSLATAILLGPTAALAEVTSDPISVNVDQ
FT                   AKLVKLPGHIATIVVGNPLIADVTLQPGGLVVVTGKGYGATNVIAMDRAGSILVDRVIQ
FT                   VEGPSDQVVTVYRGVERESYSCMPVCQKRITLGDSVAYFKATMDQASNLSSQAGGAK"
FT   sig_peptide     437096..437194
FT                   /locus_tag="Nham_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            437888..438457
FT                   /locus_tag="Nham_0396"
FT   CDS_pept        437888..438457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0396"
FT                   /product="TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61287"
FT                   /db_xref="GOA:Q1QR60"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR60"
FT                   /protein_id="ABE61287.1"
FT                   /translation="MSPFPRFRTVAARVAGRFRGNQRGSAAVEFALVAPLFFALLFAII
FT                   ETGMVFFASQSLETTLQDSARMIQTGQAQIAKYDKASFKKDVVCANASVLFDCENGIFV
FT                   DVHSYPSGFGSVEIDDSITADPITGDRNFVDNTQYSAGGPGDIVVVRLFYQWPLFVTGL
FT                   GYNLANLSGSKRLLAATVAFKNEPYS"
FT   gene            438471..439085
FT                   /locus_tag="Nham_0397"
FT   CDS_pept        438471..439085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0397"
FT                   /product="TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61288"
FT                   /db_xref="GOA:Q1QR59"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR59"
FT                   /protein_id="ABE61288.1"
FT                   /translation="MSSIWSCIRVSAAAMRRDSRGVAAIEFAMIVPLMLVMLFGTIDVS
FT                   SGVAVKRKVTLVARTLSDLTSQSKVVGDADITNFLAASYGIMWPYPSAPVQATISELYI
FT                   DPATSVARVQWSQGSSPRGVGSTVSISSDLIGKDSSDKTLPGQYLIYSEVSYLYQPIVG
FT                   YVMAKAGVTLSDTAYTRPRQSMCVTYPTPPAGTPFPPCPTN"
FT   gene            complement(439210..439416)
FT                   /locus_tag="Nham_0398"
FT   CDS_pept        complement(439210..439416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0398"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61289"
FT                   /db_xref="GOA:Q1QR58"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR58"
FT                   /protein_id="ABE61289.1"
FT                   /translation="MGTVKWFNATKGYGFIQPDDGGNDVFVHVSAVERAGLGTLREGQK
FT                   ISYEIVADRRSGKSSADNLRAAG"
FT   gene            complement(439693..439974)
FT                   /locus_tag="Nham_0399"
FT   CDS_pept        complement(439693..439974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0399"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61290"
FT                   /db_xref="GOA:Q1QR57"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR57"
FT                   /protein_id="ABE61290.1"
FT                   /translation="MAKEELIQFEGLVTEILPDARYRVQLDAGHEIVAYTAGKMKKNRI
FT                   KTLAGDRVTIEMSPYDLEKGRLIFRHKDERPSGAPRGGPPRGGQFRRR"
FT   gene            complement(440393..441826)
FT                   /locus_tag="Nham_0400"
FT   CDS_pept        complement(440393..441826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0400"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61291"
FT                   /db_xref="GOA:Q1QR56"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR56"
FT                   /protein_id="ABE61291.1"
FT                   /translation="MERNHLLSSFQDFGLADPITRALAEENYLTPTPIQTQTIPLALAG
FT                   RDIVGIAQTGTGKTASFALPILHRLLQNRIKPQPKSCRVLVLSPTRELSGQILESFNAY
FT                   GRHLRLTSALAIGGVPMGRQVRAVMQGVEVMVATPGRLLDLVQSNGLKLGQVEFLVLDE
FT                   ADRMLDMGFIHDIRKVVAKLPVKRQTLFFSATMPKDIAELAEQMLRDPARVAVTPVAST
FT                   VDRIAQRIIQVDHASKPAFLAQLLKQEPVNRALIFTRTKHGADKVVKSLAKSGIRSDAI
FT                   HGNKSQNHRERVLAAFRTGEIRTLVATDIAARGIDVDGISHVVNFDLPNVPETYVHRIG
FT                   RTARAGADGAAISLVAGAEEMAYLRDIEKLIRVALPREDRRTPGQREAAPAHQQHRAGR
FT                   PAQPSHTTRAGDAAPGAKGPRRRSRHGNGVPQTKRPEAGRHEPSRSSQGGKAEGMQGVA
FT                   FLHRQSRPARAKPGQRPQR"
FT   gene            complement(442300..443178)
FT                   /locus_tag="Nham_0401"
FT   CDS_pept        complement(442300..443178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0401"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61292"
FT                   /db_xref="GOA:Q1QR55"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR55"
FT                   /protein_id="ABE61292.1"
FT                   /translation="MDTPQLSAEQIQARVLHRDGLMLVIDKPAGIPVHRGPKGGANLEA
FT                   SFEALRFGLPRPPVLAHRLDRDTSGCLVLGRHRKATASLGLLFKHGKISKTYWAVVEGG
FT                   PTEDEGTIDIPLGRLNHERGWWQKPDPNGLPSVTRWKVLGRGIFTAASDRFSPSPCGVE
FT                   TSEARPEGAGARGNSDGIAPDHPPPRAREEGIQLTWLALEPVTGRTHQLRVHCAAMRWP
FT                   IAGDNIYGTQASLRRLRNEQYIPQFGEPSLHLHAREIAIPLSKNKPPIVVTASAPVHLH
FT                   ARLKACGWNGE"
FT   gene            443231..444178
FT                   /locus_tag="Nham_0402"
FT   CDS_pept        443231..444178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0402"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61293"
FT                   /db_xref="GOA:Q1QR54"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR54"
FT                   /protein_id="ABE61293.1"
FT                   /translation="MSDSTDDKPKQSWWRRLSGGLKRTSSSLGTAVADLVTKRKLDRAM
FT                   LDDIEDVLLRADLGTAVAERIAAAVGEGRYDKAISADEVKAVVATEVEKVLAAVAKPLV
FT                   VDETHKPFVILVVGVNGSGKTTTIGKLAAKLSAEGRKVMMAAGDTFRAAAIEQLQVWGE
FT                   RTGSPVVAGAQGSDAASLAFNALTAARDDRRDVLLIDTAGRLQNKAELMNELEKVVRVI
FT                   RRVDAAAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALAEK
FT                   HKLPVHFIGVGEGVDDLAPFTAHDFAKAIAGIEA"
FT   gene            444282..444881
FT                   /locus_tag="Nham_0403"
FT   CDS_pept        444282..444881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0403"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61294"
FT                   /db_xref="GOA:Q1QR53"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR53"
FT                   /protein_id="ABE61294.1"
FT                   /translation="MDKKQPHPLFKLATELGPLLVFFAANAKFNLFVATAAFMVAIVAA
FT                   MIASYVVTRHIPLMALVTGIVVIVFGTLTLVLHDETFIKVKPTIIYSLFAGVLGGGLLF
FT                   GRSFIAIMFDQVFNLTPRGWQVLTLRWALFFFGMAILNELIWRTQSTDFWVNFKVFGAV
FT                   PLTMIFAMMQMPLTKRYHLEPATLEASDASEGDVRK"
FT   gene            445234..445608
FT                   /locus_tag="Nham_0404"
FT   CDS_pept        445234..445608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61295"
FT                   /db_xref="GOA:Q1QR52"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR52"
FT                   /protein_id="ABE61295.1"
FT                   /translation="MNLMLTIVFGVAGLVLSFGFFVPSELSMFRLIAAVGVMVGYQAGQ
FT                   LVGRFVRPRPKRFLTLSVSALFCIYFAFAYAQTLQTGLANTSDKVNLVVLLGLSFFWLG
FT                   FLLPFTRVPNKIKALWARAK"
FT   gene            complement(445867..446229)
FT                   /locus_tag="Nham_0405"
FT   CDS_pept        complement(445867..446229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR51"
FT                   /protein_id="ABE61296.1"
FT                   /translation="MRHFTLASITAAALALGLLASSPSMAQSTQPAAKSDRMAPAGKMA
FT                   PAAKTVPANSDAAKLDINTATKEELMAFKGIGDKYSDKIIAGRPYAKKDQLVSKNILPA
FT                   AIYKKIAGQIIASQSK"
FT   sig_peptide     complement(446149..446229)
FT                   /locus_tag="Nham_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(446447..446818)
FT                   /locus_tag="Nham_0406"
FT   CDS_pept        complement(446447..446818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61297"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR50"
FT                   /protein_id="ABE61297.1"
FT                   /translation="MSSLSGDIDPSENRAADRSPAALPVPGRVTFTRLELNRILNLYGR
FT                   MVADGEWRDYAIDFLKDRAVFSIFRRASEVPIYRIEKDPRLARKQGAYSVMSASGRVLR
FT                   RGHELDRVLLVIDRKLALV"
FT   gene            complement(447447..448244)
FT                   /locus_tag="Nham_0407"
FT   CDS_pept        complement(447447..448244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0407"
FT                   /product="protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61298"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR49"
FT                   /protein_id="ABE61298.1"
FT                   /translation="MAPAHVVSRFRCSPMMTHGCLSRLSGALGVCVFVAIIRPAEAGPR
FT                   AVVELFTSQGCSSCPAADKILGDLSRDPSIVALSMPIDYWDYLGWKDTLADNRFTARQK
FT                   AYSQMRGDRDVYTPQVIVNGSAHVIGSDRAAIDNAVRDTKKNDDVMSVPVSMAVSGRQL
FT                   NVSVASASANHPSDHGEVWICAISKAVPIAIGRGENGGREVTYHNVVRSWLKVGDWTGK
FT                   AGTWAVPMENIAQDGVDAAVVYVQDGNRDRPGPMLGAAYTSLH"
FT   gene            complement(448510..451227)
FT                   /locus_tag="Nham_0408"
FT   CDS_pept        complement(448510..451227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0408"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61299"
FT                   /db_xref="GOA:Q1QR48"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR48"
FT                   /protein_id="ABE61299.1"
FT                   /translation="MASLDSFKCLKTLKVGGKTYAYYSLPAAEKNGLKGISRLPYSMKV
FT                   LLENLLRNEDGRSVTKEDIVAVSKWLRKRKLEHEISFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQNLGGEPAKINPMVPVDLVIDHSVIVNFFGDNKAFAKNVVEEYRQNRERYELLKW
FT                   GQKAFSNFSVVPPGTGICHQVNLEYLAQTVWTKKEKLTISKKTRSIEVAYPDTLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEAAMLGQPLSMLLPDVVGFKLKGALKEGVTATDLVLTVT
FT                   QMLRKQGVVGKFVEFYGSGLDHLSVADKATIANMSPEYGATCGFFPVDAATIDYLKTSG
FT                   RAPSRVALVAKYTKAQGLFRTTASPDPAFTEKLMLDLGTVVPSLAGPKRPEGRQPLPAI
FT                   AEGFAAALASEYRKTDAAARWPVEGRNFDLGHGEVVIAAITSCTNTSNPTVLIAAGLLA
FT                   RKAAAKGLTAKPWVKTSLAPGSQVVAEYLANSGLQKDLDTVGFNLVGFGCTTCIGNSGP
FT                   LPEEISKSINDNGIIAAAVLSGNRNFEGRVSPDTQANYLASPPLVVAYALAGSVTRNLA
FT                   TEPLGTDKAGKPVYLKDIWPTSKEINAFIKKFVTSRIFKKKYADVFKGDTNWRKIQTVT
FT                   SETYRWNMGSTYVQNPPYFEGMTKEPEPIADVVDARILAMFGDKITTDHISPAGAIKLT
FT                   SPAGKYLTEHQVRPADFNQYGTRRGNHEVMMRGTFANIRIKNFMLKGADGNIPEGGLTR
FT                   HWPDGEQMSIYDAAMKYQQENVPLVVFAGSEYGNGSSRDWAAKGTLLLGVRAVICESFE
FT                   RIHRSNLVGMGVLPLTFEDGASWQSIGLKGDETVTIRGLQGDLKPRQKLTADIVSRDGS
FT                   LRRVLLLCRIDTLDELDYYRNGGILHYVLRKLAA"
FT   gene            451460..452074
FT                   /locus_tag="Nham_0409"
FT   CDS_pept        451460..452074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0409"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61300"
FT                   /db_xref="GOA:Q1QR47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR47"
FT                   /protein_id="ABE61300.1"
FT                   /translation="MKLSGHGLRCVRGGREVFSGLDVAAESGRAVAITGPNGAGKTSLL
FT                   RLLAGLLALEGGSIGLEGGDPELTLPEQAHYLGHRDALKPALSVSENLSFWRGFLGGAS
FT                   RASGPDAAQALAAVGLDHVAHLPAAYLSAGQRRRLSIARLLAVKRPVWLLDEPTSALDV
FT                   AGQSAFAAIMTGHLAGGGIILAATHTPLGIAARELRIGGTT"
FT   gene            452187..452855
FT                   /locus_tag="Nham_0410"
FT   CDS_pept        452187..452855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0410"
FT                   /product="heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61301"
FT                   /db_xref="GOA:Q1QR46"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR46"
FT                   /protein_id="ABE61301.1"
FT                   /translation="MTALAALVRRDVSVALRVGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLKKLGPAILWIGALLASLLTLDRLFTADHDDGSLDLIVMSRTPLELACAAKALAHWLA
FT                   AGLPLVAATPVLGLLLNLDAAATGAVALTLLAGTPALTFTGMIGAAIAVVLRRGGLLLS
FT                   VLVLPLSIPVLIFGVAASNAALSGPSPFGTPFSILCALSLASLVIGPFAAAASLRHGLD
FT                   "
FT   gene            452950..453681
FT                   /locus_tag="Nham_0411"
FT   CDS_pept        452950..453681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0411"
FT                   /product="heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61302"
FT                   /db_xref="GOA:Q1QR45"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR45"
FT                   /protein_id="ABE61302.1"
FT                   /translation="MTLIDLANPSRFLALAGRILPWLVAVTVLVLAIGLYQSATAPDDY
FT                   QQGATVKIMFIHVPNAWLSMFVWGVMSIAALGTLVWRHPLADVAAKTAVPIGAAFTFLA
FT                   LLTGSLWGRPMWGTYWEWDARLTSVLILFLMYLGLMALWRAVEDPSRAARAAAVLTLVG
FT                   SINIPIIKFSVDWWNTLHQPASVIRMGGSTLDRAFLIPLLVMAIGFTLLFLTLHIAAMR
FT                   NEILRRRVRTLQMLQASKSAA"
FT   gene            453687..453866
FT                   /locus_tag="Nham_0412"
FT   CDS_pept        453687..453866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0412"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61303"
FT                   /db_xref="GOA:Q1QR44"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR44"
FT                   /protein_id="ABE61303.1"
FT                   /translation="MTLGPYASFIVMSYVAVAAVVVALVIWVIVDYRRQKARLRDLEAA
FT                   GAVRRSGRSAAEIK"
FT   gene            453863..454456
FT                   /locus_tag="Nham_0413"
FT   CDS_pept        453863..454456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0413"
FT                   /product="periplasmic protein thiol"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61304"
FT                   /db_xref="GOA:Q1QR43"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR43"
FT                   /protein_id="ABE61304.1"
FT                   /translation="MTDPAIPAAAPKRRWLMALPLVVFAALALLFWFRLGDTDISRIPS
FT                   ALIGHAAPRTTLPPLSGLVADGKPVPGLDPASLEGKVSLVNVWASWCVPCHGEAPLLTA
FT                   LAKDRRLQFVGINYKDAPDNARRFLGRYGNPFDIVGVDDNGRASIEWGVYGVPETFVVG
FT                   RDGTIAYKLVGAITPENIDAVLKPEIDKALKAGS"
FT   gene            454774..455391
FT                   /locus_tag="Nham_0414"
FT   CDS_pept        454774..455391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61305"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR42"
FT                   /protein_id="ABE61305.1"
FT                   /translation="MAGARRLLAGFAIACGMVLASSHANAGWWSRTPADFEECAASVEK
FT                   NATSAEDKGQRLTACEAKFAGRRNPGGGYTYYDFMQNRHFDIAGPNPTAEEQKHIDEQY
FT                   AAYLKDQRRGIIAAAFFRKQQEVEQARATVKPNAGSSNVRLTTTPKTAEKHVAVLPRPR
FT                   PKIAPHCEEAFFSTCSWSRISTGVRDLKKALFGSFVRKDERS"
FT   sig_peptide     454774..454854
FT                   /locus_tag="Nham_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.714 at
FT                   residue 27"
FT   gene            complement(455473..455709)
FT                   /locus_tag="Nham_0415"
FT   CDS_pept        complement(455473..455709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61306"
FT                   /db_xref="InterPro:IPR021937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR41"
FT                   /protein_id="ABE61306.1"
FT                   /translation="MRNLIYAALSAAAILAISTPISPASAHDYRYCLQGREWGYPGNCQ
FT                   FSTYRQCMLTASGTDAYCGINPRVAFRERGHYR"
FT   sig_peptide     complement(455629..455709)
FT                   /locus_tag="Nham_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(455831..456898)
FT                   /locus_tag="Nham_0416"
FT   CDS_pept        complement(455831..456898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0416"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61307"
FT                   /db_xref="GOA:Q1QR40"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR40"
FT                   /protein_id="ABE61307.1"
FT                   /translation="MRIAQVAPLTEAVPPKLYGGTERVVHWLTEELVALGHDVTLFASG
FT                   DSRTSARLDATWPKALRLDGAVCDPNALHMVMLERVRRKCDDEEFDFLHFHLDYYPFSL
FT                   FSRQPTPFLTTLHGRLDLPEHQPVFTAFSSIPVISISNAQRRPVPQARWLRTVYHGLPE
FT                   KLLTPRPTTPGYLAVLGRIAPEKGVDRAIRIALRCGIPLKIAAKVDRADQDYYDEVVRP
FT                   MMDHPLVDFIGEISDHEKPDFLSGAIGLLVPIAWPEPFGLVMIEAMACGTPVIAYNRGS
FT                   VAEIIEDGRTGFIVEDENSAVAAVDRLASLDRAIVRKEFEARFTARRMALDYLDAYHDL
FT                   IEAATPKIKLVSSAE"
FT   gene            457191..458954
FT                   /locus_tag="Nham_0417"
FT   CDS_pept        457191..458954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0417"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61308"
FT                   /db_xref="GOA:Q1QR39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR39"
FT                   /protein_id="ABE61308.1"
FT                   /translation="MDDFSGYGGRPFAFVMRYCRQRSASHVAILFCVVAAVACSVGTQY
FT                   GVKSLVDALAGGPSRSGGVWLAFIFLMSLIAADNFLWRIAGWVASFTFVGVTGDLRRDI
FT                   FRHLTGHAPSYFAERMPGMLTSRITATSNAVYSVENMLVWNVLPPCIATMAAIALIGTV
FT                   SPPMAAGLTVVAGIMVVAMFKMAAAGKPLHEDFADKAAAVDGEMVDVVNNMPLVRAFCG
FT                   IDHELDRFNATVGRELSARGRSLRYLEKLRITHAAITVALTVSLLAWAITLWQRGGATT
FT                   GDVVLVCTLGLSILHATRDLAVALVDITQHVARLSEAVATLLVPHELTDHPEAEPLRKN
FT                   GAAIAFNNVSFRYPGGRPVFERFNLRLQPGQRVGLVGESGGGKSTLFVLMQRFYDPERG
FT                   SVTIDGQDVSRVTQQSLRAAISVVPQDISLFHRSILENIRYGRPTATDDEVLRAAIAAR
FT                   CDFVEGLSDGLSTMVGDRGVKLSGGQRQRIAIARAFLKDAPILLLDEATSALDSESEEA
FT                   IREALGRLMRGRTVIAIAHRLATLRNFDRMVVLKNGKIIEDGQPGRLMRKDGHYRQLVA
FT                   KEMSRLAVHAA"
FT   gene            459040..461247
FT                   /locus_tag="Nham_0418"
FT   CDS_pept        459040..461247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0418"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61309"
FT                   /db_xref="GOA:Q1QR38"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR38"
FT                   /protein_id="ABE61309.1"
FT                   /translation="MMAIKATAQITTTQLSDVLAAESPFYIPMTGPSARPRRTLKHDDT
FT                   FVVLDSHGDIGASAGGPDGLFNTDTRYLARLELVLNDMQPLLLGSNLRNDNSGLTVDLT
FT                   NPDIYDGDRIVFHKDTIHIVRTIFLWRGTAYQRIGIQNHGEGTASFDLSLLFDNDFADL
FT                   FEVRGERRARRGVGTGELSDPATVALSYIGLDDIIRTSRLHFDPRPTRLTVNGAIYHLD
FT                   LPPQQTTAIFLAVSCNKPATEKPVPFYRGLLAHRREMRRAWSGATNVETSNNIFNEVLC
FT                   QSMADLNILMTQTPHGRYPYAGIPWYSTTFGRDGLITALQMLWIDPGIARGVLRRLAAF
FT                   QAQAVDPLADAEPGKILHEMRGGEMAALREVPFARYYGSVDSTPLFVLLAGLYVERTGD
FT                   ESILKELWPAIEAALGWIDGPGDPDGDGFVEYRRASEQGLPNQGWKDSFDAIFHADGAL
FT                   AEGNIALAEVQGYVFAAKRSAARCARALGLTDRARELERAAERLASRFEEAFWLPDLRT
FT                   YALALDGKKRPCKVRTSNAGQLLFTGLVGEERARMVAADLMRPPLFTGWGIRTVASGEA
FT                   RYNPMSYHNGSIWPHDNALIALGLARYGLKHSVEHVFKGLFDAATYMDLRRLPELFCGF
FT                   RREPRRGPTLYPVACSPQAWASATPFTLLEAALGLEFDAARSEIRLRNPRLPAFLNEVI
FT                   LRGLHLGESSVDLRLRRHDEDVSLEVLRTRGHIQVSIVLTR"
FT   gene            461502..462011
FT                   /locus_tag="Nham_0419"
FT   CDS_pept        461502..462011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0419"
FT                   /product="PRC-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61310"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR37"
FT                   /protein_id="ABE61310.1"
FT                   /translation="MFRQGSTNAVLSMAVLVFAATQVMADDTAQSQADPAPSNPPVAAK
FT                   PSGGTTAPPPSITVISPADAHGVLGRDVRSMSGQNMGRIVEVIVDRAGVVRAAVIDFGG
FT                   FLGVGSRKIAVDWNALRFGGVKGTNDSISLELTQDQVKAAPEYKEGAPVVVLGASGTLQ
FT                   PLNFGP"
FT   sig_peptide     461502..461579
FT                   /locus_tag="Nham_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            462102..463352
FT                   /locus_tag="Nham_0420"
FT   CDS_pept        462102..463352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0420"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61311"
FT                   /db_xref="GOA:Q1QR36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR36"
FT                   /protein_id="ABE61311.1"
FT                   /translation="MNPPPPAAEQGRSPSAQSQRGLDWFIFFLADVQTGFGPFVAVYLT
FT                   TQKWTQSEIGLILSIGGVVGLIGQMPGGAVIDAARSERLVAGLAVATIGVSALAYAAWP
FT                   IFPVIALAAILHAAASCVLGPVIAAISLGLVGPRAIGERLGRNARYASLGNGVAAGVMG
FT                   AVGYLLSSRAVFVVSFAFAIATLLSLARIRDREIDPEHAHGTIACAKPDPDTTSIVHLL
FT                   HQRPLVIFACTVFLLQFANAAMLPLMAGIVTERSSQGTPALIALCIIVPQAIVALVSPS
FT                   VGRKAQLWGRRPLLMIAFAALALRGALFATIHDPTLLVAVQVLDGITAAVFGVMTPLIV
FT                   ADVAFGSGHFNLAQGIIGTAVGIGASLSTAVAGYVSDQLGHGVAFMALAAVALTGLLVV
FT                   WTLMPETRLAEGLERGS"
FT   gene            complement(463472..463732)
FT                   /locus_tag="Nham_0421"
FT   CDS_pept        complement(463472..463732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR35"
FT                   /protein_id="ABE61312.1"
FT                   /translation="MDSRLPLTPFKSATADESSIEGSGPQEFMRSDGTMDIEFLKQQAE
FT                   RCRRLAKGTDPFTEKRLLKLAEEYEAQIKELEKRSLEPWSH"
FT   gene            464110..465735
FT                   /locus_tag="Nham_0422"
FT   CDS_pept        464110..465735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0422"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61313"
FT                   /db_xref="GOA:Q1QR34"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR34"
FT                   /protein_id="ABE61313.1"
FT                   /translation="METLLLPFSPRFIVLTICAVVTALLIGLGVADHETLTVVVVPILI
FT                   FGALTALGVRDLLQKSHAILRNYPISAHIRFLLEEIRPEMRQYFFESEKDGMPFSRDTR
FT                   SVIYQRAKMVLDKRPFGTQEKVYAEGYEWMHHSMAPKPHAEETFRIAIGGPDCKTPYSA
FT                   SIFNISAMSFGALSPNAVRALNAGAKMGNFAHDSGEGGVSPYHRENGGDLIWEIGSGYF
FT                   GCRNRDGSFNAREFARVAADDQIKMVELKISQGAKPGHGGVLPAAKVSEEISRIRGISM
FT                   DEDCISPSHHKAFSTPVGMMTFIAEMRRLSGGKPAGFKLCVGHKWEFLAICKAMVQTGI
FT                   YPDFIVVDGNEGGTGAAPLEFMDHLGMPMREGVNFVHNALIGIDARDRIRIGASGKIAT
FT                   AFDVARAMALGADWCNSARGFMFALGCIQSLSCHTDRCPTGITTQDPTRNRALVVPHKL
FT                   ERVYNYHQATLLALTELIAAAGLEHPRELRPVHFSQRVSNTEVASFDTLYPTLRPGELL
FT                   DGTADPRFRDAWAQAQAGSFAPVG"
FT   gene            complement(465989..468067)
FT                   /locus_tag="Nham_0423"
FT   CDS_pept        complement(465989..468067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0423"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61314"
FT                   /db_xref="GOA:Q1QR33"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR33"
FT                   /protein_id="ABE61314.1"
FT                   /translation="MRANGAIDDQYGNLPVQADGPMSAIRPFRLRRGRHVVLAGVALSA
FT                   LALGGSAVAADVGASLLPTKAMPRPVIDWTGLYFGAHAGFGGGRSTATLVDPASTTGRN
FT                   DYGGIISGVQAGYNIQLPSGLLLGLEADISFPNYIESNSDVSKLATARSAVTQQWDFIG
FT                   SARGRIGYATGPWLTYASGGLAFAGERYLNDLPSGDQEKALDMRLGWAAGAGLEYAFTP
FT                   SWSARLEYLYYRFDKTNVQFPSAAQYAATMDMHSIRVGLNRKLGGSAGIADLSLKSLTD
FT                   PESDRWEIHGQTTYLGQGYPAFRAPYSGANSLTPGAQYQATWSNSLFLNARLWDGGEVY
FT                   YNPELLQGFGLSDTVGVAGFPSGEAQKSNFPYPHYNTSRLFVRQTFGFGGEQEELASGP
FT                   AQLAGKADISRLTIQAGKFAVTDVFDGNAYAKDTRSDFMNWSLWAPGAFDYSADRLGLS
FT                   YGVTAELNQKQWALRGGYFLMDAESNANSFDTRLFRRGEYVLELETRYSLLGQPGKLRT
FT                   IGWLNSAYMGSYRDTLNNPAFNLDIAQTRTGRIKYGYVVNIEQAVTDDIGLFGRWSWND
FT                   GKTEIMAFTDIDASLALGTSIKGTRWSRPGDVIGIGGAINALSRDHRDFIAAGGLGVLV
FT                   GDGQLNYRHERVLEAYYAYALNKQFTLTADYQFIANPAYNADRGPVHVFSGRLHGEF"
FT   gene            complement(468389..469207)
FT                   /locus_tag="Nham_0424"
FT   CDS_pept        complement(468389..469207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0424"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61315"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR32"
FT                   /protein_id="ABE61315.1"
FT                   /translation="MTRTPPFDWSAIYRPGVPPETAANWIAVLPLAATEQHGPHLPLTT
FT                   DVLIAEAYLARVRELLPQDIPANFLPVQPIGISTEHTDFPGTQTLTNEAALKAWTALGE
FT                   DVARTGIRKIVMVSSHGGNSAAMTMVAQDLRARHRMLAVTTAWSRFGVPDGLFDAQELR
FT                   HGIHGGAIETSIMLARYPEQVRRDSIADFHPASIAIEKIYRWLGTQRPAPFAWQTQDLH
FT                   PSGAVGDATQASAEKGERLLEHGARAFCELLADMARFDPAVLTDGPRGRA"
FT   gene            469440..470465
FT                   /locus_tag="Nham_0425"
FT   CDS_pept        469440..470465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0425"
FT                   /product="perplasmic binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61316"
FT                   /db_xref="GOA:Q1QR31"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR31"
FT                   /protein_id="ABE61316.1"
FT                   /translation="MMRLALSLRTLTAGLVLALGLAGPATAEPALDKVSFGTNWVAEGE
FT                   HGGFFQALADGTYKKYGLDVKIVPGGPNVNNRVLLISGKLDFFMTANTLQSFDAVANNV
FT                   PVVAVAAMFQKDPQVFLAHPESKVTKIEDLKPLTLFVSKEGIASYFQWLKSEYGFSGEK
FT                   VKPYTFNAQPFLADRKSAMQGYVTSEPFAVEKRAGFKPTVILLADAGFNPYSTLIETRR
FT                   DLVENKQDLVQRFVDASIVGWYTYLYGDNTAGNAMIKKLNPEMTDDLLAYSVAKMRKYG
FT                   IVDSGDSLRDGIGAMSDARYASFFDKMVRAGVVRRDIDFRKAYTLRFVNKGVGLDLRPK
FT                   N"
FT   sig_peptide     469440..469523
FT                   /locus_tag="Nham_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            470488..471294
FT                   /locus_tag="Nham_0426"
FT   CDS_pept        470488..471294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0426"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61317"
FT                   /db_xref="GOA:Q1QR30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR30"
FT                   /protein_id="ABE61317.1"
FT                   /translation="MTESALALSKADTGPRAGDAVSLKGVTKLYDRGVAALGPLDFNVR
FT                   DGDFVSLLGPSGCGKSTALRIIAGLSAPTSGTVRVAGGGRSIGFVFQEPTLMPWASVRD
FT                   NVALPLKLAHRPRTDIGGHVEAALARVGLAEFAAAYPRQLSGGMRMRVSLARALVTDPD
FT                   ILLMDEPFAALDEITRFRLNNDLLALWRDLRKTVIFVTHSVFESVYLARRVVVMTPRPG
FT                   RISAEYRIDTAEPRGEDFRTSAEYAAYCREVSIGLSLATGKGALRR"
FT   gene            471291..472130
FT                   /locus_tag="Nham_0427"
FT   CDS_pept        471291..472130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61318"
FT                   /db_xref="GOA:Q1QR29"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR29"
FT                   /protein_id="ABE61318.1"
FT                   /translation="MTVSGSSAVPIGSEASERDSRTSAARVLLPVAVLAAGVLVWDLVV
FT                   RINGIPPYVLPGPMLVAATLVQDWPILWQSLLTTLLTTGEGFAAATVGGVALALLFNQS
FT                   KWLEHALLPYAIILQVTPVIAIAPLLLIYLPQQTAVVVCAWIVAFFPVLSNTTLGLNSV
FT                   DRNLAGLFQLYGASRMQTLRYLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAG
FT                   SGLAYRIAESGYRLNIPRMFAALLLLSVAGIVIYMCLAAVSHLMLRRWHESALGKEN"
FT   gene            472130..473113
FT                   /locus_tag="Nham_0428"
FT   CDS_pept        472130..473113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0428"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61319"
FT                   /db_xref="GOA:Q1QR28"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR28"
FT                   /protein_id="ABE61319.1"
FT                   /translation="MAAPVSPEKIDLLVYGPHRPIVDNGFTDQFVLHHCEKQADLERLT
FT                   PAVAGKIRGMAITDSVPCRSTAQTRFPKLEIMSSFGVGYDHIDTDHAREHNIVVTNTPD
FT                   VLTEEVADVAIGLLIATLREFVKADRYVREGLWATQDFPLSAGSLRDRKVGMVGMGRIG
FT                   QAIARRLDAARVPVVYHARNPAAGVSYQHYPNLIEMAKAVDTLIVITPGGASTLKMIDA
FT                   DVLAALGPRGVIVNMARGSVIDEPALIHALKSGITLAAGLDVFANEPDVPEELRALQNV
FT                   VLLPHIGSASVVTRDVMDQLVVDNLRAWFAGKPPLTPVPETPVEGR"
FT   gene            473115..473837
FT                   /locus_tag="Nham_0429"
FT   CDS_pept        473115..473837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61320"
FT                   /db_xref="GOA:Q1QR27"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR27"
FT                   /protein_id="ABE61320.1"
FT                   /translation="MRCPDDSTQAWRKRGVVLATVVMLTTGGSVASAQNASTLKKDMIG
FT                   QWELSTTERSKTCVVTLTGDPSPQGLKLDLEPGCAAALPFTKDIAVWTVAGLDIVRLQT
FT                   ASGEPVIDFTEVESGIFEGRRENEGIYILQNLAEARSLARSMDQMIGDWAFVRGNGQAI
FT                   CGITLTNTEVPPDNFQAFLKPKCDPAIAGFKPEAWRLERGEILLMSASGETWHFQADDN
FT                   AQWRLVPDSANPLILVRQ"
FT   sig_peptide     473115..473216
FT                   /locus_tag="Nham_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.782 at
FT                   residue 34"
FT   gene            complement(473893..474657)
FT                   /locus_tag="Nham_0430"
FT   CDS_pept        complement(473893..474657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0430"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61321"
FT                   /db_xref="GOA:Q1QR26"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR26"
FT                   /protein_id="ABE61321.1"
FT                   /translation="MPPAAARLREPRNGPPRPMPADADNPAGFAEAPHYHGHRERLRER
FT                   FRDAGPDALSDYELLEMVLFRALPRRDVKPLAKSLIGRFGSFAEVVHAPDARLREISGL
FT                   GEAAIIEIKLIAATASRVAKGQLKPRTMLSSWTAVIDYCRASMAFADKEQFRILFLDKR
FT                   NQLIVDELQQVGTVDHTPVYPREVVKRALELSATAIIMVHNHPSGDPTPSQADIQMTKS
FT                   IIDISKPLGISVHDHIIVGKNGHASLKGLRLI"
FT   gene            complement(474733..475557)
FT                   /locus_tag="Nham_0431"
FT   CDS_pept        complement(474733..475557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0431"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61322"
FT                   /db_xref="GOA:Q1QR25"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR25"
FT                   /protein_id="ABE61322.1"
FT                   /translation="MSYVEASETSLRKTGQIKLHGPSGFAGMRKAGALTARCLDELADL
FT                   VKPGLLTSKIDDFVREFAFSHDAYPATLMYRGYRYSTCTSINHVVCHGMPGDRTLKEGD
FT                   IVNVDVTLIVDGWYGDSSRMYPVGPIARKAERLIEVTYEAMMRGIAAVRPGATTGDIGY
FT                   AIQSFVEPQSMSVVRDFCGHGLGRMFHDEPNIIHIGRPGEGVPLRPGMFFTIEPMINIG
FT                   KPHVKILSDGWTAVTRDRSLSAQFEHSVGVTQTGVEIFTLSPRKLDKPPYGG"
FT   gene            475782..477575
FT                   /locus_tag="Nham_0432"
FT   CDS_pept        475782..477575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0432"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61323"
FT                   /db_xref="GOA:Q1QR24"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR24"
FT                   /protein_id="ABE61323.1"
FT                   /translation="MASLDSVSLAILLGAILVMAGILSSLLALRFGAPLLLVFLFIGML
FT                   AGDSGPGGLMFSDVQNTYLVGSAALALILFDGGLKTRFQSIRTVLAPSMVLATLGVLLT
FT                   ALVTAPVAKYALDLNWTEALLIGAVVASTDAAAVFLLVHAQGLRLRPRVGATLEAESGT
FT                   NDPFAVFLTLMLVELISVGDSSVWHVVLEFLRESMLGGLVGVIGGRLVVAALNRVELPQ
FT                   GLHAPFVTTAALVIFGVAQIFHASGFLAVYLAGIIIGNHPTRAHRSVVTFLDAATWLAQ
FT                   IVMFVLLGLLVSPHRLLDSVVPAVIVALVLMLVARPLAVFLCLAPFRFNWREKLFIAWT
FT                   GLRGAVAIFLASIPMLVGLSKAYLYFDVAFVVVIISLLLQGWTLAAAARRLHVALPRAD
FT                   RGPRRVELDLPGQLEQQLVGYAVRPKSLFLRRGLIPSWSKPTLVIRNEKILSPAEAEPI
FT                   AAGDYLYLLAPPEKAEALDRFFVEMQPMAPPDPHLLGDFLVSGETTVEDIAQIYGISVD
FT                   PAAARLTLADYFDVHLDRAPKDGATLPLDTIVLVARNISEGRVNAVGLRLPEDEEQPPP
FT                   LTRIGAFRQKMAEAWSSIARI"
FT   sig_peptide     475782..475844
FT                   /locus_tag="Nham_0432"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.470 at
FT                   residue 21"
FT   gene            complement(477584..478249)
FT                   /locus_tag="Nham_0433"
FT   CDS_pept        complement(477584..478249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0433"
FT                   /product="Molybdate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61324"
FT                   /db_xref="GOA:Q1QR23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR23"
FT                   /protein_id="ABE61324.1"
FT                   /translation="MLRVEVSKQLGNFSIDVAFASEGRVTGLFGASGAGKTSLVGMIAG
FT                   LQKPDRGMISVDGDTLDDTAHNLHVAVHRRRIGYVFQDARLFPHLDVRRNLDYGRRMNR
FT                   LTPDPAQETRLNEMLNIGHLLDRRPGQLSGGERQRVALGRALLARPRLLLLDEPLGSLD
FT                   GSRKAEILPYLMRLRDEAGVPMVYVSHDPDELRQLASQIVMLKRGRVAAFGGIDILPA"
FT   gene            complement(478252..478947)
FT                   /locus_tag="Nham_0434"
FT   CDS_pept        complement(478252..478947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0434"
FT                   /product="Molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61325"
FT                   /db_xref="GOA:Q1QR22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR22"
FT                   /protein_id="ABE61325.1"
FT                   /translation="MFDISPTEWTAVLLSLKVGVVATLVATPIAVTLAWALARYEFWGK
FT                   SLIDAAVHLPLVLPPVVTGYLLLLTFGRRGLVGGWLADHLGIVFAFRWTGAALACGVMS
FT                   FPLLVRPIRLSIEAIDRRLEQAASTLGASPWQVFATVTLPLALPGILAGMVLGFAKAIG
FT                   EFGATITFVSNIPGETQTISSAIYSLIQTPDGDAAALRLVVVSIVMSMAALVASEVFAR
FT                   RATRRIHGS"
FT   gene            complement(479171..479995)
FT                   /locus_tag="Nham_0435"
FT   CDS_pept        complement(479171..479995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0435"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61326"
FT                   /db_xref="GOA:Q1QR21"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR21"
FT                   /protein_id="ABE61326.1"
FT                   /translation="MTLFTRSLFSALLVGAFLAVPASAKDAKPSAMAPAAAQDKILTVF
FT                   AAASMKNALDDVDKAYTAKSGVKIVASYAASSALAKQIEQGAPADVFISADTAWMDYVN
FT                   NKKSINESTRVNLLGNSIVLVAPKDSKIDHVAIEQGFDLAKLAGDGKVATGDVKAVPVG
FT                   KYAKAALEKLGAWKAVEPKMAMAENVRAALALVARSEAPLGIVYSTDAKVEPGVKIVGT
FT                   FPANSHPPIVYPVAATSTAHQGAADYLAFLRSSEAKAIFEKYGFSFLVSPTT"
FT   sig_peptide     complement(479921..479995)
FT                   /locus_tag="Nham_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(480173..480671)
FT                   /pseudo
FT                   /locus_tag="Nham_0436"
FT   gene            complement(480946..481908)
FT                   /locus_tag="Nham_0437"
FT   CDS_pept        complement(480946..481908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0437"
FT                   /product="murein endopeptidase, Metallo peptidase, MEROPS
FT                   family M74"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61327"
FT                   /db_xref="GOA:Q1QR20"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR20"
FT                   /protein_id="ABE61327.1"
FT                   /translation="MNVRAILPLLLVSAIAVLGGPATAPDAFAQTKGTLHPKPLPPLTN
FT                   PDDPSLAAKQLFGRKMLPTAGPPHVIGFYAKGCIAGAEALPITGPTWQVMRLSRNRNWA
FT                   HPAMVALLERLSARVHKDAGWPGLLIGDMAQPRGGPMITGHASHQIGLDADVWLTPMPN
FT                   RLLSRNEREDMSAVMMVRRDRLDIDPHTWTPRHLSVIRAAAREPSVERIFVNAAIKKAL
FT                   CREARGDRSWLSKVRPMYGHDYHFHIRIKCPPGSRQCESQTPPKPTEGCSAHDLAYWFS
FT                   DAVLHPKPPKVPPKPKPPLTLAQLPSDCRQVLAAPDARP"
FT   sig_peptide     complement(481819..481908)
FT                   /locus_tag="Nham_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.858 at
FT                   residue 30"
FT   gene            complement(482229..484061)
FT                   /locus_tag="Nham_0438"
FT   CDS_pept        complement(482229..484061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0438"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61328"
FT                   /db_xref="GOA:Q1QR19"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR19"
FT                   /protein_id="ABE61328.1"
FT                   /translation="MSDELRKRGTTPIANIRNFSIVAHIDHGKSTLADRLIQMTGGLSD
FT                   REMAGKEQVLDSMDIERERGITIKAQTVRLNYHAKDGKDYIFNLMDTPGHVDFAYEVSR
FT                   SLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEPDKVKQQIED
FT                   VIGIDASDAVMISAKTGLGVPDVLEAIVTRLPPPQGDRDATLKALLVDSWYDVYLGVVV
FT                   LVRIVDGVMKKNSRIRMMGTNAAYDVERVGFFTPKMQQVDELGPGEIGFITAAIKEVAD
FT                   TRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRTAMGKLRLNDASFSF
FT                   EMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGGEIEIH
FT                   NPIDMPDVVKIAEIAEPWIEATILTPDDYLGSVLKLCQERRGSQKELTYVGSRAMVRYD
FT                   LPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKVADLVKMQILVNGEPVDALSMLVHRTR
FT                   AEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKR
FT                   KLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVDG"
FT   gene            complement(484410..484751)
FT                   /locus_tag="Nham_0439"
FT   CDS_pept        complement(484410..484751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0439"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61329"
FT                   /db_xref="GOA:Q1QR18"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR18"
FT                   /protein_id="ABE61329.1"
FT                   /translation="MTGKPDDATSPSAAPAVSGAFPAGAVSREISIINKRGLHARASAK
FT                   FVQMVERFNAEVSVTRNGETVGGNSIMGLMMLSAGIGTTITVSATGPEAKAAVAAIAEL
FT                   VGDRFNEEE"
FT   gene            complement(484748..485149)
FT                   /locus_tag="Nham_0440"
FT   CDS_pept        complement(484748..485149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0440"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61330"
FT                   /db_xref="GOA:Q1QR17"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR17"
FT                   /protein_id="ABE61330.1"
FT                   /translation="MIGLVLVTHGRLADEFKAALEHVMGPQKQIEAITIGAEDDADLCR
FT                   GDIIEAVNRVDSGDGVAILTDMFGGTPSNLAISCMSRPKVEVLAGINLPMLVKLAKVRE
FT                   ERSLPDAIAMAQEAGRKYVTIASRVLAGK"
FT   gene            complement(485300..485806)
FT                   /locus_tag="Nham_0441"
FT   CDS_pept        complement(485300..485806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0441"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61331"
FT                   /db_xref="GOA:Q1QR16"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR16"
FT                   /protein_id="ABE61331.1"
FT                   /translation="MTASSAPTIHGSAVLVGDRAVLIRGPSGAGKSRLAFDLILAGRSG
FT                   QLPAATLVGDDRLCLEPVRDRLLVRPPPELEGLMEIRGLGIRRCAYVAEAPVGLVIDLD
FT                   APDAERLPPLKALRTTILAIELARIPVAAGFSPLPIAIAALTTVPGCSDPRSAADCREE
FT                   SGNHI"
FT   gene            complement(485803..487626)
FT                   /locus_tag="Nham_0442"
FT   CDS_pept        complement(485803..487626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0442"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61332"
FT                   /db_xref="GOA:Q1QR15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR15"
FT                   /protein_id="ABE61332.1"
FT                   /translation="MLDRTQPDLDPDTEDTSQVLAPEAPADHVEPTPYWQRPLGWLRRV
FT                   GQFFFTLSFSSLTRRIVSLNLAGLIALVASILYLSQFRAGLIDARAQSLLVQGEIIASA
FT                   IAASATVETNTITIDPDRLLDLKPGESFGAPDEFSGLDFPINPERVAPVLRRLISPTNT
FT                   RARIYDRDGVLILDSRSLFRRGDVIRFELPPPTDVKPGFVERTTIAIRTWLNRGDLPLY
FT                   RELGPENGNGYQEVAQSLKGEKSSMVRINDRGEIIVSVAVPVERPRATIFGALMLSTQG
FT                   DDIDQMVMAERLAILKVFGVAVVVMIVLSLLLASTIAGPVRRLADSAERVRRRIKTRIE
FT                   IPDFTRRRDEIGHLSGALRDMTDALYNRIEAIETFAADVSHELKNPLTSLRSAVETLPL
FT                   AKTEASRARLLEVIEHDVRRLDRLISDISDASRLDAELQRQDEAQIDIRRLLTTLTSVA
FT                   NETKLGHDIGVDVRFEGNRADSFSIPGHDSRLGQVISNLLTNAQSFSKSGGRVRIVCRR
FT                   LKSDIEIVVDDDGPGIRPDALERVFERFYTDRPHQGFGQNSGLGLSISKQIIEAHRGRI
FT                   WAENRPGPIDAHGDTRIAGARFVVRLPAPAP"
FT   gene            complement(487860..488561)
FT                   /locus_tag="Nham_0443"
FT   CDS_pept        complement(487860..488561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0443"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61333"
FT                   /db_xref="GOA:Q1QR14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR14"
FT                   /protein_id="ABE61333.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTSQ
FT                   PDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRACPKDPTAAPKESDAKALDRGLLRMDPERHTCTWKNEPVTLTVTE
FT                   FLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKVVDDDFEMIET
FT                   LYGVGYRFKET"
FT   gene            488775..489518
FT                   /locus_tag="Nham_0444"
FT   CDS_pept        488775..489518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0444"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61334"
FT                   /db_xref="GOA:Q1QR13"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR13"
FT                   /protein_id="ABE61334.1"
FT                   /translation="MQPTANFTAANLARSLLRRSRQGALATLMTGSGDPYCSLVNVASH
FT                   YDGSSILLISRLAVHTKNVIADTRVSLMLDERAEGDPLEGSRIMVAGTAEEAGGELRTT
FT                   LRRRYLNAHPSAESFADFNDFSFFRIRPTGVHLVAGFGRIVDLKPEKILTSLEGAEALL
FT                   EAEQSAIDHMNADHRDALNLYATQLLGAETADWRCTGCDPDGLDISADKHSALRLDFPR
FT                   RIVAPAELRVVLKELAEKARAATRH"
FT   gene            489699..491315
FT                   /locus_tag="Nham_0445"
FT   CDS_pept        489699..491315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0445"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61335"
FT                   /db_xref="GOA:Q1QR12"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QR12"
FT                   /protein_id="ABE61335.1"
FT                   /translation="MPETGVRNGAFGADKFGLKNLEAVYWNFGAPQLYEHALRKGEAMV
FT                   NADGALCADTGVFTGRSPKDKFTVRDATTDQSVWWAGNQSITPEQFAALYADFLDHAEG
FT                   MTLFAQDLYGGADPNFRIPTRVFTELAWHSLFIRTLLRRPDTSELAGFVPELTVIDLPS
FT                   FRADPERHGVRSENVVAIDFVRKIILIGGSHYAGEMKKSIFTTLNYYLPDNGVLPMHCS
FT                   ANVGPEGDSTIFFGLSGTGKTTLSADPKRTLIGDDEHGWSKEGIFNFEGGCYAKCIKLS
FT                   QEAEPEIYAASKRFGAVLENVVHDESTRVPDFDDGSKTENTRSAYPLEFIPNASLTGRA
FT                   GQPKNLVMLAADAFGVLPPIARLTPAQAMYHFLSGYTAKVAGTERGLGNEPQPEFSTCF
FT                   GSPFLPRDPSVYGNMLRELIARHNVDCWLVNTGWTGGKYGTGRRMPIKVTRALLGAALD
FT                   GSLREVQFRTDRYFGFAVPTSVPGIEPHILDPIKTWADKAEFDKTACALVGMFQNNFTR
FT                   FEGDVDAEVRAAAPEVRAAAE"
FT   gene            491570..492463
FT                   /locus_tag="Nham_0446"
FT   CDS_pept        491570..492463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0446"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61336"
FT                   /db_xref="GOA:Q1QR11"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR11"
FT                   /protein_id="ABE61336.1"
FT                   /translation="MIGRRRLLRAAGAGLVGLVVMSRAGRVRAAPVLQERFVDELKRLE
FT                   TESGGRLGVTLLDTGTGQCVGHRMDERFPLCSTFKVLASGAVLQGVDAGKESLARRIYF
FT                   NEADLVTHSPETHKRVGPIGITVAELCKAAITLSDNTAGNLLLASIGGPQGLTAFVRKL
FT                   GDDVTRLDRIETELNEAAPGDPRDTTTPNAMASDLRALAVGDVLSAKSRAQLVGWLAAN
FT                   TTGGKRLRAGLPAGWRVGDKTGTGERGTANDVAVIWPPDRAPFIITAYLTGATVSADRQ
FT                   NAVMAAVGRAVATALA"
FT   sig_peptide     491570..491659
FT                   /locus_tag="Nham_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.953 at
FT                   residue 30"
FT   gene            complement(492588..493565)
FT                   /locus_tag="Nham_0447"
FT   CDS_pept        complement(492588..493565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0447"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61337"
FT                   /db_xref="GOA:Q1QR10"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR10"
FT                   /protein_id="ABE61337.1"
FT                   /translation="MTDAGGGRVGRVALLGVPIDMGAAQRGTLMGPAALRIAGIKPVLE
FT                   SLSIDVLDHGDISIAQVAPATDQIPANANHYRDIQAWTRTLSPRAYDLAKSGAIPIFLG
FT                   GDHSLSMGSINGVARYWLEQGRELFVLWLDAHADYNTPLTTMTANMHGMSAAFVCGEPG
FT                   LDDLLGEEPRASITSAHLDLFGIHSIDPLEKKLVHERRIAIADMRAIDEFGVAVLMHSV
FT                   IERVRARNGVLHVSFDLDVLDPGIAPGVGTTVPGGATYREAHLVMELLYDSGLVGSVDI
FT                   VELNPFLDERGRTARVAVELIASLFGQQITDRPTPSNTLMPGGS"
FT   gene            complement(493562..496162)
FT                   /locus_tag="Nham_0448"
FT   CDS_pept        complement(493562..496162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0448"
FT                   /product="ATP-dependent DNA ligase LigD polymerase module /
FT                   ATP-dependent DNA ligase LigD phosphoesterase module"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61338"
FT                   /db_xref="GOA:Q1QR09"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR09"
FT                   /protein_id="ABE61338.1"
FT                   /translation="MHDATRLHYDFRLEYDGVFKSWAVTRGPSLDPAEKRLAVEVEDHP
FT                   LDYGDFEGTIPKGQYGGGTVEIWDRGYWYADDPAKGLAKGDLKFALMGEKLKGEWVLVR
FT                   MKHDRSGGKRTNWLLIKHRDDYAKPGTGEEVLKHDRSVASGRTLRQIAEGKGKAPEPFM
FT                   MTRRIAGSDAVWDSNKGVAAKARDRNSKHSAVKTSAKPASARKRLPTKAKANAIKSEMP
FT                   DFAGLQLCKTSTRPPSADGWVHEIKFDGYRIQMRIENGDVTLKTRKGLDWTDKFPAIAS
FT                   AATKLPDAIIDGEIVALNQHGDPDFSAMQAALSEDKTDELVFFAFDLLFAEGEDLRPLS
FT                   LLARKERLRQLLGRSAKSARASIRYVEHFDADGAQVLDTAREAGLEGIISKRADEPYRA
FT                   GRGGSWLKSKSRAGHEVVIGGWKTTSGKFRSLMAGVYNGDYLVYTGIVGTGYGRDTVKR
FT                   IMPALKAAAASKSPFSGNNAPPGGPEVHWLKPELVAEIEFAGWTADGMVRQAAFKGLRA
FT                   DKPAREVKAEAPSHATVPRLNATRLAASAAAAARADTTTSRQPRAPAARDRSTVMGVAI
FT                   SHPDKALWPDAGDKQPVTKRDLAAYMETAGDWIIQHIRGRPCSIVRAPDGIGGETFFQR
FT                   HAMPGLSDLVTEVKVSGDRKPYLQIDRVEGLIAVAQIGGLELHPWNCAPDQYDVPGRLV
FT                   FDLDPAPDVAFPDVIAAAKEMKQRLETLGLETFCKTTGGKGLHVVTPLAITQKNRLNWK
FT                   QAKMFAQAVCEQMATDTPDKYLITMSKKQREGKIFLDYLRNDTKSTAVAPLSPRARPGA
FT                   TVSMPLNWSQVKAGLDPKRFTLRTAPDLLKKSKAWSGYDEAARPLAAAIGKLVR"
FT   gene            complement(496168..496497)
FT                   /locus_tag="Nham_0449"
FT   CDS_pept        complement(496168..496497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61339"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR08"
FT                   /protein_id="ABE61339.1"
FT                   /translation="MAALTQLSRDRMATFQDLADEAFADLLKKHGIPIDLKDALRKSAG
FT                   VKKKKSWPRGTRAPVRTLHTSDPSLEPTPCPPENSPPTATSATLRKPPNRAARRAARSR
FT                   SSGAS"
FT   gene            complement(496543..497544)
FT                   /locus_tag="Nham_0450"
FT   CDS_pept        complement(496543..497544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61340"
FT                   /db_xref="GOA:Q1QR07"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR07"
FT                   /protein_id="ABE61340.1"
FT                   /translation="MAPRANWKGFLRLSLVTCPVALFPATSESEKVSFNQINRKTGHRI
FT                   KYQKVDAETGEDVDTGDIVKGYKIDTDSYLEVTRDELDNIALDSTHTIEIDQFVPRAEI
FT                   DDLYIVRPYYLVPDGKVGHDAYAVIRDTIKTTGKIALARVVLTNREHVIALEARDNGLV
FT                   GLLLRYPYEVRDAADYFDVIKDAKITKDMLDLARHIVEQKSGHFEPTAFEDHYEAALLD
FT                   LIEQKKAGHPIAKAKVRTEGNVINLMDALRQSLKSGRSAPAAGEAAPVKGKKSRKRVEG
FT                   QREMLFPIEGKKAAAKETKRKPAKRPAKTSGAKTSTTKTPAAKASTAKRKAG"
FT   sig_peptide     complement(497461..497544)
FT                   /locus_tag="Nham_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.712) with cleavage site probability 0.457 at
FT                   residue 28"
FT   gene            complement(497772..498413)
FT                   /locus_tag="Nham_0451"
FT   CDS_pept        complement(497772..498413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0451"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61341"
FT                   /db_xref="GOA:Q1QR06"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR06"
FT                   /protein_id="ABE61341.1"
FT                   /translation="MGAPNSGSPSRSPLDCVSLINRSSLSVSHTTSRARLAEIIRTRSF
FT                   GRGEITLASGRKSDFYFNLKPTMLDPEGAALLAELSFEALKDDRLDYIGGLEMGAVPLA
FT                   GAIAQLSWLKNQPIAAFFVRKKPKEHGARLAVEGLAKGESLKGKRVVIVEDVTTTGGSA
FT                   IKAVDSVREAGGEIVLVFTMVDREEGAAETFAQAGVQFRALYKASEFLKS"
FT   gene            complement(498435..499070)
FT                   /locus_tag="Nham_0452"
FT   CDS_pept        complement(498435..499070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0452"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61342"
FT                   /db_xref="GOA:Q1QR05"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR05"
FT                   /protein_id="ABE61342.1"
FT                   /translation="MGGIFTSPLAAFALTSLVIEMTPGPNMAYLAALSLSQGIRAGLAA
FT                   VIGVALGLAVYGAAAALGLSAAIDNSPLLYEVLRWGGVVYLLWLAWEAWANEAETSPEN
FT                   TGDLDARPGQAFRRGLVTNLLNPKAAVFYVAVLPDFIQIGRGSVAMQTLMLSALYVGIA
FT                   TLVHLVIVLLASRLQSVIQTPDKRRTIRRVLAVALAAIAIWFALSTGR"
FT   gene            complement(499092..502136)
FT                   /locus_tag="Nham_0453"
FT   CDS_pept        complement(499092..502136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0453"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61343"
FT                   /db_xref="GOA:Q1QR04"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR04"
FT                   /protein_id="ABE61343.1"
FT                   /translation="MPKKPTPATKPVPTPAAAEAVTVKSAAATKSDMQGKHVFLVDGSS
FT                   YIFRAYHALPPLNRKSDGLQVNAVLGFCNMLWKLLRDMPKDDKPTHLAIIFDKSEVTFR
FT                   NKLYPAYKAHRPPAPDDLIPQFALIREAVKAFDLPCIEQGGFEADDLIATYVRQACERG
FT                   ATATIVSSDKDLMQLVTDCVTMFDTMKDRRLGIAEVIEKFGVPPEKVVEVQALAGDSVD
FT                   NVPGVPGIGVKTAAQLITEYGDLETLLAQASEIKQPKRREALIENAEKARISRQLVLLD
FT                   DHVALDVPLDDLAVQEPDARKLIAFLKAMEFTTLTKRVADYSEVNAAEIEPDRKNASGA
FT                   SSTAAKASAEAVTSDLFGSDGVAKATSAGRTRATSDTAIKTPQALAAARLEAVRKLPVD
FT                   RTQYETIRTLDRLQHWIARIANHGSFVVEALAPTIDPMQAELSGIALALAPNAACYVPL
FT                   NHKQAGDSAGLFAAGLAPDQIAIRDALDLLKPLLESGGHLKVGFNVKFTAVLLAQHGIV
FT                   MQNNDDVELISYALDAGRGAHDLEALAQRWLDHTALNYGELIGSGRNKLAFDQVTIDRA
FT                   TTYAAEYAALTLRLWQVLKPRLVAERMNSVYETLERPMIATLARMERRGITIDRQVLSR
FT                   LSGEFAQTAARLEAEIQKLAGEPINVGSPKQIGEIMFGKMGLPGGSKTKTGAWSTSAQI
FT                   LDDLAEQGHDFPRKILDWRQVSKLKSTYTDALPEYVNPQTSRVHTTYALAATTTGRLSS
FT                   NEPNLQNIPVRNEEGRKIRRAFIATPGHKLVSADYSQIELRLLAEIADIPVLKQAFRDG
FT                   LDIHAMTASEMFGVPVTGMPGEIRRRAKAINFGIIYGISAFGLANQLGIPREEAGTYIK
FT                   KYFERFPGIRAYMDATRDFCREHGYVETLFGRKCHYPDIKSPNPSHRAFNERAAINARL
FT                   QGTAADIIRRAMVRMDDALAAKKLSARMLLQVHDELIFEVPDDEVAATLPVVQHVMQDA
FT                   PFPAMLLSVPLQVDARAADNWDEAH"
FT   gene            complement(502307..503353)
FT                   /locus_tag="Nham_0454"
FT   CDS_pept        complement(502307..503353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0454"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61344"
FT                   /db_xref="GOA:Q1QR03"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR03"
FT                   /protein_id="ABE61344.1"
FT                   /translation="MTGNGTASLKNERVDWVDYAKGICIIMVVMMHSVQGVEKAVGQDG
FT                   FMHLVVEFAKPFRMPDFFLISGLFLPLVINRDWRTYLDRKVVHFAYFYLLWTAIQFGFK
FT                   APHFAAEVGWPGVIHLYLMSFIDPFGTLWFIYLLPVFFVVIKATRRISPWAIWGAAAAL
FT                   EMAHISTGWTAIDEFAARFVYIYSGYLFASHVFALSNRARAYPAWALAALALWAVTNAG
FT                   LVYTGASEWPIISLALGLVGAGAIITIGTLLAKMHWLDAVRYCGEHSIVIYLAFFLPMA
FT                   ASRTILLKAGLIHDIGLISLIVTIVGVIGAVLIWWACRNTRANFLFERPDAFWIAPKKR
FT                   AAAIQAAE"
FT   gene            503540..506029
FT                   /locus_tag="Nham_0455"
FT   CDS_pept        503540..506029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0455"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61345"
FT                   /db_xref="GOA:Q1QR02"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR02"
FT                   /protein_id="ABE61345.1"
FT                   /translation="MTKTFASPLPIDVVLDELGRTLSASNTAVLVAPPGAGKTTRVPLA
FT                   LLDASWTKSKKIIVLEPRRIAARASAERMAKTLGERAGETVGYRVRFGSKVSRATRIEV
FT                   VTEGIFSRQILDDPELTGVAAVLFDEFHERSLDADLGLALARDVQTGLREDLRILVMSA
FT                   TIDGARIAKRLGDAPVIESEGRAFPVETRYLGRKPDAPLERQMADAIAVALRTEAGSVL
FT                   AFLPGAAEIRRTQNMLAERVHDASVEIVPLFGALDAATQDRAIAPAPKGHRKVVLATSI
FT                   AETSLTIEGVRIVVDSGMARVPRYEPDIGLTRLETIRASRAAVDQRRGRAGRTEPGVCY
FT                   RLWDEPQTASLAAYTQPEILSADLSTLVLDLAQWGVSDPAALTFLDSPPAPALNEARSL
FT                   LRELGALDADGRITDEGKSLRALALPPRLARMIVDSHRLGAGREAADIAAVLTERGLGG
FT                   DSVDLEARLDNFRRDRSPRAAGARQLAERWASQVAAPLTPPHQRGQGEAIPSTGVMLAF
FT                   AFPDRVARNRGNGSFVLVNGRGASVDPASALARRPYIAVAELTGTAASGRILLAAPITQ
FT                   TDIELRFANQIETDDEVVFDRAAMALRARRRKRLHAITLSEAPLAVVPSMAAARILAEG
FT                   LTGAGLDRLPWSKPLKQWRDRVMFLRAAQREGWPDLSDTGLAAEIETWLVPALSDATSL
FT                   KDFSPGDLSDALMALLPWNLRARLEREAPTHFEAPTGTMLAIDYQAEQGPTITVRLQEL
FT                   FGLTAHPSIAQGRVPLVLELLSPAHRPVQVTRDLPGFWRGSYAAVRSDLRGRYPRHPWP
FT                   DDPANAPPTRRVKPRGT"
FT   gene            506119..506829
FT                   /locus_tag="Nham_0456"
FT   CDS_pept        506119..506829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0456"
FT                   /product="MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61346"
FT                   /db_xref="GOA:Q1QR01"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR01"
FT                   /protein_id="ABE61346.1"
FT                   /translation="MDMPLQPTWSDIAIRLALTMIAGGIVGFDRGARGHAAGFRTIILV
FT                   GLAASVAMIQTNILLSTSGRTPESFAVMDVLRLPLGILTGVGFIGAGTIVKKGDLITGI
FT                   TTAATLWLMTVIGLCLGGGQLVIGMITTVLAVITLWALQWVDRAIPREHRARLTVTADT
FT                   EMRAMIELPRLTGGLGYRARFAEVERRDDGSIDCSFDISWRRAERSTPPADLLALIRQH
FT                   YEVKVFALTTENGR"
FT   gene            506940..507467
FT                   /locus_tag="Nham_0457"
FT   CDS_pept        506940..507467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61347"
FT                   /db_xref="GOA:Q1QR00"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QR00"
FT                   /protein_id="ABE61347.1"
FT                   /translation="MRNLMIFAALLIGAGTYMAQLADKMTATAAARVTTPAQQTAFTAI
FT                   QDNTQADSRSVSIARDGRGHFQTEGRIDGQRIGFMVDTGASVIALNETSAARIGVRPSQ
FT                   NDYTTQVTTANGKVKAARTRLAMVDVGGLIVRDVDAMVLPDEALSENLLGLSFLSRLKR
FT                   FEFANGRMLLEQ"
FT   sig_peptide     506940..506999
FT                   /locus_tag="Nham_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.784 at
FT                   residue 20"
FT   gene            507612..509111
FT                   /locus_tag="Nham_0458"
FT   CDS_pept        507612..509111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0458"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61348"
FT                   /db_xref="GOA:Q1QQZ9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ9"
FT                   /protein_id="ABE61348.1"
FT                   /translation="MFPKPKPVLAPNTYAYESEPMVKATGFREYDARWLFGKEINLMGI
FT                   QALGMGLGTLIGELGQKKEIVTGHDFRSYSSSIKYALISGLLASGCKVHDIGLCMTPTA
FT                   YFAQFELDVPCVAMVTASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLEAAFANTIG
FT                   GGYQFHENFPARYIADLTKRPKLKRKLRAVVACGNGTAGAFAPAVMEAIGCEVIPLDTE
FT                   PDYTFPKYNPNPEDMKMLHAIRDAVLEHKADVGLGFDGDGDRCGVVDNTGEEIFADKVG
FT                   VMLARDMSAIHKDAHFVVDVKSTGLFVTDPVLQQQGASATYWKTGHSYMKRRTNELGAL
FT                   AGFEKSGHFFFNAPMGRGYDDGLISAIAVCDMLDRAAGKSLADLKNALPKTWSSPTMSP
FT                   HCADEAKYGIVDSVVKHFEAAKANGDKVAGQPTRDLVTVNGVRVTVEDGSWGLVRASSN
FT                   KPELVVVVESPVSEQRMRDMFEAMDSVLRTHPEVGEYNQKI"
FT   gene            complement(509196..509705)
FT                   /locus_tag="Nham_0459"
FT   CDS_pept        complement(509196..509705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0459"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61349"
FT                   /db_xref="GOA:Q1QQZ8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ8"
FT                   /protein_id="ABE61349.1"
FT                   /translation="MSDIALQPPESGRRLDAIDRKILTVLQEDASLSVAEIGDRVGLSS
FT                   TPCWKRIQRLEADGIILRRVALVDQNKIGLGISVFVSVESGDHSDAWLKTFADAVSAMP
FT                   EVMELYRMAGDVDYMLRVVVADMASYDLFYKKLISAVALKNVTSRFAMEKIKSVTALPV
FT                   PAASAV"
FT   gene            complement(509787..510713)
FT                   /locus_tag="Nham_0460"
FT   CDS_pept        complement(509787..510713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0460"
FT                   /product="PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61350"
FT                   /db_xref="GOA:Q1QQZ7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ7"
FT                   /protein_id="ABE61350.1"
FT                   /translation="MIKKPRILCIGIPVRDMTFRVQGLPARGFKVGAEHFEEIAGGNAL
FT                   NAAIAISRLGGLAAFCGPMGDAGETSSRYIFDKAAELGIGMRDIVHMPGLVTPISTVMI
FT                   DPGGERTIITFRDPELWKVRLPDPDKLLEDCDAILTENRCAAFCTGLCAEAHRRGIPVV
FT                   VDVDSAMSMREGLLTASSHLIFSSEALQATAGVADDAAALQKLARATSSFLAGTRGAQG
FT                   TVWLDPNGALRQTPAFPVHTVDTLGAGDVFHGAFVLAITEKQDVQEALRFASAAAAIKC
FT                   TRFGGAFACPQRPEVEALLRQAASTSA"
FT   gene            complement(510935..511351)
FT                   /locus_tag="Nham_0461"
FT   CDS_pept        complement(510935..511351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0461"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61351"
FT                   /db_xref="GOA:Q1QQZ6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ6"
FT                   /protein_id="ABE61351.1"
FT                   /translation="MSAIWSLHPQLDSDTVAIGDLPLCRLLLSKDPNYPWLILVPRQPD
FT                   AVEIIDLDPDARTRLMTEIGQVSEALKDITGCDKLNVAALGNQVPQLHVHVIARRIGDA
FT                   AWPRPVWGAVPAREYDAAGLEAFINAIRRRIGLG"
FT   gene            511488..511592
FT                   /gene="ffs"
FT                   /locus_tag="Nham_R0007"
FT   ncRNA           511488..511592
FT                   /gene="ffs"
FT                   /locus_tag="Nham_R0007"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            511693..513540
FT                   /locus_tag="Nham_0462"
FT   CDS_pept        511693..513540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0462"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61352"
FT                   /db_xref="GOA:Q1QQZ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ5"
FT                   /protein_id="ABE61352.1"
FT                   /translation="MTDAGNPATSTDGAAGQSGFDLGVGPSESGAAYRVLARKYRPASF
FT                   DDLIGQEALVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGP
FT                   TIRMPKLGVHCQAIMESRHIDVLEMDAASHTGVDDVRQINDSVRYAPSSARYKVYIIDE
FT                   VHMLSTAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLKRVDADVLVTH
FT                   LGNIAAKENVEVEPEALGIVARAAEGSVRDSLSLFDQAIAHAAGVVRADAVRQMLGLAD
FT                   RTRVIDLFYSLARGDIASAFREFRDQYDTGADPVVVLSDLAEFVNFVTRIKIVPALADN
FT                   IAFGETERLRARDFAAKLSMRVLSRMWQMLLKGITEVQGATRPAAAAEMVLVRIAYVAD
FT                   LPTPDEAIRMLDRNGGESPVVPNNAAPQRPAPGSMSSAQSSAARTLSAPRAAAEPASRP
FT                   QAITPMVDPTGAVPAVRLESFTELVALAGEKRDLIIKAALEADMRLVRMEDGRLEVALE
FT                   RSAARTLVNELARKLEQWTGRRWTVIVSNEPGQPTLRSQALLQKNERERAAEADPRVKD
FT                   VLARFPGAKVVEVRKLALSPPDSDTVPDDQADGFDGGDE"
FT   gene            513556..513876
FT                   /locus_tag="Nham_0463"
FT   CDS_pept        513556..513876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0463"
FT                   /product="conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61353"
FT                   /db_xref="GOA:Q1QQZ4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQZ4"
FT                   /protein_id="ABE61353.1"
FT                   /translation="MADFLGMMKQAAQLQSKMKAMQDELDHVEVEGASGGGLVSVRMTA
FT                   KMEVKAISIDPSLMKPDEREILEDLVVSALGDARRKAEVAMQEKMQALTGGLGLPPGLG
FT                   LG"
FT   gene            513959..514561
FT                   /locus_tag="Nham_0464"
FT   CDS_pept        513959..514561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0464"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61354"
FT                   /db_xref="GOA:Q1QQZ3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQZ3"
FT                   /protein_id="ABE61354.1"
FT                   /translation="MASVAGPEIDRLIQLLARLPGLGPRSARRAALHLIKKREALMTPL
FT                   ASALQVAIDRIQICEICGNIDTRSPCTVCTDMRRDPSIIVVVADVADLWALERAGATNG
FT                   FYHVLGATLSPLDGVGPQDLTIDALVSRAHDPRVTEIVLALNATVDGQTTAHYITDLLG
FT                   EANVKVTRLAHGVPVGGELDYLDEGTLSAAMRQRTPF"
FT   gene            complement(514689..515099)
FT                   /locus_tag="Nham_0465"
FT   CDS_pept        complement(514689..515099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0465"
FT                   /product="protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61355"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ2"
FT                   /protein_id="ABE61355.1"
FT                   /translation="MDMALSAADIIARLGLKPHPEGGHYRETFRDVRTDDQGRAASTAI
FT                   YFLLARGERSRRHRIDAVEVWHYYAGSPLLLQIDDGAIMRTICLGANLAAGEVPQALVP
FT                   AYAWQTAQSSGDWTLVGCTVAPGFEFSGFELG"
FT   gene            complement(515115..515882)
FT                   /locus_tag="Nham_0466"
FT   CDS_pept        complement(515115..515882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0466"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61356"
FT                   /db_xref="GOA:Q1QQZ1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQZ1"
FT                   /protein_id="ABE61356.1"
FT                   /translation="MTADIRLFTCLTDNFGVLIHDPATDATAAIDAPEAGPIIEALDRE
FT                   GWTLTDILVTHHHADHIGGIAELKQKYKCRVVAPHDKKAPIANVDLRVGQGDIVKVGTL
FT                   LGRVLETPGHTLDHISYVFDDEKVVFAADTLFSIGCGRVIEGTYPMMWDSLLKLRALPD
FT                   DFRLYCGHEYTASNVKFALTVEPNNAALKARAEDVARLRAENKPTVPTLMGEEKKANVF
FT                   LRADDPAVAAGVHMKGASGADVFGELRERKNKS"
FT   gene            516122..516862
FT                   /locus_tag="Nham_0467"
FT   CDS_pept        516122..516862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61357"
FT                   /db_xref="GOA:Q1QQZ0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQZ0"
FT                   /protein_id="ABE61357.1"
FT                   /translation="MAIDVIDLRDFYAQRLGIVARRLINRGIHAHWPSMEGQCVVGLGY
FT                   PTPYLGLFREDCERCIAFMPAAQGVLKWPTARPALATLVDELSLPLQDAVADRILLVHA
FT                   LEMSDDPESLLREVWRVLSPSGRMMVIVPNRRGIWTRTDATPFGYGRPYSRSQITQLLR
FT                   QTWFTPSAWGEALFVPPINGGWFLRSAAAWERVGAALSLPFAGVHIVEATKQVYRPIAA
FT                   KRQHSRLIPALPPALAPSSCSAEE"
FT   gene            complement(516920..517642)
FT                   /locus_tag="Nham_0468"
FT   CDS_pept        complement(516920..517642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61358"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY9"
FT                   /protein_id="ABE61358.1"
FT                   /translation="MRNGQNNNKRMRNRNNSNNNNNNRRGQNPMTRVFESNGPDIKIRG
FT                   TASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQSQPQQQPRIDV
FT                   DTPDDAGGDDDSESYSNFGAEPGFVPVQQPRDHHQRDPQPFQRDQQQPREHRQPQPQYQ
FT                   PQPAMQPADDGGVDRLPSFITGAQPQASGSRFEGNGHQGSERNDRFPPRRRRRPHSPRP
FT                   DGMVQPPVPGEDFNSGNE"
FT   gene            complement(518137..519090)
FT                   /locus_tag="Nham_0469"
FT   CDS_pept        complement(518137..519090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0469"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61359"
FT                   /db_xref="GOA:Q1QQY8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY8"
FT                   /protein_id="ABE61359.1"
FT                   /translation="MNRARRMGRCLRGDDAGLVEATRVTESFAAQTIETARRLLTARLE
FT                   AAGIDSPALDARMLTGAALHLDLTGLIAQGPRQLTADDAACLDAFARRRLAGEPVARIL
FT                   GTKDFWGLPLKLSADTLVPRPDTETVVEAALEILRAEGRTRTPLRIADLGTGSGAILLA
FT                   LLSELPDATGVGTDLSAAALDTAKANAQRLGLAPRADFTVSDYAGGLSDPFDLIVSNPP
FT                   YIRSADIASLAPEVRDHDPHLALDGGSDGLEAYRRIAPQAAGLLAPGGLLVLEVGQGQD
FT                   GDVVRLVAAAGLTVAGPARADLAGIGRAVAARKLPF"
FT   gene            complement(519175..520260)
FT                   /locus_tag="Nham_0470"
FT   CDS_pept        complement(519175..520260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0470"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61360"
FT                   /db_xref="GOA:Q1QQY7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQY7"
FT                   /protein_id="ABE61360.1"
FT                   /translation="MSSLPEAKLDILLARHAALENELLSQISAERYVQMTRELSELNPV
FT                   VEAVKNWRAVKTEIAGIDAMIADPATDAEMRAMAEAERPALGARGDELAQKIRVALLPK
FT                   DAMDERNVMLEIRAGTGGDEASLFAGDLFRMYERFAGLQGWKVEAISASEGTMGGYKEI
FT                   VAEVRGRGAYAKLKFESGVHRVQRVPDTETQGRVHTSAATVAVLPEAEEVDVDIKTDDL
FT                   RIETMRAQGAGGQHVNKTESAIRITHIPTGIVVMMQDSRSQHKNRASAMNILRSRIYDA
FT                   ERQRINAARSADRKDQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGDALHE
FT                   LIDALTTEHQAAQLATEGGGA"
FT   gene            complement(520309..522576)
FT                   /locus_tag="Nham_0471"
FT   CDS_pept        complement(520309..522576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0471"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61361"
FT                   /db_xref="GOA:Q1QQY6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY6"
FT                   /protein_id="ABE61361.1"
FT                   /translation="MRSASSGPRVLLRRLREVMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   STYVLRVDNTLELYATEGLNRDAVHRTVLTAHEGLVGLVASEATPLNLSDAQSHPAFSF
FT                   RPETGEEIYNSFLGVPILRAGNTLGVLVVQNRARRTYVEEEVEALQTTAMVVAEMIASG
FT                   ELAALAQPGLEPAARHSIRQTGAILSDGIALGHVVLHEPRVVITNYIAEDLPKEIRRLE
FT                   AALAKLRADLDRMLERGDVVDGGEHREVLEAYRMFANDHGWSHRLQEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQDHAPSREQLPENAILIARA
FT                   MGPAALLDYDRKRLRGLVLEEGTANSHVSIVARALGIPAVGEVPNAPGIADPGDAIIVD
FT                   GTSGAIYVRPSAEIESAYAERVRFRARRQAQYIALRDKPCVTKDGQPVDLMINAGLLID
FT                   LPHLEDTNCSGIGLFRTELQFMVGQNLPRTSEQLALYRAVLDAAGDKPVTFRTLDIGGD
FT                   KAVPYMETVAEENPALGWRAIRLGLDRPGLLRGQVRALLRAGGGRALRIMFPMISEVAE
FT                   FDQAKAIIERELTYLRQHGHALPERVDVGTMVEVPALLYQLDELLRKVDFVSVGSNDLF
FT                   QFMFAVDRGNSKVSNRFDTLSAPILRALRDIVTKAKAAGKSASLCGEMASQPLGALVLI
FT                   ALGYRSLSLSATAHGPVKAMILDLDAKKAEATIMPLLDAPSGSISIRDKLRNFADAEGL
FT                   TL"
FT   gene            complement(522876..524129)
FT                   /locus_tag="Nham_0472"
FT   CDS_pept        complement(522876..524129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0472"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61362"
FT                   /db_xref="GOA:Q1QQY5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY5"
FT                   /protein_id="ABE61362.1"
FT                   /translation="MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAG
FT                   KTNDLVAWCRDASPMHDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRT
FT                   SDAHASARILGIDGSELVNRFTERKEVAVIAGFQGINPQTGRITTLGRGGSDTSAVAIA
FT                   AAIHADRCDIYTDVDGVYTTDPRVVPKARRLDRIAFEEMLELASQGAKVLQVRSVELGM
FT                   TQNMPIFVRSSFDKPEDIDPHGTPPGTLICGEEEIMESHVVTGIAFSKDEAQISLRQIE
FT                   DKPGVAASIFVPLADANINVDMIVQSVSEDGKTTDLTFTVPAADYARARETITRAKDKI
FT                   GYARLDSATDLAKISVIGSGMRSHAGVAAQAFKALSEKSINIRAITTSEIKFSLLIDTA
FT                   YTELAVRTLHTLYGLDHT"
FT   gene            524335..524802
FT                   /locus_tag="Nham_0473"
FT   CDS_pept        524335..524802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0473"
FT                   /product="membrane-flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61363"
FT                   /db_xref="GOA:Q1QQY4"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY4"
FT                   /protein_id="ABE61363.1"
FT                   /translation="MARYIDDILQPGEKVLYSTNVHWIFYLPAIAAWIVAVVLLMVSRM
FT                   FVTQTPMLLCLALAVIAALVALYWMLGAWFHRWTTETDVTNLRVVHKTGFIKRRTFEMS
FT                   LDKVESVDVNQSILGRILNYGDVTVRGVGEGAERIRSIASPLAFRSHITAR"
FT   gene            524818..525591
FT                   /locus_tag="Nham_0474"
FT   CDS_pept        524818..525591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0474"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61364"
FT                   /db_xref="GOA:Q1QQY3"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY3"
FT                   /protein_id="ABE61364.1"
FT                   /translation="MAMQVNPSANSSAAPGSTVDPAEIAKFSKLSQEWWDPNGKMAPLH
FT                   KINPLRLQFIRDAACRKFERSARSLNCLADLRLLDIGCGAGLLCEPFTRLGAQVIGVDP
FT                   SATNIAAAKLHAEKAHLSIDYRCTTVEDMDVRERFDIILAMEVVEHVADVGLFLDRCAA
FT                   MLKPGGMMVASTLNRNWKSFALGIVAAEYVLRWLPRGTHQWDKFVTPDELARHLERNRL
FT                   GITEQSGVVYSPFADKWSLSSDMGVNYMVVAEAIG"
FT   gene            525760..526698
FT                   /locus_tag="Nham_0475"
FT   CDS_pept        525760..526698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61365"
FT                   /db_xref="GOA:Q1QQY2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY2"
FT                   /protein_id="ABE61365.1"
FT                   /translation="MRRLQWFKLPTSFMLTVASLWIPFTVTAAFGQVARNAMQRSLTGP
FT                   LGTWGATNIRFLFGFPFALIFFALVIAFSGDPVPWPVAAFWLWLLLGALTQIVATGLML
FT                   LAMNDRSFVVTTAYLKTEAIQTAIFGFVFLGDHLTVLKVVAILIATVGVVITALRPGGA
FT                   RGFADLKPTVLGLVAAASFALSAVGFRGAIIVVPGVSFVTAASYTLVFGLFVQTAVLTA
FT                   YLLLRAPDVPKKILGLWRPSMVAGFLGAFASQFWFLAFALTAAANVRTLALVEVLFAQA
FT                   VSYYSFKQPFSFHEIGGIVLILIGVGLLVAV"
FT   sig_peptide     525760..525846
FT                   /locus_tag="Nham_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.557 at
FT                   residue 29"
FT   gene            complement(526699..527139)
FT                   /locus_tag="Nham_0476"
FT   CDS_pept        complement(526699..527139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0476"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61366"
FT                   /db_xref="GOA:Q1QQY1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY1"
FT                   /protein_id="ABE61366.1"
FT                   /translation="MTLDTFPSWLFWALLSAAFAALTAIFAKVGVEGINSDLATFLRTI
FT                   VVLVSLGLILLATGQFSHPGPIPTRSWIFLVLSGLGTGASWLCYFRALKLGPATLVAPI
FT                   DKLSVVLVALFGVVFLGERPSLNGWIGIALIAAGAVVIALKR"
FT   sig_peptide     complement(527068..527139)
FT                   /locus_tag="Nham_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.353 at
FT                   residue 24"
FT   gene            complement(527146..527589)
FT                   /locus_tag="Nham_0477"
FT   CDS_pept        complement(527146..527589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0477"
FT                   /product="protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61367"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQY0"
FT                   /protein_id="ABE61367.1"
FT                   /translation="MIRYNLRCHRGHSFESWFQNSSAYDSQVKRKLVTCAVCGSTKVEK
FT                   AIMAPQIAGSKKRGGPVPADSSMPATMAQERELRAELRELHDHLVKNADNVGTRFPKEA
FT                   RKMHYGDIEHRPIYGEASPEEAKSLIEEGVEVGSLPVLPDDRN"
FT   gene            complement(527586..527828)
FT                   /locus_tag="Nham_0478"
FT   CDS_pept        complement(527586..527828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61368"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX9"
FT                   /protein_id="ABE61368.1"
FT                   /translation="MIRYNLRCERGHTFESWFQSSSSYDSQVKRKLVTCAVCGSAKVEK
FT                   AIMAPQIAGSKKRRTPRLAAAPAFMVDDPPERGSA"
FT   gene            complement(527825..528706)
FT                   /locus_tag="Nham_0479"
FT   CDS_pept        complement(527825..528706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0479"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61369"
FT                   /db_xref="GOA:Q1QQX8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX8"
FT                   /protein_id="ABE61369.1"
FT                   /translation="MDTETTFIAAMVQMRAGLLPEPNLDQGARLIREAAAQGASFVQTP
FT                   EVSNMMQTNRVALFEHLRSEDDDRSLAGYRDLARELGIHLNVGSLALQATPEKAVNRSF
FT                   LIGPSGDILARYDKIHMFDIDLGGGESYRESANYQPGETAVITDLPWGRLGMTICYDVR
FT                   FPALYRALAEAGASFLTVPSAFTKKTGEAHWHTLLRARAIENGCFVFAAAQAGLHENNR
FT                   ETFGHSLIVDPWGTVLAEGGGTEPGIVLATIDPAKVATARKTVPSLQHGRRFSIVDHKA
FT                   ASDHLHLVRGSA"
FT   gene            complement(528759..529571)
FT                   /locus_tag="Nham_0480"
FT   CDS_pept        complement(528759..529571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0480"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61370"
FT                   /db_xref="GOA:Q1QQX7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX7"
FT                   /protein_id="ABE61370.1"
FT                   /translation="MDASTDGQAPPRANPLRAALLACYGVVSHAARTALDVALPTLCVA
FT                   CREPVAGVGVCADCWTKLSFIERPYCPRLGTPFVYDPGTNMLSMEAIANPPAYQRARAA
FT                   VRYDDVAKVLVHALKYQDRTDLAPAMGRWMARAGTELLDGADVLIPVPLHWRRGWSRRY
FT                   NQSGALARIIAGQSGVPIVPDALRRIRPTRQQVGLSKNDRARNVQGAFKIATERTSRIQ
FT                   GRRVIVIDDVLTSGATVDACARVLLRAKAAQVDVLVFARVVDTMKAPI"
FT   gene            529735..530673
FT                   /locus_tag="Nham_0481"
FT   CDS_pept        529735..530673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0481"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61371"
FT                   /db_xref="GOA:Q1QQX6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX6"
FT                   /protein_id="ABE61371.1"
FT                   /translation="MGPCVRRDDRWRMLPIASGGEIGVPSRMAPNPSSPPVLFDRALLR
FT                   VRQRRAAKIGAVPFLLDRVAEDMAERLQAVLRVFQHAADIGTPGDQVRGALAARVTDTA
FT                   SVDLPVDESDALGLPPESLDLAVSGLAFQFVNDLPGVLAQIRRALKPDGLLLAATIGGE
FT                   TLTELRQAFAAAESELEGGISPRVAPFADLRDAGALLQRAGFALPVTDVDRVVVRYDDA
FT                   FGLMHDLRGMGATNVLAERRRTPLRRATLLRMAQIYRERFTDPDGRIRATFDIVWLSGW
FT                   APHESQQKPLQPGSAKASLEEAVKGRGPKQD"
FT   gene            complement(530806..531258)
FT                   /locus_tag="Nham_0482"
FT   CDS_pept        complement(530806..531258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0482"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61372"
FT                   /db_xref="GOA:Q1QQX5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX5"
FT                   /protein_id="ABE61372.1"
FT                   /translation="MTQDWVDSPPRPPEEGKVKLTLVVACALIDVDNRVLIAQRPEGKQ
FT                   LAGLWEFPGGKFEPGERPEQALIRELCEELGIVTQEACLAPLTFASHAYESFHLLMPLY
FT                   ICRRWQGDVTPKEGQALKWVRANKLRDYPMPPADIPLIPPLIDLLM"
FT   gene            complement(531388..532668)
FT                   /locus_tag="Nham_0483"
FT   CDS_pept        complement(531388..532668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0483"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61373"
FT                   /db_xref="GOA:Q1QQX4"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX4"
FT                   /protein_id="ABE61373.1"
FT                   /translation="MDCRIKSGNDEKAMSTAISPLAPTDIPDMPAIAGVRLATAAAGIR
FT                   YKGRTDVLLALLDKGTTVAGVFTRSKCPSAPVEWCRALLNSRSARALVVNSGNANAFTG
FT                   KTGRQSTKLTADIAAKAAGCKATDIYLASTGVIGEPLDATKFNGVLETLARDAAPDRWM
FT                   DAARAIMTTDTFPKVATARVKLGRATITINGIAKGAGMIAPDMATMLSFVFTDAPISAA
FT                   ALQSLLKSGVEDTFNAVTIDSDTSTSDTLLAFATGAASAHGAPKISRASDPRLKAFAKA
FT                   FHGVLADLAEQVARDGEGARKLVEVIVEGATSKQSARRIAKSIANSPLVKTAIAGEDAN
FT                   WGRVVMAVGKAGEPADRDKLSIAFNGIRVATRGARDASYDEAEVSAAMKSPTIQIKVAL
FT                   GLGKGRDRVLTCDLTKEYVAINGDYRS"
FT   gene            complement(532719..533645)
FT                   /locus_tag="Nham_0484"
FT   CDS_pept        complement(532719..533645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0484"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61374"
FT                   /db_xref="GOA:Q1QQX3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX3"
FT                   /protein_id="ABE61374.1"
FT                   /translation="MTTSLPATKHSLRVRLALSALGGCLALTLLVGTPVRADDLNPVLA
FT                   KVNGSEIRQSDVNVAEEELGPGLAQMDPAAKQENVLSFLIDMKIIAKAAEDKKIENSED
FT                   FKKRLAFARDRLLMDKLLASEGKAAITDEAMKTVYADASKQITSEEEVHARHILVPTEE
FT                   EAKKVEDELKKGADFAELAKKESKDPGASDGGDLGFFTKEQMVPEFSKVAFALEPGKIS
FT                   DPVKTQFGWHIIKVEEKRARKAPAFDQVKPQIEQFVTRKAQADYVAKLRETAKIERLDK
FT                   PAEPAKAGGDKTGPAKPANGKTAPAKK"
FT   sig_peptide     complement(533532..533645)
FT                   /locus_tag="Nham_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            534221..537076
FT                   /locus_tag="Nham_0485"
FT   CDS_pept        534221..537076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0485"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61375"
FT                   /db_xref="GOA:Q1QQX2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQX2"
FT                   /protein_id="ABE61375.1"
FT                   /translation="MIGALARKFFGSANDRRVKGYQARVKAINGLEPEIAALSDEALRA
FT                   RTAEFRQQLADGKTLDDILVPAFATVREAGKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLAVYLNALAGKGVHVVTVNDYLASRDAGWMAQIYTFLGLTTGVIVHGLDD
FT                   VERKAAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQREHFYAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSEFYNTIDTFMPNLEKVADYEVDEKQRTVALTEAGMEKIETLLRDAGQL
FT                   KGDSLYDVENVSVVHHINQALRAHSLFTRDKDYIVRDDEVVIIDEFTGRMMQGRRYSEG
FT                   LHQALEAKEHVTVQPENQTLASITFQNYFRMYKKLSGMTGTALTEADELADIYKLEVVE
FT                   IPTNLPIARLDEDDEVYRTQNEKYAAILAEVERANARMQPVLVGTASIEKSEVLADYLK
FT                   KNGYKLIDFGDPKSMRKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIAT
FT                   NMAGRGTDIKLGGSLEMRAQFETADLADEAEKDAKIAEIKADIERFRDMVLKAEDVVEI
FT                   EPAKGSKPAKTVTRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLM
FT                   RIFGSDRLDTMLQRLGLKDGEAITHPWINKALEKAQQKVEARNFDIRKNLLKYDDVQND
FT                   QRKVIFDQRVDLMMNESVAETVADMRHAFVDDLVTKHVPENQYAEQWDVAGLKEELRRV
FT                   LDIDLPVDEWAAEEGIADEELLSRIENRVDEHMAAKVGQWGPDVMRYVEKTILLQTLDH
FT                   LWREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFSLFEALIAHLREAVTGQLMRVEIV
FT                   PPEEEQPVLPAMEVHKLDPHTGEDEMAFAQGNFAQASLAPVVSADRSSRDPGNPASWGK
FT                   VGRNEDCPCGSGKKYKHCHGR"
FT   gene            complement(537367..538875)
FT                   /locus_tag="Nham_0486"
FT   CDS_pept        complement(537367..538875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0486"
FT                   /product="protein of unknown function DUF949"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61376"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQX1"
FT                   /protein_id="ABE61376.1"
FT                   /translation="MDLGYSFARCLRSFALIRRTIVRAVMMSAVLASGAFLAGCNGNDA
FT                   SLASNAKANQPVPPKLVAAMTEKDMELQSPILIRLFKQEAELEVWKQNRSGKFALLKTY
FT                   PICRWSGDLGPKTREGDRQAPEGFYSISPAQMNPRSAYYLSFNTGYPNAFDKSLGRTGS
FT                   ELMVHGDCSSRGCYAMTDEQIAEIYALGRESFFGGQHAFQFQAYPFHMTPVNLAKHRNN
FT                   PNMPFWKMIKEGSDHFEVTHQAPKVEFCEHKYVFDPAPPPGSTRPLEFNASAACPAYVV
FT                   PDDIASAVREKQQRDNAELAKLISKGTPVAKLNTGIDGGMNRVFAAKLPEGQTGLSDPV
FT                   EPGLKNTAFSPAPGTIPPTVNPPRGSAAATVATSFEPEADVTRPSSSLLAPSPPNNIFT
FT                   NLASKIGFGAADTTATTRQPAPAKPKTATPARSAPHGPTVAAKHAAPRKTTETAAGKVA
FT                   RPEHVATARPPSKPAAATDAPTPNPGAAPVASTGSFDSRFSAFR"
FT   gene            complement(539076..540038)
FT                   /locus_tag="Nham_0487"
FT   CDS_pept        complement(539076..540038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0487"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61377"
FT                   /db_xref="GOA:Q1QQX0"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQX0"
FT                   /protein_id="ABE61377.1"
FT                   /translation="MPDPMRSYLDFEKPVAELDSKIDELRALAASGSDIGEEISSIGDK
FT                   AAQALKDLYANLTPWQKTQVARHPQRPHFSDFIKGLITEFTPLAGDRKFGEDEALIGGF
FT                   GRFRGESICVIGQEKGATTESRLKHNFGMARPEGYRKAVRLMDMADRFDIPVLSLVDSA
FT                   GAYPGIGAEERGQAEAIARSTDTCLSLGVANVAVIIGEGGSGGAIAIATASRVLMLEHA
FT                   IYSVISPEAASSILWRDSSKAQEAATNMKITAQDLLRFGVIDAILKEPPGGAHRDPAAT
FT                   VALTGDAIAEAFNDLRNLDRDTLRKQRRQKFLDIGRKLG"
FT   gene            complement(540250..541209)
FT                   /locus_tag="Nham_0488"
FT   CDS_pept        complement(540250..541209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0488"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61378"
FT                   /db_xref="GOA:Q1QQW9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW9"
FT                   /protein_id="ABE61378.1"
FT                   /translation="MKTDKTSDAKLTNLFLDMLAAEQGAGDNTLDAYRRDLEDLSAFLT
FT                   RVGQTFVTAGTQTLRDYLGDLDVRGFKSSSVARRLSAMRHLFRFLLSERIRSDDPAAIL
FT                   SGPKRGRSLPKVLSIADVDRLLACAKAAMETPDASPARRLRAARLYCLLEVLYATGLRV
FT                   SELVSLPLSAARRDARMIVVRGKGNKERLVPLNEASRQAMADYLAAMADRRGADKAVAV
FT                   QPKWLFPSFGESGHLTRQHFARELKELAAAAGLAPRLVSPHVLRHAFASHLLHNGADLR
FT                   IVQTLLGHTDISTTQIYTHVVEERLKSLVRDLHPLAEA"
FT   gene            complement(541226..541372)
FT                   /locus_tag="Nham_0489"
FT   CDS_pept        complement(541226..541372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61379"
FT                   /db_xref="GOA:Q1QQW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW8"
FT                   /protein_id="ABE61379.1"
FT                   /translation="MPSLLRFLTVVAALGAIGYGVIFALANFVNPTPREMTVTIHPDKF
FT                   LKK"
FT   sig_peptide     complement(541292..541372)
FT                   /locus_tag="Nham_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.574 at
FT                   residue 27"
FT   gene            541674..542348
FT                   /locus_tag="Nham_0490"
FT   CDS_pept        541674..542348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0490"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61380"
FT                   /db_xref="GOA:Q1QQW7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW7"
FT                   /protein_id="ABE61380.1"
FT                   /translation="MTSETVSPAGAGTPTEAAIVAALGGRSLVLVGMMGAGKSTIGRRL
FT                   ATRLAMRFVDADAEIERAAGMSIPEIFETHGEPHFRDGEARVIARLLSGGPLVLATGGG
FT                   AVLREETRARIRERAISIWLKADAEVILRRVRRRADRPLLQTADPAATIGRLIAEREPV
FT                   YQLADIMVVSCDVPYERIVDECIDLLHGRLCRGGTTELKPPGARDERPDEGFDTKGFGT
FT                   TR"
FT   gene            542345..543496
FT                   /locus_tag="Nham_0491"
FT   CDS_pept        542345..543496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0491"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61381"
FT                   /db_xref="GOA:Q1QQW6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQW6"
FT                   /protein_id="ABE61381.1"
FT                   /translation="MSAPLKNSDPVTVDVALGDRSYDIVIGRGILPSLGERIAALRPGA
FT                   RVAIVTDEYVATHWLRATEASLLGAGIATSRIVVDEGEVSKSYEGIEFVCEELIKARIE
FT                   RNDLVVALGGGVVGDLAGFAAAIVRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNL
FT                   VGAFHQPILVVADTAVLDTLSPRQFRAGYAEVAKYGLLGDEAFFAWLETNHADIVKGSA
FT                   ARESAVAASCRAKAAIVARDERETGERALLNLGHTFGHALETATGFSDRLYHGEGVSIG
FT                   MVLAAELSAQLGMIADADVARIRRHLATAGLPTRLQDIAGFRQEGLADADGLMALMAQD
FT                   KKVKRGRLTFILLQAIGQAVVSSDVEPSTVRDFLARKLADAPA"
FT   gene            543685..545037
FT                   /locus_tag="Nham_0492"
FT   CDS_pept        543685..545037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0492"
FT                   /product="protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61382"
FT                   /db_xref="GOA:Q1QQW5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW5"
FT                   /protein_id="ABE61382.1"
FT                   /translation="MSSTLFQILLAVLLLAANAFFVAAEFALVKSRGFRVKAMVERGAF
FT                   GARLVRDIMGNIEAYLACCQLGITMASLGLGWVGEPVVAALLEPLLRPFGMPQSALHLI
FT                   SFLTGFLVFSSLHIVIGEQVPKTLAIRQPEPVSQWIAYPLHASYVLFYPLNWLLNSASR
FT                   AILRALRVKELSQHEVLSGAEIEGLVGESAEYGGIESGEAEYIQNVFRFGDLAVSDVMV
FT                   HRTAMVTVNADLPPEELVREVLASEYTRVPLWRDKPENIVGVLHAKDLLRAICASEGDI
FT                   ARINASALALPPWFVPEMRPVSDQLKAFRRRKTHFALVVDEYGEVEGMVTLEDVLEEIV
FT                   GDISDEHDVVVAGVRQQADGSVVVDGSVPIRDLNRAMDWHLPDEEATTIAGLVIHEARS
FT                   IPERGQNFTFHGFRFRVLRRERNRITALRIQPVPREAEAMENRPRRAGTAF"
FT   sig_peptide     543685..543759
FT                   /locus_tag="Nham_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.792 at
FT                   residue 25"
FT   gene            complement(545201..545530)
FT                   /locus_tag="Nham_0493"
FT   CDS_pept        complement(545201..545530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0493"
FT                   /product="type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61383"
FT                   /db_xref="GOA:Q1QQW4"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW4"
FT                   /protein_id="ABE61383.1"
FT                   /translation="MGWNNRKADRVTFATGYSVLMMGIDGTWQRPCTLLDISNSGALLQ
FT                   VKDSIEGLNLREFFLLLSSTGLAFRRCELVRVNGDEIGVKFAEDRVPAKKAGKKKSRAL
FT                   ARSDS"
FT   gene            complement(545534..546667)
FT                   /locus_tag="Nham_0494"
FT   CDS_pept        complement(545534..546667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61384"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW3"
FT                   /protein_id="ABE61384.1"
FT                   /translation="MSETASTALIVELESAVKGGTSERRLQMLRQVTDLFLSDADRLNE
FT                   NQIGVFDDVLVRLTEQMEARALAQLSTTLSGSSHAPKETVRQLAYHQEVSVAAPVLSKS
FT                   ARLSEGDLIAIANLRGPQHLLAISSRNALSEGVTDVLLKRGDSHVSHALARNTGARFSE
FT                   FGYATLVESSAKDDALAEKLGLRMDIPIKVLRELLSRAGAAVRDRLLKAAPPELRAKIQ
FT                   EAIQSVVEQIVAPALAPIDYTESEAMVLALNRAGKLGDQTINRFATQGEYTHIVAALSL
FT                   LTSVKIEAIEPLIANPRPDGLIVACKASRLDWSTANMILRNRPHCRPLTRQELDDGREV
FT                   FDTLSLSSAQRTIRFWSARGSARKADAPDTAVAISDI"
FT   gene            complement(547026..547322)
FT                   /locus_tag="Nham_0495"
FT   CDS_pept        complement(547026..547322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0495"
FT                   /product="transcriptional regulator, BolA protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61385"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW2"
FT                   /protein_id="ABE61385.1"
FT                   /translation="MGVKSLAMSLKDSITKKLSEAFTPESLDVADESHLHEGHAGHRPG
FT                   GGTHFRINIVSRAFEGKGRVDRHRMINMLLAEELAGSVHALAIRALTPGEQGR"
FT   gene            547407..548063
FT                   /locus_tag="Nham_0496"
FT   CDS_pept        547407..548063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0496"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61386"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW1"
FT                   /protein_id="ABE61386.1"
FT                   /translation="MVMPIDASKFFDSIRIKPTRAGAKQPRVREEAVGCEWPDCQNKGS
FT                   HRAPKGRGNEREYFHFCLNHVRAYNQSYNFFQGMNADAVARYQKDALTGHRPTWKMGAN
FT                   GTKGKGKTGDIDLEGMADPFSVFGELNGRGKWRPGPGSGAEAKPETRKIFNAERKALQV
FT                   MGLGADATLETVKAKYKLLVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRGA"
FT   gene            complement(548074..548793)
FT                   /locus_tag="Nham_0497"
FT   CDS_pept        complement(548074..548793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61387"
FT                   /db_xref="GOA:Q1QQW0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQW0"
FT                   /protein_id="ABE61387.1"
FT                   /translation="MNRRSPTAFDSGVSELREDDFVTDYVAQLTGLVSAHAGLAYLTVF
FT                   LAALLEAIPVFGSVIPGSTIILALSALIGGGELEFLPVMLAAIIGAVIGDGSAFWIGHR
FT                   SQRDILSAWPLARYPGVVAQSEAFFNRYGTLAVFLARFVAPVRAFVPLTAGALGMPPQR
FT                   FYGVNIAAIVLWASAHILPGIVAVSVLHRYGGIDHPAALVRHYWLPTVLGAGLIAGLVV
FT                   WYVRRRRGINAPVKRQA"
FT   gene            549012..550010
FT                   /locus_tag="Nham_0498"
FT   CDS_pept        549012..550010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0498"
FT                   /product="cobaltochelatase CobS subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61388"
FT                   /db_xref="GOA:Q1QQV9"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV9"
FT                   /protein_id="ABE61388.1"
FT                   /translation="MTTAAMPKTETPAGLPDMKVSVRQVFGIDSDLEVPAYSEADPHVP
FT                   DVDPDYRFDRATTLAILAGFARNRRVMVTGYHGTGKSTHVEQVAARLNWPCVRVNLDSH
FT                   ISRIDLVGKDAIVIKDGKQITEFRDGILPWAYQNNVALCFDEYDAGRPDVMFVIQRVLE
FT                   SSGRLTLLDQSRVIKPHPAFRLFSTANTIGLGDTSGLYHGTQQINQAQMDRWNIVTTLN
FT                   YLPHDNEVEIVLAKAKHYRTSAGRDTVGKMVRLADLTRNAFANGDLSTVMSPRTVITWA
FT                   ENAEIFNDLGFAFRVTFLNKCDELERPLVAEFYQRCFNVELAESAVNVALS"
FT   gene            550159..552096
FT                   /locus_tag="Nham_0499"
FT   CDS_pept        550159..552096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0499"
FT                   /product="cobaltochelatase CobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61389"
FT                   /db_xref="GOA:Q1QQV8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV8"
FT                   /protein_id="ABE61389.1"
FT                   /translation="MERRKTANAFMSTTPPSNRFRTGPKEAPSEPFKRAVASCLRAIAR
FT                   QSELEVTFAAERPGLSPGKARLPEPGRKMSKRDAAVVRGHADSIALKIACHDPKVHRRL
FT                   MPGNPQARGVFDAVEQARVEAVGSRRMTGVAKNLTAMLDDHFHRGKYDEITDRADAPLS
FT                   DALAMMVRERLTGLPPPAAARKMVDLWRPFLEDKIGTRLDRLCHLTEDQAKFGDVVHDL
FT                   LAALDLGGDTNAEADKDETQDDDRESESDQSGAEGSADSDAVQEMSADQAQETTDEMSD
FT                   SAMESAQASASDSFDDGDLGDDETPGEATRPNARGGNEPRGPEYHAFAPKFDEVIAAED
FT                   LCDHDELERLRSYLDKQLAHLQGIVARLANRLQRRLMAQQNRAWEFDLEEGILDPARLA
FT                   RVVIDPYQPLSFKHEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGV
FT                   KVEILGFTTRAWKGGQSREAWLAAGKPVAPGRLNDLRHIIYKSADAPWRRARKNLGLMM
FT                   REGLLKENIDGEALDWAHKRLLARGEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRW
FT                   VIEEIETRSPVELIAIGIGHDVTRYYHRAVTIVDAEELGGAITEQLAELFSETHDPPEP
FT                   PARRPRRLHS"
FT   gene            552344..553423
FT                   /locus_tag="Nham_0500"
FT   CDS_pept        552344..553423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61390"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV7"
FT                   /protein_id="ABE61390.1"
FT                   /translation="MQKRVSSQPGRRAVLKWGATIASFAINPAARAQFATHPRKQPAPD
FT                   ELTPPAPVSITVNARPISSFDLRDRSRTRFGALAFRSGLILTSSFRGFGGLSSLRLDPK
FT                   GQRFISASDKGTWITGRIVYGAREMTGLADVEAAPMLGHDGRPITARGWFDTESIALDG
FT                   SLVYVGIERVNRIMRFDFGKGFTRARGEDVEVPPAIRKLPFNRGLEAMVVVPCDRPLGG
FT                   TLIAISERGLDAGRNIVAFLIGGPSPGRFSIRRTDNFDISDACLLPSGDLLILERKFSL
FT                   IGGIGIRIRRIAINAIAPGALVDGPSLFEADLGQEIDNFEGLDAFVNDNGDIVLTLVSD
FT                   DNFSLIQRTLLLQFTLVED"
FT   sig_peptide     552344..552442
FT                   /locus_tag="Nham_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.840) with cleavage site probability 0.838 at
FT                   residue 33"
FT   gene            553559..554440
FT                   /locus_tag="Nham_0501"
FT   CDS_pept        553559..554440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0501"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61391"
FT                   /db_xref="GOA:Q1QQV6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV6"
FT                   /protein_id="ABE61391.1"
FT                   /translation="MSVLMSSSGNSSRKTAFVFAGGGSFGAIQVGMMHALAAHGVVADM
FT                   VVGSSVGALNGAYYAGVPTLDGAKHLADIWRGLRREDVFPVSIWTLLEFFWRRDFLISH
FT                   DGVRKLIDDHLPYKNLEDAKLPVHIVTTNIVTGGSVVLSDGPAAEAIVASTSIPGVFAP
FT                   VLHKGMYLADGAISSNTPVNVAIEKGARRLVVLPTGFACAGDAPPKGAVANVLHAVTLL
FT                   ISRQVIDDLEYIDPSVEFHVVPPLCPLVGSAYDFSRTDEHIERAIRKTEQWIAGGGLEQ
FT                   HGIPGEMRPHAH"
FT   sig_peptide     553559..553681
FT                   /locus_tag="Nham_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.506 at
FT                   residue 41"
FT   gene            complement(554633..554926)
FT                   /locus_tag="Nham_0502"
FT   CDS_pept        complement(554633..554926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0502"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61392"
FT                   /db_xref="GOA:Q1QQV5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQV5"
FT                   /protein_id="ABE61392.1"
FT                   /translation="MSRRCELTAKAPMVGHKVSHSNIKTKRRFLPNLVNVTFLSEALAS
FT                   PVRLRVSTHALKSVDHRGGFDAFLLKAKNAELSPKAIEIKRRIEKKQAANAG"
FT   gene            555422..556282
FT                   /locus_tag="Nham_0503"
FT   CDS_pept        555422..556282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61393"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV4"
FT                   /protein_id="ABE61393.1"
FT                   /translation="MTLPRSMLASLRTLAGASLALLAAMLAMTGPAAAQGKLEAHYDVT
FT                   LAGILVGTGTWAVDILDDQYSAAADGGATGILKAFAHGTGTGTSQGRVVNGALVPANYT
FT                   ATISSSKKSETIRMSLAGGNVKDFVIEPTPPVDAKRIPVTDAHKRGVFDPMSATLLRVP
FT                   GTADPLGPEACHATTGIFDGRMRYDLRLDFKRMETVKSEKGYHGPVVVCSIYFSPISGY
FT                   VPDRFAIKYLAAQRNMELWLAPIAGTRVVVPYRLTIPTPLGIGKLEATQFITTAMPPRA
FT                   AAKAH"
FT   sig_peptide     555422..555526
FT                   /locus_tag="Nham_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 35"
FT   gene            556605..560027
FT                   /locus_tag="Nham_0504"
FT   CDS_pept        556605..560027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0504"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61394"
FT                   /db_xref="GOA:Q1QQV3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV3"
FT                   /protein_id="ABE61394.1"
FT                   /translation="MAFSSSISPPGNGRAPGTGVTAVLGPTNTGKTHLAIERMLAHSSG
FT                   IIGLPLRLLAREVYNKIADRAGPDSVALITGEEKIKPARPRFWVSTVEAMPRDLDVSFL
FT                   AVDEIQISADLERGHVFTDRILHRRGRDETLLLGAATMRPIIERLLPGASIVTRPRLSQ
FT                   LEFAGDRKITRQPRRTAIVAFSADEVYAIAELIRRQHGGAAVVLGSLSPRTRNAQVAMF
FT                   QSGDVDYLVATDAVGMGLNLDVDHVAFASDRKYDGYQFRRLTPAEFAQVAGRAGRATRN
FT                   GTFGTTGRCAPFEPELVNALQNHTFEAVKTLQWRNSDLDFSSLGALQVSLALTPPHEAL
FT                   TRAPIAEDLRVLDHAARDVDVRAMAHGAAAVERLWDACQIPDYRKIAPAAHAELVTTLF
FT                   GFLMRKGRVPDDWFAAQIAQADRIDGGIDTLSGRIAQIRTWTFVANRPDWLADPEHWQG
FT                   ISRQVENKLSDALHQRLTERFVDRRTSVLMRRLRENTMLDTEIGKTGEVIVEGHVIGRL
FT                   DGFTFAPDAAEAGSEAKALQAVAQKALAGEIEARAEKLSGAPDDQFVLTSDGTIRWTGD
FT                   AVARLAAADDVLHPRLRIISDERLTGAPRDAVQARLDLWLKTHIEKLLGPLFELSKAED
FT                   VTGIARGIAFQLIEALGVLERSRIAAEMKDLDQPSRASLRKYGVRFGAYHIYFPALLKP
FT                   AARSLASLLWAQKQDNCDLSALSSAQHLAGSGRTSFPADKLLDRDAYRTLGYRQCGERA
FT                   VRVDILERLADLIRPALAWREGAPGEKPAGAFDGRGFVVTQAMTSLAGTAGEDFASILR
FT                   ALGYRMEQCLPPPVTETGPAPDAAAETVSAEAPESTPPGSAAPDAMPEGQEPAPDSAVA
FT                   PDAGSAEPASAADAGSSDDTATATEVLATEALAEVVEETSPSAVSPPDIADSAASDDAV
FT                   ETAPADATPDQSVPADAEGVASAEIAAADASSAHATDAAPATVEVWRPGGRPADRRPRH
FT                   DRSRHRRQQPRQDGAQPAVADGEAGEGAQKRERHGRGRRERQKEARRPSTGVAAEGASA
FT                   GSESAPGRELREGKGRPQRDPFQGKGKNRDRDQDKGRFQGSRKGGREGRPDAGPSHRPY
FT                   ASSAPRERERPMDPNSPFAKLAALREQLAGRKD"
FT   gene            560106..560381
FT                   /locus_tag="Nham_0505"
FT   CDS_pept        560106..560381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0505"
FT                   /product="heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61395"
FT                   /db_xref="GOA:Q1QQV2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV2"
FT                   /protein_id="ABE61395.1"
FT                   /translation="MERQRLDKWLWHARVVKARTHAAALVEAGHVRINGIREKSPGHPL
FT                   KVDDVLTIGLDRCVRILRVTGFSERRSNAADAKALYDDVSDAAGRS"
FT   gene            560618..560956
FT                   /locus_tag="Nham_0506"
FT   CDS_pept        560618..560956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0506"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61396"
FT                   /db_xref="GOA:Q1QQV1"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV1"
FT                   /protein_id="ABE61396.1"
FT                   /translation="MTYVVNDACIKCKYTDCVEVCPVDCFYEGENMLVIHPDECIDCGV
FT                   CEPECPAEAIKPDSEPGLEKWLELNADYAKSWPNLTQKKDAPPDAKEFEGQEGKFEKYF
FT                   SPNPGTGD"
FT   gene            561346..562125
FT                   /locus_tag="Nham_0507"
FT   CDS_pept        561346..562125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0507"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61397"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQV0"
FT                   /protein_id="ABE61397.1"
FT                   /translation="MPSKTARIPAKATASKTAASKTAAASKAGSRTATRPAAKPASKTA
FT                   VAGKSAVKAGAPRVDEPKKVLTQRQGFRTNEFVVYPAHGVGQILAIEEQEIAGARLELF
FT                   VINFMKDKMTLRVPTAKIANVGMRKLSEPGLVKRALETLKGRARIKRTMWSRRAQEYEA
FT                   KINSGDIVAIAEVVRDLYRSESQPEQSYSERQLYEAALDRLSREIAVVQHVTETEAVKE
FT                   IEGQLAKSPRRGAKAESDAETDADADGDDATVADEAA"
FT   gene            complement(562424..563917)
FT                   /locus_tag="Nham_0508"
FT   CDS_pept        complement(562424..563917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0508"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61398"
FT                   /db_xref="GOA:Q1QQU9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQU9"
FT                   /protein_id="ABE61398.1"
FT                   /translation="MAVSAERRGTGVSRRLLAAPAVLCAALALAGCGDMSRFQTASHPS
FT                   AATPAKPARTAVHTPAAEREHERILASYGGAYDDPRLEALINKTVERLVAVSERPDLAY
FT                   KVTILNSGAVNAFALPTGQLYVTRGLVALANDTSELSSVLSHEMAHVLAKHAAIREDQA
FT                   RQAALVSHVVTEMGTDPDLTALALAKSKLTLASFSRAQEFEADGIGVGISARAHFDPYG
FT                   AARFLAAMERNAALKAGKPSLDPRSQDFLSSHPATPERVQNAQANARQYSAPAHGERDR
FT                   EIYLDAIDNIVYGEDPSEGFVRGRRFLHPKLGFTFQAPEGFALDNTAQAVIGVREGGSQ
FT                   AMRFDVVRVPAEQKLTEYLNSGWMENVDKASTEELTINGFPAASAVASGEQWQFRVYAL
FT                   RFGSDVYRFIFATRHKTTESERNARETVASFRRLTLDEIQAARPLRIKVITVQPGDTVE
FT                   SLSHRMAGVDHPAERFRVLNGLDPHAQVKVRSRVKIVVD"
FT   sig_peptide     complement(563825..563917)
FT                   /locus_tag="Nham_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.745) with cleavage site probability 0.538 at
FT                   residue 31"
FT   gene            complement(564040..564861)
FT                   /locus_tag="Nham_0509"
FT   CDS_pept        complement(564040..564861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0509"
FT                   /product="nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61399"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQU8"
FT                   /protein_id="ABE61399.1"
FT                   /translation="MQPGPRIMLRGSQRSERSQAARRFAAVALLCGLSFGGAAPSIAAG
FT                   CQFAIQGAGVVSAVIDARTLRLDDGRDVRLAGVEVVAEDSHDSLAALAALIGRHVILRG
FT                   ERDDPDRYGRQSAFIYLDASASSVQSELLGRGEALASADVADKACAAELATAEAAARQT
FT                   RRGTWASSVVVKNADNPDDILTRIGQFAVVEGKVLSVRQAGGTFYVNFGRRWTRDFAAT
FT                   ISRRMMPSFEAAGVVPASFENRRVRVRGWVQRRGGPRIEVLRVGQIEVVGD"
FT   sig_peptide     complement(564730..564861)
FT                   /locus_tag="Nham_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.897 at
FT                   residue 44"
FT   gene            complement(564861..565139)
FT                   /locus_tag="Nham_0510"
FT   CDS_pept        complement(564861..565139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0510"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61400"
FT                   /db_xref="GOA:Q1QQU7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQU7"
FT                   /protein_id="ABE61400.1"
FT                   /translation="MSGILWIILVGFVAGVIAKFLSPGPNNPSGFILTTALGIGGAFLA
FT                   TFIGQSIGHYSPNQGAGFITSTIGAIVVLFIWNRLVARRAISGPGSK"
FT   gene            complement(565226..565807)
FT                   /locus_tag="Nham_0511"
FT   CDS_pept        complement(565226..565807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0511"
FT                   /product="protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61401"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQU6"
FT                   /protein_id="ABE61401.1"
FT                   /translation="MGLLDVLNGMQNGPRGPSDPNAPSEGGGMSPMTMAILAVLGYKAL
FT                   KHFTGSQPEANPSAPPAPAPGSTVNAGLPGSAGGGLGDLLKGGLGGLLAGGAAGSILSG
FT                   GLGSLLNQLQQKGHGETANSWVNPGPNKQIAPRDLADALGADQINALTAQTGLSRDELL
FT                   AGLSRHLPEVVNHLTPDGRVPTESELSRLL"
FT   gene            566183..566259
FT                   /locus_tag="Nham_R0008"
FT                   /note="tRNA-Arg1"
FT   tRNA            566183..566259
FT                   /locus_tag="Nham_R0008"
FT                   /product="tRNA-Arg"
FT   gene            complement(566587..567696)
FT                   /locus_tag="Nham_0512"
FT   CDS_pept        complement(566587..567696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0512"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61402"
FT                   /db_xref="GOA:Q1QHB5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QHB5"
FT                   /protein_id="ABE61402.1"
FT                   /translation="MRGSDERSGSLFSYVDLEARIRSDHPLRTIRQIANAALNDLSRDF
FT                   DKLYTAFGRPSIAPEKLLRAMLLQAFYGIRSERQLMERLEFDLLLRWFVGLGVDDPVWD
FT                   HSTFSKNRDRLLEGEIAAKFLNALMGQHQVKRLLSSEHFSVDGTLIEAWASIKSFRRKD
FT                   GGDQDSDGPGRNAERSFHNEKRCNETHQSTTDPEARLYKKGGGQPAKLCYIGHALMENR
FT                   NGLAVLGGVSRATGTAERDQALALIDCHRGQSERRITLGADKAYDVTAFVEDLRRRSVT
FT                   PHIAIDGHLSKTGKPRKTAIDQRTLRHAGYAVSQRCRKRIEEVFGWIKASAGLAKIKLR
FT                   GRDRVNATFTLALAAYNLIRLPKLLAAAA"
FT   gene            complement(567886..567975)
FT                   /locus_tag="Nham_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(567886..567975)
FT                   /locus_tag="Nham_R0009"
FT                   /product="tRNA-Ser"
FT   gene            complement(568605..569741)
FT                   /locus_tag="Nham_0513"
FT   CDS_pept        complement(568605..569741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61403"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQU4"
FT                   /protein_id="ABE61403.1"
FT                   /translation="MAEDTLTTSGIGKHGVPRLPSVDVDSYNIELKDDDGFLGDRASKG
FT                   AFRKILDGLRKPLKKNGDDPLGDTPSEEIAKGSLDEALVGDDIEAAALVHGAIEEFAQE
FT                   LAYVTGRFLKTKAWADTECIVVGGGFRKSRVGEIAIARADLLLKSEGHKVHLIPIRFDP
FT                   DEAGLIGCLHLAPSWIFEAFDSILAVDIGGTNIRCGVVETRWKKAADLSKAGVWKSELW
FT                   RHANDEPTRESAVKKLVKMLKDLISQAEKQGLKLAPFIGISCPGVIEQDGSIEKGAQNL
FT                   PGNWESSKFNLPGSLVEAIPEIGGHDTTVLMHNDGVAQGLSEMPYMQDVSRWGVLTIGT
FT                   GLGNARFTNRKKDNKKDKKPDDDGKDKNKDKKDRKTRD"
FT   gene            570136..570522
FT                   /locus_tag="Nham_0514"
FT   CDS_pept        570136..570522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0514"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61404"
FT                   /db_xref="GOA:Q1QQU3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQU3"
FT                   /protein_id="ABE61404.1"
FT                   /translation="MFAVIKTGGRQYRVVPDDVLEIGKIAGDVGTIVQLGEVLVLGGDT
FT                   PVLGLPTVAGASVAAEVLQHKRGPKVIAFKKRRRKHSKRKRGYRDEITVLRITEILADG
FT                   KTPTVGPRPKKEKVVEPAEGEGDH"
FT   gene            570645..570917
FT                   /locus_tag="Nham_0515"
FT   CDS_pept        570645..570917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0515"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61405"
FT                   /db_xref="GOA:Q1QQU2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQU2"
FT                   /protein_id="ABE61405.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGVKAFGGEHVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKAGGRTFVSVLPMTEAAAE"
FT   gene            571059..571661
FT                   /locus_tag="Nham_0516"
FT   CDS_pept        571059..571661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0516"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61406"
FT                   /db_xref="GOA:Q1QQU1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQU1"
FT                   /protein_id="ABE61406.1"
FT                   /translation="MLQDIPTPTPLLRETRPFVLETERLSLRKPTLADVKGIAALANDR
FT                   RIAEMTRRLPHSYTQDDAVHFVRVVAGDSSETVFLIEHCHTPVGVAGVDWSEPDAPELG
FT                   YWFGVDHWGLGFATEAARAVIDYTFETFAIDQMISGARVVNPKSRNVLEKCGFQWSGVE
FT                   LHRFRALGSSTPVDRFRLSRGVWSSLKNWSNAARRER"
FT   gene            571889..572965
FT                   /locus_tag="Nham_0517"
FT   CDS_pept        571889..572965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0517"
FT                   /product="GTP1/OBG subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61407"
FT                   /db_xref="GOA:Q1QQU0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQU0"
FT                   /protein_id="ABE61407.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPSGGNGGRGGDV
FT                   IVEVADGLNTLIDYRYQQHFKAPKGTNGMGSDRHGANGKAIVLKVPLGTQIIDEDRETL
FT                   IHDFTTVGERFVLAEGGNGGFGNAHFKSSTNRAPRNANPGQPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNAGDREFVLADIPGLIEGAHE
FT                   GTGLGDRFLGHVERCRVLLHLVDATCEHAGKAYKTVRGELEAYAGTLAEKVEIVALNKI
FT                   DAVSVEDLKKQRDRLKRAANKMPLLLSGITGKGVPEVLQTLAAVIGEAPVSDKAKGAGA
FT                   SAAQAVVPPVAQAKPWSP"
FT   gene            573119..574258
FT                   /locus_tag="Nham_0518"
FT   CDS_pept        573119..574258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0518"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61408"
FT                   /db_xref="GOA:Q1QQT9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQT9"
FT                   /protein_id="ABE61408.1"
FT                   /translation="MTSLHLKKFRRIVVKVGSSLLIDSDAGEVRAAWLSALADDIAGLH
FT                   GEGRDVLIVSSGSIALGRSKLKLPRGPLKLEESQAAAAVGQIALARIWSKVLGDHGIGA
FT                   GQILVTLQDTEERRRYLNARSTIAKLLDWRAVPVINENDTVATNEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYDAPPHLNPDAKLIPVVKRVTADIEAMAGSAASELSRGGMQT
FT                   KIEAAKIATTAGTHMLIASGKIEHPLRAVMDGGRCTWFMTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVAALRAGKSLLPAGVIRVDGQFARGDAVIVRGPNTHEIGRGLVAYDAVDA
FT                   EKIKGRSSCDAAQILGISGRAEMIHRDDLVVGGPRGGAG"
FT   gene            complement(574531..575124)
FT                   /locus_tag="Nham_0519"
FT   CDS_pept        complement(574531..575124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61409"
FT                   /db_xref="GOA:Q1QQT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT8"
FT                   /protein_id="ABE61409.1"
FT                   /translation="MPVSNITQFSVTLKPASIEAVSFLYGWLAQCGWYQPPMPRCGASP
FT                   FQTGNHASRTLSRKATSMSRELVAHNHPANETYTQLHSSIPKIAAGLVIWFVLMAWIFF
FT                   DRQSVVALPLAFITVLFLVVGLCFSGSFLVSYRHQPDYGRHPNEVPFRDWSTGNFAVWG
FT                   SQQSAAQAATEILLPIAAAASLMTVMGIIYAIMS"
FT   gene            575369..576661
FT                   /locus_tag="Nham_0520"
FT   CDS_pept        575369..576661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0520"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61410"
FT                   /db_xref="GOA:Q1QQT7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQT7"
FT                   /protein_id="ABE61410.1"
FT                   /translation="MTASLKATCASADLPVLMNGLATQARSAARVLGLASTAQKDQALD
FT                   AMARAIRAAAAAILNANAEDVADARAGGATSAFVDRLTLTQARIDAMADGVKVVRAIDD
FT                   PVGKVTERWQRPNGMTIERVRVPLGVVAVIFESRPNVCADAGALCLKSGNAVILRGGSD
FT                   SFRSCRAIHECLVQGLREAGLPEAAITLVPTRDRAAVGLLLSGLDGGIDVIVPRGGKSL
FT                   VARVEAEARVPVFAHLEGVNHVYVDGAADLAMAKAIVLNAKMRRPGVCGAAETLLVDRA
FT                   GAPNTLKPLVDMLIDAGCEVRGDAAVQAVDARVKPATDDDWDTEYEDAIIAARVVDGVG
FT                   EAIDHIQRHGSHHTDAIVTDDSNTAARFLDEVDSAIVLHNASTQFADGGEFGFGAEIGI
FT                   ATGKFHARGPVGAEQLTSFKYRVHGTGQTRP"
FT   gene            576748..577383
FT                   /locus_tag="Nham_0521"
FT   CDS_pept        576748..577383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0521"
FT                   /product="nicotinate-nucleotide adenylyltransferase family
FT                   protein"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61411"
FT                   /db_xref="GOA:Q1QQT6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT6"
FT                   /protein_id="ABE61411.1"
FT                   /translation="MGPRSVASSSAIPLHFDGMRIGLLGGSFNPPHAAHRAISLYALKR
FT                   LQLDRVWWLISPANPLKDARALRDLGERAAAARAMASDPRIDVSCLEAVIGTRYTIDTI
FT                   TYLRRRCANVRFVWIMGADNLEQFHRWENWQRIAAEVPIAVIDRPPHSFRALAAPAAQA
FT                   LARWRLPEVGANRLTAQRPPAWVFLTGMKSRLSSTGLRNRDGTWKGGA"
FT   gene            577641..578003
FT                   /locus_tag="Nham_0522"
FT   CDS_pept        577641..578003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0522"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61412"
FT                   /db_xref="GOA:Q1QQT5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT5"
FT                   /protein_id="ABE61412.1"
FT                   /translation="MVSKARPDVEETLKLVLSRLEDMKAEETVTIDLRGRSAFSDYMVI
FT                   ATGRSNRHVGAVAENVAKGLKETGVKNVHIEGLPNCDWVLIDSGDVIVHVFRPEVREFY
FT                   NLERLWMQNTATAKSV"
FT   gene            578129..578611
FT                   /locus_tag="Nham_0523"
FT   CDS_pept        578129..578611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0523"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61413"
FT                   /db_xref="GOA:Q1QQT4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQT4"
FT                   /protein_id="ABE61413.1"
FT                   /translation="MRLVVIAIGRLKQGPERELADRYRGRFDDIGRKLGFRGFDVHEIP
FT                   ESRARDAKQRIREEAAAILALAPEGAVLVALDEKGKNIDSAAFADHLGRWRDESVTSTV
FT                   FAVGGADGLSPELRRKARLSVAFGAATWPHQIVRVMLLEQIYRAATILAGHPYHRG"
FT   gene            578648..580057
FT                   /locus_tag="Nham_0524"
FT   CDS_pept        578648..580057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0524"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61414"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT3"
FT                   /protein_id="ABE61414.1"
FT                   /translation="MVRTNGRRSPDMRMNQDHGLRSRSAEVRGGQPPPASMLVISACLL
FT                   AGFSSAVSSSVMAQAAGTPSPAAAPSADDIKHREQELEAVRAQQKSAAELQERLKADIA
FT                   AIGQNRAKLNQQLIDVAAGVRAIETKIAEAEARLLPLDAREREIRGSLDSRRSEIVEVL
FT                   AALQRVGRRTPPALLVRPEDALQSLRTAMLLGSVVPEIRARAEKLVADLEELVGLRKSI
FT                   AAERDLMAADRDRLKDDQTRLATLVDERQRQQSSIEKDMAAEGARAIELSHQVDSLQGL
FT                   IAKMEQDLKSAAKAAATASRQGAPAKPNLAALKDPGRLSPAIAFASAKGLLAFPVNGTK
FT                   IRDFGGSDGVGGAEKGISLAARPGAQVTTPCDGWVVYAGPFRSYGQLLILNAGGGYHVL
FT                   IAGMERISVNIGQFVLTGEPVATMGSTSRVASILAANASQPVLYIEFRKDGTPIDPGPW
FT                   WAANKGQKVRG"
FT   sig_peptide     578648..578830
FT                   /locus_tag="Nham_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.586 at
FT                   residue 61"
FT   gene            580054..581409
FT                   /locus_tag="Nham_0525"
FT   CDS_pept        580054..581409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0525"
FT                   /product="C-terminal processing peptidase-3, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61415"
FT                   /db_xref="GOA:Q1QQT2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT2"
FT                   /protein_id="ABE61415.1"
FT                   /translation="MMRKVSLILLSAAAGAALTLFVTQPRSVLMGSSARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLIESAISGMLSGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLVKVVSPIDDTPASKAGILANDIITNLDDEAVQGLTLNQAVDKMRGPI
FT                   GTKIKLKIVRKGQDNPIDVTLVRDNIRVRSVRSHVETDDIAYIRITTFNEQTTEGLKKS
FT                   ISDLQGQIGDKLKGYIIDLRNNPGGLLEEAVTVSDSFLDRGEIVSTRGRNAEETQRRSA
FT                   HPGDLTKGKPVIVLINGGSASASEIVAGALQDHKRATLIGTRSFGKGSVQTIIPLGSGN
FT                   GALRLTTARYYTPSGRSIQAKGIVPDIEVLQDVPDELKSRTDTKGEASLRGHLRNGTDE
FT                   KTGSQSYVPPDAKNDKALKMADDLLHGIKVNASSPAPGDKAAIEKPAKKATN"
FT   sig_peptide     580054..580164
FT                   /locus_tag="Nham_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.730 at
FT                   residue 37"
FT   gene            581559..582764
FT                   /locus_tag="Nham_0526"
FT   CDS_pept        581559..582764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0526"
FT                   /product="protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61416"
FT                   /db_xref="GOA:Q1QQT1"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT1"
FT                   /protein_id="ABE61416.1"
FT                   /translation="MADTTDDLSTPLGQNPAPKRRFRLPFTLPQAAAVLLGSILVVFVG
FT                   FVLFNHDPLGGEPAARIAIRQTVAPEDKSAAVPPASQPTSAAAVTAQPEAGRKTITIID
FT                   GSSGSRQDVVVAGADSDTAGGGAAPVTMAGIDPRLLEKSRYGMIPAVAADGLKPFKAYA
FT                   TGTDADRAKAATMPVIAIVVGGLGVGAAKTADAIMKLPPAVTLAFTPYGSDPGKLVEQA
FT                   RAQRHEILLQVPMEPYDYPDNDPGPQTLLTTLGTEQNIDRLHWHLSRFQGYVGLANFMG
FT                   ARFVAAATVMQPIIREAAKRGLGYLDDGSTPRSVAGQLAEGQAMPFAKADLTIDAVPTS
FT                   VEIDKALARLEDLAKERGAAIGMASALPVSVERIGAWAKGLESRGVMLVPLTTEMLKSK
FT                   SG"
FT   gene            582789..583328
FT                   /locus_tag="Nham_0527"
FT   CDS_pept        582789..583328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0527"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61417"
FT                   /db_xref="GOA:Q1QQT0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQT0"
FT                   /protein_id="ABE61417.1"
FT                   /translation="MSERGGAKGIDAMARYDDLPYRTCVGMMLINERGLVLIGRRAGGI
FT                   EHVDDEYVWQMPQGGVDPGEDTWLAAKRELYEETSVRSVEKLAEVSDWLIYDIPRTVAG
FT                   RAWKGRYRGQRQKWYAMRFTGKDNEIDVVNPGGGHKAEFIGWRWEPMQNLPRLIVPFKR
FT                   PVYERVVKEFASLSGG"
FT   gene            complement(583625..584032)
FT                   /locus_tag="Nham_0528"
FT   CDS_pept        complement(583625..584032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0528"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61418"
FT                   /db_xref="GOA:Q1QQS9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQS9"
FT                   /protein_id="ABE61418.1"
FT                   /translation="MATFHFDLVSPEKLTFSGDVDQVDVPGVEGDFGVLAGHAPVVAAI
FT                   RPGILTITTGGTPQKIIVLGGLAEVSEKGLTVLADVATSIQELDRAQFADTIASMEAKL
FT                   AEKEGSELDKAIERLDHFKSIQSQLNTTALH"
FT   gene            complement(584252..585682)
FT                   /locus_tag="Nham_0529"
FT   CDS_pept        complement(584252..585682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0529"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61419"
FT                   /db_xref="GOA:Q1QQS8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQS8"
FT                   /protein_id="ABE61419.1"
FT                   /translation="MASPANQTGRITQVIGAVVDVQFEGHLPAILNAIETKNGDNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVKDTGNPILVPVGVGTLGRIMNVIGEPVDEQG
FT                   PVKAEDMRAIHQEAPLYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVALSGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTTKGSITSIQAIYVPADDLTDPAPATSFAHLDATTTLNRAISEK
FT                   GIYPAVDPLDSTSRMLSPLIVGEEHYQTARMVQQVLQRYKSLQDIIAILGMDELSEEDK
FT                   IAVARARKIERFLSQPFFVAEIFTGAPGKFVDLADTIKGFRAICDGKYDHLPEAAFYMV
FT                   GTIEEAVEKGKKLAAEAA"
FT   gene            complement(585766..586170)
FT                   /locus_tag="Nham_0530"
FT   CDS_pept        complement(585766..586170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0530"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61420"
FT                   /db_xref="GOA:Q1QQS7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQS7"
FT                   /protein_id="ABE61420.1"
FT                   /translation="MAYVTKATTSGGRNGRAVLDGGGLALAMALPKDLGGAGDGHNPEQ
FT                   LFALGWSSCFGQAILVLAKKHGLDGQAAKVTCEVTLNINDGAFSLAAELKVALPGADKA
FT                   KLQALIEDAHTICPYSKATKGNVPVKLTAV"
FT   gene            complement(586185..587063)
FT                   /locus_tag="Nham_0531"
FT   CDS_pept        complement(586185..587063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0531"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61421"
FT                   /db_xref="GOA:Q1QQS6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQS6"
FT                   /protein_id="ABE61421.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQSAAEAARPY
FT                   AEKMDQVISNIASAAAGSPGAPVLLGGTGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RALALMNQGKDVKFFCVGRKGYEQLRRTFEKQIVENVELRSVRQLGFVNAEAIAKKVIA
FT                   RFNAGEFDVCTLFYSRFKSVIAQVPTAQQIIPLEVEAPAANAGPAPFYEYEPEEDEILT
FT                   RLLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGDMIRKQTLVYNRTRQAMITKE
FT                   LIEIISGAEAI"
FT   gene            complement(587216..588748)
FT                   /locus_tag="Nham_0532"
FT   CDS_pept        complement(587216..588748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0532"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61422"
FT                   /db_xref="GOA:Q1QQS5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQS5"
FT                   /protein_id="ABE61422.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLD
FT                   NIQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRAIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKSIDALIPVGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVAGAPEGQKLYCVYVAIGQKRSTVAQFVKVLE
FT                   EQGALEYSIIVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDHGNGSLTALPVIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDKLP
FT                   LGKVRAFEDGLLSLLRGKNVEILNTIRESRDLSDDTAAKLRSAVDGYAKTFV"
FT   gene            complement(588748..589371)
FT                   /locus_tag="Nham_0533"
FT   CDS_pept        complement(588748..589371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0533"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61423"
FT                   /db_xref="GOA:Q1QQS4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQS4"
FT                   /protein_id="ABE61423.1"
FT                   /translation="MAPLVWRRLFPCEFDSLKSAQVAAVDSSVSGVSGRYATALFELAR
FT                   EDKSIDAVKADLDRFDAMLADSPELARLVRSPVFSADTQAKALAAVLDKAGFGGTTAKF
FT                   LKVLTANRRLFAVTEVIRAFRALVARFKGEVTAEVTVAETLNKKNLDALTTALKSVTGK
FT                   DITLNVKVDPSIIGGLVVKLGSRMVDSSLRTKLNSIKHAMKEAG"
FT   gene            589953..590462
FT                   /locus_tag="Nham_0534"
FT   CDS_pept        589953..590462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0534"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61424"
FT                   /db_xref="GOA:Q1QQS3"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQS3"
FT                   /protein_id="ABE61424.1"
FT                   /translation="MLHSQKSTLGFLIRPRTVAAVIAATVLIAGSVTEASARSRNHHRH
FT                   HHDRAHHAASHGTAGSSWLNANASVGRSAGAGRSFSGVASYYGSESGSRTASGQRFNQN
FT                   AMTAAHRSLPFGTKLRVTHGSRSVVVTINDRGPFIRGRVLDLSKGAARAIGLTGRGVGR
FT                   VVAEVM"
FT   sig_peptide     589953..590057
FT                   /locus_tag="Nham_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.574 at
FT                   residue 35"
FT   gene            complement(590563..592779)
FT                   /locus_tag="Nham_0535"
FT   CDS_pept        complement(590563..592779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0535"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61425"
FT                   /db_xref="GOA:Q1QQS2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQS2"
FT                   /protein_id="ABE61425.1"
FT                   /translation="MDHFSRNGTSSTPSSTTRVVDVLVPVAIDQAYSYRVPRGMEVAPG
FT                   DLVTVPLGPREVIAVVWAENPAPDPRLHNRLKDIGEKLDLPPLKDELRTLVDWVANYTL
FT                   SARGMVMRMSLRMGEQLGPERVRPGVRLTGAPPQRMTPARQRLIAVLSDGLLHGKSDAA
FT                   KEAGVSAGVVDGLVDERTLTVEPMPRPPPPPPPDPDFAVPDFSRSQRTAVDAMRALASN
FT                   GTFHVALLDGVTGSGKTEVYFEAVAETIRRGKQALILMPEIVLTGQFRDRFAARFGERP
FT                   LEWHSELTPRTRARNWAAIAAGEGQVVVGARSALFLPYADLGLIIVDEEHDQAYKQDEG
FT                   THYHARDMAVVRAHIAKIPIVLASATPSVESEVNARKGRYQRVALTSRFGGQHMPQIEV
FT                   IDLRREGPPRGRFISPRLAGEVRAAIERREQALLFLNRRGYAPLTLCRACGHRFACTIC
FT                   DAWLVDHRFRQRLVCHHCGFSMPRPHQCPHCAAEETLVAVGPGVERLQEEAAALFPDAR
FT                   TLVLSSDLVTSIETMRSELNDIAEGRVDIIIGTQLVAKGHHFPRLNLVGVIDADLGLGN
FT                   GDPRAAERTFQLLNQVIGRTGREQGHGVGYLQTHQPEHPVMRALVASDREAFYASEIEA
FT                   RERSGYPPFGRLASLIISAGDRPTAESFARRLAAIAPIDERIQVLGPAEAPLAVIKGRY
FT                   RFRLLVKSARGVDLSGYLREWLAAGPKTKGNLKLEIDVDPQSFL"
FT   gene            592949..593851
FT                   /locus_tag="Nham_0536"
FT   CDS_pept        592949..593851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0536"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61426"
FT                   /db_xref="GOA:Q1QQS1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQS1"
FT                   /protein_id="ABE61426.1"
FT                   /translation="MVRWLSHLRAERRLSPKTCEAYARDARQCLMFLSQHWGELVTLKR
FT                   FAALEASDVRAFMAARRADDIGGRSLMRALAGLRSFARFLEREGLGKVGALSAIRAPKV
FT                   GKSLPKPIQMSAAKRFADASERAGEDREPWIWARDAAVMALLYGSGLRISEALGLKRRD
FT                   VPQPGAGDVLVVTGKGNKTRMVPVLQNVLALVHEYVAVCPHSLPPEGPIFVGARGGPLS
FT                   PRIIQLTMARMRGALGLPDSATPHALRHSFATHLLSRGGDLRAIQELLGHASLSTTQIY
FT                   TGIDSERLLEVYKTAHPRA"
FT   gene            complement(593868..595310)
FT                   /locus_tag="Nham_0537"
FT   CDS_pept        complement(593868..595310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0537"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61427"
FT                   /db_xref="GOA:Q1QQS0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQS0"
FT                   /protein_id="ABE61427.1"
FT                   /translation="MAKLPDDNTRFETMATYDLIVIGTGPGGYVCAIRAAQFGMKVAVV
FT                   EKNPTLGGTCLNVGCMPSKALLHASEMFEEAGHSFAKMGIGVSAPRLDLAAMMNFKQQG
FT                   IDGNVKGVEFLMKKNKIDVISGTGRILGAGKVEVTGNDGKKQTLETKNIVIATGSDVAK
FT                   LKDIEIDEKRIVSSTGALSLAKVPGKLLIVGAGVIGLELGSVWHRLGAQVTVVEFLDRI
FT                   LPGMDGEVAKQFQRMLEKQGFAFKLGAKVTGVDTSGKTLTAKVEPAAGGAAETIEADVV
FT                   LVAIGRTPYTDGLGLKEAGVALDDRGRVEIDAHFATNVKGVYAIGDVVAGPMLAHKAED
FT                   EGVACAEILAGQAGHVNYDVIPGVIYTTPEVSSVGKTEEELKQAGTAYTVGKFPFTANG
FT                   RSKVNQTTDGFVKILADAKTDRVLGVHIIGREAGEMIHEACVLMEFGGSAEDLARTCHA
FT                   HPTRSEAIKEAALAVGKRAIHM"
FT   gene            complement(595344..595787)
FT                   /locus_tag="Nham_0538"
FT   CDS_pept        complement(595344..595787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61428"
FT                   /db_xref="GOA:Q1QQR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR9"
FT                   /protein_id="ABE61428.1"
FT                   /translation="MEQQIVSALSGVLGGAIGGLITIWAMFRIQRSTNVSLEYDEIRKK
FT                   RVEIIYQLLGSRYVLMEGYPATESDVKSFNTAMSLFSIYFAKDPEVMSAYDRLLNSESD
FT                   DNIVQMLKVAAKTASLELLDTHIKRVMTVAPKNASLLVPRASQ"
FT   gene            complement(595788..595949)
FT                   /locus_tag="Nham_0539"
FT   CDS_pept        complement(595788..595949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61429"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR8"
FT                   /protein_id="ABE61429.1"
FT                   /translation="MRGALETRQFELRVDRSAAAPWTKLIDGKEAVTFLVRVKEPLEDP
FT                   ARLVLGGN"
FT   gene            complement(595946..596446)
FT                   /locus_tag="Nham_0540"
FT   CDS_pept        complement(595946..596446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR7"
FT                   /protein_id="ABE61430.1"
FT                   /translation="MTQILLKSDTKTTEFGHLTSIDLELNAVILELFYLACLSFEHGQS
FT                   AAHIYASEYGGEIKSIAYENPFDVLGSFENISKKSADWVLSRALFYHDNQRRRAKADPE
FT                   NAKAEEKHQPAIEKKLGNLDKAHSLRRKLITDGADPDEVNRLVGGLLFDQRAKLLPGPD
FT                   QTG"
FT   gene            complement(596468..597709)
FT                   /locus_tag="Nham_0541"
FT   CDS_pept        complement(596468..597709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0541"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61431"
FT                   /db_xref="GOA:Q1QQR6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR6"
FT                   /protein_id="ABE61431.1"
FT                   /translation="MTEIRVPTLGESVTEATIGKWFKKAGDAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLSEIVAKDGETVAVGALLGQISEGAAPVKATAPAAQPAAAAPASAAAVSP
FT                   VPAQKSPPPDAPLAPSVRKLSAESGVDASTVPGSGKDGRVTKGDMLAAIEKAASTATPV
FT                   NQPAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTGVM
FT                   TLRTHYKEVFEKKHGVKLGFMGFFTKACVQALKDIPAANAEIDGTDLIYKNYYHIGIAV
FT                   GTDKGLVVPVVRDCDRKSIAEIEKSIADYGRRARDGQLKIDEMQGGTFTITNGGIYGSL
FT                   MSTPILNAPQAGILGMHKIQERPMAIAGKVEIRPMMYLALSYDHRVIDGKDAVTFLVRV
FT                   KESLEDPARLVLDL"
FT   gene            complement(597850..600819)
FT                   /locus_tag="Nham_0542"
FT   CDS_pept        complement(597850..600819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0542"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61432"
FT                   /db_xref="GOA:Q1QQR5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR5"
FT                   /protein_id="ABE61432.1"
FT                   /translation="MSRQNANAAFALSSFLQGANATYIDGLYARYEKDPGSVDAEWQEF
FT                   FKSLKDAPDDVRKNAKGPSWEKANWPLAPQDDLISALDGNWTQIEKAVGAKLQAKAQGE
FT                   AQARDSALAGVDVNQATRDSVRALMLIRAYRMRGHFHARLDPLGLEPARDHEELDPRAY
FT                   GFTDADMDRKIFLDHVLGLEYGTLREIVAICERTYCQTLGVEFMHISNGAQKGWIQERI
FT                   EGPDKEISFTPEGRRAILKKLVEAEGFEKFCDVKFTGTKRFGLDGGESLIPALEQIIKR
FT                   GGNLGVKEIVIGMPHRGRLNVLTQVMGKPHRALFHEFKGGSANPDVVEGSGDVKYHLGA
FT                   SSDREFDNNRIHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDPPDQRDSVLPLLMHGDA
FT                   AFAGQGVVAECFALSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDLAKMIDAP
FT                   IFHVNGDDPEAVVFAAKVAIEFRQKFHKPVVIDMFCYRRHGHNEGDEPSFTNPMMYKKI
FT                   AAHPSTLELYAKRLSTEGVITDGEIEKLKADWRARLDAEFEAGAGYKPNKADWLDGKWA
FT                   GFKLADQDEEPRRGVTGVDIATLKQIGRSITRVPDGFRVHRTVQRFLDNRAKAIDRGVG
FT                   IDWATAEALAFCTLVLEGHNVRLSGQDSERGTFSQRHSVLFDQEDESRYTPFNHLGKDQ
FT                   GRYEVINSLLSEEAVLGFEYGYSLAEPNTLTLWEAQFGDFANGAQVLFDQFISSGERKW
FT                   LRMSGLVCMLPHGYEGQGPEHSSARLERFLQMCAEDNMQVVNISTPANHFHALRRQLKR
FT                   QIRKPLIMMTPKSLLRHKRAVSRLDELGADTAFHRILYDDATILPDQKIRLVEDEKIRR
FT                   VVLCSGKVYYDLYEERAKRDIADVYLLRIEQLYPVPLKALVQVLGRFNKAEIVWCQEEP
FT                   RNMGAWHFIEPYLEWVLNQIDAPNKRPRYAGRAAAAATATGLMSKHLAQLKALLDEALD
FT                   "
FT   sig_peptide     complement(600754..600819)
FT                   /locus_tag="Nham_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.546 at
FT                   residue 22"
FT   gene            complement(600955..601839)
FT                   /locus_tag="Nham_0543"
FT   CDS_pept        complement(600955..601839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0543"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61433"
FT                   /db_xref="GOA:Q1QQR4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR4"
FT                   /protein_id="ABE61433.1"
FT                   /translation="MSILIDRNTRVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   NKHLDLPVFDTVRDAREATGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVRRALSGSKSRLIGPNCPGVVTAGECKIGIMPANIFKPGNVGIVSRSGTLTYEAVF
FT                   QTSQEGLGQTTAVGIGGDPVKGTEFIDILEMFLADPKTNSIVMIGEIGGSAEEDAAQFL
FT                   IDEARRGRSKPVVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSP
FT                   ARLGKTLVEKLKS"
FT   gene            complement(601987..603180)
FT                   /locus_tag="Nham_0544"
FT   CDS_pept        complement(601987..603180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0544"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61434"
FT                   /db_xref="GOA:Q1QQR3"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQR3"
FT                   /protein_id="ABE61434.1"
FT                   /translation="MNIHEYQAKALLREFGVPVSRGVPVLKASEAEAAAETLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKQFASQMLGATLVTVQTGPAGKQVN
FT                   RLYIEEGSDIDKEFYLSALVDRETSRVAFVVSTEGGVNIEDVAHTSPEKIVSFSVDPAT
FT                   GVMSHHGRTVAKALGLRGDLGKQAEKLVAQLYNAFIAKDMALLEINPLVVTRQGELRVL
FT                   DAKVSFDDNALYRHPDAVALRDESEEDAKEIEASRFDLSYVALDGQIGCMVNGAGLAMA
FT                   TMDIIKLYGMSPANFLDVGGGATKDKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAE
FT                   GVVAAVKQVGLNVPLVVRLEGTNVDAGKKIIRESGLNVLPADDLDDAAQKIVKAVKG"
FT   gene            complement(603310..604278)
FT                   /locus_tag="Nham_0545"
FT   CDS_pept        complement(603310..604278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0545"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61435"
FT                   /db_xref="GOA:Q1QQR2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQR2"
FT                   /protein_id="ABE61435.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHLIGLKELGDVVMFDIAEGIPQGKSL
FT                   DIAQSSPVDGFDAKLTGANSYEALEGARVCIVTAGIPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGMPAKKVVGMAGVLDSSRFRYFLADEFDV
FT                   SVEDVTAFVLGGHGDSMVPLVKYSTVAGIPLPDLVKMGWTSQARIDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPCAAYLNGEFGVKDMYVGVPVVIGARG
FT                   VERIVEIELAGKDREAFDKSVGAVQGLIDACKKIAPDLLGK"
FT   gene            complement(604428..605612)
FT                   /locus_tag="Nham_0546"
FT   CDS_pept        complement(604428..605612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0546"
FT                   /product="AFG1-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61436"
FT                   /db_xref="GOA:Q1QQR1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR1"
FT                   /protein_id="ABE61436.1"
FT                   /translation="MHSVSTTSFRDHYQALVASGAIEADPAQAQAVEALATLDERLTAY
FT                   KPAGKGGFLDKLFHSDGEPAPKGLYIYGEVGRGKTMLMDLFFQESAVAHKRRVHFHEFM
FT                   ADVHERIYVFRQAIARGEMADADVIHLTAVSIFEEAWLLCFDEFHVTDIADAMILGRLF
FT                   ARLFELGTVVVATSNVPPEHLYEGGLNRVLFLPFIAQIEESMDVLRLDARTDFRMEKLA
FT                   GVTMWLTPADAAAEAALDKAWALMTGGAPCRPRDIAIKGRILHVPCSAHGVARFSFADL
FT                   CEQPLAASDYLRLAHDYHTLMIDRIPVMDYADRNAAKRFIALIDTLYDTGVKLMASSDT
FT                   DPLSLYRATDGYEANEFKRTSSRLIEMGSESYLAQAHGRSDSAASSSSTGLVET"
FT   gene            complement(605686..606222)
FT                   /locus_tag="Nham_0547"
FT   CDS_pept        complement(605686..606222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0547"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61437"
FT                   /db_xref="GOA:Q1QQR0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQR0"
FT                   /protein_id="ABE61437.1"
FT                   /translation="MPRLFTGLEIPPDIGRTLSSLRGGLPGARWIDPENYHLTLRFIGD
FT                   IDGASANEIASMLFRVNRKPFEVTLRGLSSFGGKKPRAVVASVEPSGPLVELQGELERL
FT                   MRRCGLDPEGRKFTPHVTLARLRDASNQDVADYLSVRGYFPARAFTAERFVLFSSRASV
FT                   GGGPYVVEDSYALSA"
FT   gene            complement(606382..607065)
FT                   /locus_tag="Nham_0548"
FT   CDS_pept        complement(606382..607065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0548"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61438"
FT                   /db_xref="GOA:Q1QQQ9"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ9"
FT                   /protein_id="ABE61438.1"
FT                   /translation="MQISYGTFFTAVERWMRTFAWLLLGAGIAMAVPAQAADGPVKIVV
FT                   LGDSLSAGLGLPAAAAFPAQLETALKDKGLNVAINNAGVSGDTASGGLDRLDWSVPVGT
FT                   QGVILELGANDALRGIDPKVTRAALEEILKRLKARDIAVLLCGMVAPPNYGAEYATRFN
FT                   AIFPDLAKTYDVPLYPFFLDGVAANTRLNQADGMHPTADGVAVIVDHILPTVEAFLGTI
FT                   HAPKS"
FT   sig_peptide     complement(606955..607065)
FT                   /locus_tag="Nham_0548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 37"
FT   gene            607262..607786
FT                   /locus_tag="Nham_0549"
FT   CDS_pept        607262..607786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0549"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61439"
FT                   /db_xref="GOA:Q1QQQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ8"
FT                   /protein_id="ABE61439.1"
FT                   /translation="MVMAGLERPDSGEVVVDGTAFNALDEDALARFRGRHVGIVFQSFH
FT                   LIPTMTALENVAVPLELAGIVDASKRAARELETVGLGERLHHYPAQLSGGEQQRVALAR
FT                   ALAPDPAILVADEPTGNLDEATGQQIVDLLFTKHAERSMTLVLVTHDIALAQRCDRVVR
FT                   LRSGRIDGAAR"
FT   gene            607908..610484
FT                   /locus_tag="Nham_0550"
FT   CDS_pept        607908..610484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0550"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61440"
FT                   /db_xref="GOA:Q1QQQ7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ7"
FT                   /protein_id="ABE61440.1"
FT                   /translation="MRSCAFAMTAKMTRTPLLPLRLALRELRSGLRGFYVFIACIALGV
FT                   MAIAGVGSVASSLSDGLAREGRTLLGGDVAFSLIQREAKPDEIAFLRARGTVSVAATLR
FT                   AMARVPDGRLALVELKAVDRAYPMLGALTLAPTIPMADLLAEHDGVFGAAADPALLARL
FT                   DLKVGDRVTVGSATFEIRSAVDAEPDKLAGRLGFGPRFLVSIDGLRATALLQPGSLVRW
FT                   TYRVRLAGDGADDKAATALADDARAALPEAGWDIRSRNNASPQLERTISRFTQYLTLVG
FT                   LAALLVGGVGVGNAVKSHIDRRRDVIASFKALGATGRDVFAIYLTQVMVLAALGSLAGL
FT                   VAGAALPFIIVGAFGHLLPLPVVPALHPEALAVSAVYGLLTALAFGIWPLARVHDIPVA
FT                   ALFRDTVAHEVHRPQTRYLVWMALLIALLVGVAIGLAYDKRVALVFVAASAMVFALLRG
FT                   IASALMALARRLPRSRITMVRLAISNIHRPGTLTPSVVLSLGLGLAVLVTITQIDGNLR
FT                   RQFLAALPERAPSFYFIDIPSSMADRFTAFLKQRAPQAKVEDVPMLRGRIVAARGVRAE
FT                   DLKPSHDAAWVLQSDRGLTYTGEVPKGSKVVEGEWWGSDYDGPPLVSFEKKVADGLGLK
FT                   LGDTVVVNVLGRDITATISNMRSVDWQSLGINFVLVFSPNAFRGAPHTHIATLTEIDAS
FT                   PAHDVAIIKAVGDAFPMVTSVRVREAMETIGTVVTNLVLAIRGASSVTLISAILVLGGA
FT                   LAAGHRHRVYDAVILKTLGATRLRLLGAYTLEYLMLGAATAVFGVAAGSIAAWLIVTRL
FT                   MTLGFEWQAGSAAMVVAAALLVTVVLGLAGTLMALNQKPASVLRNL"
FT   gene            610806..611621
FT                   /locus_tag="Nham_0551"
FT   CDS_pept        610806..611621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0551"
FT                   /product="protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61441"
FT                   /db_xref="GOA:Q1QQQ6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ6"
FT                   /protein_id="ABE61441.1"
FT                   /translation="MSDLDRNYTSPFGRAAGRVDRAAVDAGLRSYMLKIYNYMSIGLAI
FT                   TGLAALGVYMFAVTGDATLAAKSATGASLALKGGQYLTPFGLAMYASPLKWVFIFAPLA
FT                   MVFAISFGINRLKPATAQMLFWAFSALMGVSLSSIFLVYTHTSIVRVFFITAASFGALS
FT                   LYGYTTKRDMTGMGSFLIMGLFGVIIASVVNIFVASSMLQFVVSVVGVLVFAGLTAYDT
FT                   QRLKNDYIYGYASQGGEIAERAAITGALSLYLNFINLFTLLLQLLGQRE"
FT   gene            611792..612835
FT                   /locus_tag="Nham_0552"
FT   CDS_pept        611792..612835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61442"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ5"
FT                   /protein_id="ABE61442.1"
FT                   /translation="MRPQDILMPVAAGLYCKPGDFHIDPVRAVDRAVITHGHSDHARPG
FT                   HGAVLATQETLDIMRLRYGDDFGGSAQAISYGEEIKLGDVRVTFHPAGHVLGSAQVAVT
FT                   HGGVRIVASGDYKDVRDPTCTPFEVVPCDVFITEATFGLPVFRHGDAASEVNKLLASVT
FT                   LFPERAHLVGAYALGKAQRVIALIREAGYSAPIYLHGAMDKVTHYYQSRGIALGDLRTV
FT                   KGVKKADLAGTVTLAPPSATADLWARRFPDPVTAFASGWMRVRARARQRGVELPLVISD
FT                   HADWGGLIRTIAATGAGEIWVTHGQEDALVHWCTTKGLVARPLALVGYGDEDSGEDAAP
FT                   AAEARDE"
FT   gene            612832..614517
FT                   /locus_tag="Nham_0553"
FT   CDS_pept        612832..614517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0553"
FT                   /product="ATP dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61443"
FT                   /db_xref="GOA:Q1QQQ4"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ4"
FT                   /protein_id="ABE61443.1"
FT                   /translation="MNRFAELLDRLAYEPGRNNKLRLITAYFRDTPDPDRGYALAALTG
FT                   ELSFKHAKAGLVRNLIAARADPVLFALSYDYVGDLSETVALMWPQTPFPPRSSGEGEKS
FT                   CHNNLPPPTLTDVVTTLRTLGKADLPAQLAHWLDELDETGRWALLKLVTGAMRIGVSAR
FT                   LAKTAAAALGDKDAHDVELIWPGLAPPYLDLFAWLEGRGDKPVNLDPAPFRPVMLAHAI
FT                   EDADFANLDAADFTAEWKWDGIRVQAVSGRDEHGDVATRLYSRTGEDITTGFPDLLPSL
FT                   RLPGAVDGELLVVRDGQVQSFNVLQQRLNRKAVTPRLMKEFPIHLRAYDLLDDGDSDLR
FT                   ELPFDDRRRRLVDFIAALDDSRIDLSPQVPFATWGELAAARADPAAAGADADAVEGIML
FT                   KRRDAPYLPGRPRGLWWKWKRDPHVIDAVLMYAQRGHGKRSSYYSDYTFGVWTAIDGDE
FT                   QLVPVGKAYFGFTDEELLQIDRFVRRNTTESFGPVRHVVHEPDHGLVLEIAFEGLQRSA
FT                   RHKSGVAMRFPRISRLRWDKPPREADRLETLERMLRSGATIQSA"
FT   gene            614621..614926
FT                   /locus_tag="Nham_0554"
FT   CDS_pept        614621..614926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61444"
FT                   /db_xref="GOA:Q1QQQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ3"
FT                   /protein_id="ABE61444.1"
FT                   /translation="MPNDDTRNLRVSHDSLSRFLGGSPLAVVFRLILLSTLVGVVLAAI
FT                   GFDPWNIVHSIRLLVERVWNLGFDAINGLWRYFLLGAVIVIPIWLLSRLFGAPRGR"
FT   gene            complement(615093..616187)
FT                   /locus_tag="Nham_0555"
FT   CDS_pept        complement(615093..616187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0555"
FT                   /product="dihydroorotate oxidase A"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61445"
FT                   /db_xref="GOA:Q1QQQ2"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ2"
FT                   /protein_id="ABE61445.1"
FT                   /translation="MIRAFDNFSLPLLRWLDPEDAHRMALQGLRLLPPIRQRADDPKLA
FT                   VRAFGLNFPNPIGMAAGFDKSAEVPDALLKLGFGFVEIGSVTPRPQPGNPRPRVFRLER
FT                   DEGVINRMGFNNDGAHVVLRRLAARAHSGGIVGVNVGANKDSGNRVADYVRLIEIFAPV
FT                   ASYFTVNVSSPNTPALRNLQQADALNELLARVIDARERVRQNAGDTPVLLKIAPDLTLA
FT                   ELDDVVHIARSRRIDGMIVGNTTLARPSSLRDQSRAKEQGGLSGRPLFRLSTRMVAETY
FT                   VRTEGAFPLVGAGGIDSGGAALTKIRAGATLIQLYSSLVYKGLGLVDDIKRDLMSTLLR
FT                   TGHDSLSDIVGADAATMTAEDWPA"
FT   gene            complement(616184..616579)
FT                   /locus_tag="Nham_0556"
FT   CDS_pept        complement(616184..616579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0556"
FT                   /product="protein of unknown function DUF952"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61446"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ1"
FT                   /protein_id="ABE61446.1"
FT                   /translation="MRFFSILGERNDGLGAHVRTIYKICPASAWREAERHGVFRGSADD
FT                   LRDGFIHFSTASQLEGTARKHFVGQTGLLLIAIDADARGETLRWEVSRGGELFPHLYCE
FT                   LDLGHVTAVLDMRARPDGYHDIPELAP"
FT   gene            616762..617394
FT                   /locus_tag="Nham_0557"
FT   CDS_pept        616762..617394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0557"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61447"
FT                   /db_xref="GOA:Q1QQQ0"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQQ0"
FT                   /protein_id="ABE61447.1"
FT                   /translation="MAMLTHAQIWTALDRLAERSGLSPSGLARKAGLDPTTFNKSKRIT
FT                   GDGRERWPSTESVAKALAATDTAIDTFVQFIEDTARATQAVPLLGFAEAGAGGYFDDGG
FT                   FPVGKGWDEVGLPSVHDEHAYALEISGDSMKPAYRDGDVIVVSPGTSIRRGDRVVVKTR
FT                   DGEVMVKELKRRTAKMIELQSLNPNHVNRTLAASDVEWIARIVWASQ"
FT   gene            complement(617458..619416)
FT                   /locus_tag="Nham_0558"
FT   CDS_pept        complement(617458..619416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0558"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61448"
FT                   /db_xref="GOA:Q1QQP9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP9"
FT                   /protein_id="ABE61448.1"
FT                   /translation="MSDKIYDVSADWAKRAWVDDAKYHEMYARSIKDPNGFWSEAAKRV
FT                   DWITPFTKVENTSFELGKVSIKWFEDGVLNAAYNCIDRHLEERGDQTAIIWEGDDPSQS
FT                   RHISYRELHDEVCKMANILRLRNVKKGDRVTIYLPMIPEAAYAILACARIGAIHSVVFG
FT                   GFSPDSIAGRLRDCKSRVVITSDEGLRGGRTIAMKANVDTAIEKVNGEVDWVIVVKRTG
FT                   GKVNMNPTRDVWYHEAAAVVESECPCEPMHAEDPLFILYTSGSTGQPKGVLHTTAGYLI
FT                   FVAMTHQYVFDYHDGDIYWCTADVGWVTGHSYILYGPLCNGATTMMFEGVPNYPDNSRF
FT                   WNVIDKHKVNIFYTAPTAIRALMQGGDDPVKKTSRASLRLLGSVGEPINPEAWEWYHRV
FT                   VGDGRCPVVDTWWQTETGGIMISPLPGAIAQKPGSATRPFFGIVPEIVDADGKVLEGEC
FT                   SGNLCIARSWPAQVRTVYGDHARFEQTYFSSYKGKYFSGDGCRRDADGYYWITGRVDDV
FT                   INVSGHRMGTAEVESSLVAHESVSEAAVVGYPHNIKGQGIYAYVTLMQGVEPSETLRKE
FT                   LVAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEPSSLGDTTTLADPGV
FT                   VTDLVKNRQNKKDGAVA"
FT   gene            complement(619831..620244)
FT                   /locus_tag="Nham_0559"
FT   CDS_pept        complement(619831..620244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0559"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61449"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP8"
FT                   /protein_id="ABE61449.1"
FT                   /translation="MAYWLVKSEPSAWSWQQQVAKGAKGEAWTGVRNFTARQNLVAMKK
FT                   GDQAFFYHSNEGKEIVGIAEIIREAYPDPTDKTGRFVCVDIKADKPLKTPVTIAAVKAD
FT                   KRLADMALVKYSRLSVQPVTPAEWKMVCKMGGL"
FT   gene            complement(620247..621227)
FT                   /locus_tag="Nham_0560"
FT   CDS_pept        complement(620247..621227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0560"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61450"
FT                   /db_xref="GOA:Q1QQP7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQP7"
FT                   /protein_id="ABE61450.1"
FT                   /translation="MKTLNRVSVIGAGAWGTALAGVAARAGREVTLYARDAATAAAISA
FT                   TRDNPRLPGIPLDRSIVVTHDLAAAGRADIIVIAVPAQNSRTAVAALAPHLAAGTPVIA
FT                   SAKGIEHGTRRFMTEVIEEAAPQTVPAILSGPSFADDVARGLPTAVTLAAKDEAMAVAL
FT                   VHALGSAAFRPYHTTDLRGVEIGGAAKNVLAIAAGIVVGKQLGASAQAALTTRGFSELV
FT                   RLGLACGARSETLSGLSGLGDLILTCSSPQSRNFSLGIALGRGESAPRGKLSEGAFTAP
FT                   ALLELAAANGVEMPVANAVAAILAGRLTIDAAIDNLLTRPFRAEG"
FT   sig_peptide     complement(621165..621227)
FT                   /locus_tag="Nham_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.544 at
FT                   residue 21"
FT   gene            complement(621241..622314)
FT                   /locus_tag="Nham_0561"
FT   CDS_pept        complement(621241..622314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0561"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61451"
FT                   /db_xref="GOA:Q1QQP6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQP6"
FT                   /protein_id="ABE61451.1"
FT                   /translation="MLVLGIETTCDETAAAVVERHADGSALILSNIVRSQTGEHAPYGG
FT                   VVPEIAARAHVDMLDGIIASAMKQSGVGFPRLSGVAAAAGPGLIGGVIVGLTTAKAIAL
FT                   VHRTPLIAVNHLEAHALTPRLTSALEFPYCLFLASGGHTQIVAVLGVGNYVRLGTTVDD
FT                   AMGEAFDKVAKMLGLPYPGGPQVERAAADGDAKRFNFPRPMLGRPDANFSLSGLKTAVR
FT                   NEAGRIDPLRPRDINDLCAGFQAAVLEATADRLGVGLELFRERFGTPRALVAAGGVAAN
FT                   QAIRGALEGVAARAQTMLIIPPPALCTDNGAMIAWAGAERLAAGLTDTLEAPPRARWLL
FT                   DANAHAPAGFANTRAGF"
FT   gene            622408..623358
FT                   /locus_tag="Nham_0562"
FT   CDS_pept        622408..623358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0562"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61452"
FT                   /db_xref="GOA:Q1QQP5"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQP5"
FT                   /protein_id="ABE61452.1"
FT                   /translation="MQSSGETDILATIGTRGSALALAQANEVRDRLARAHQVAPERIVI
FT                   KTIRTSGDAIQDRPLFDVGGKGLFTKEIEEALLAGSIDFAVHSSKDVPTFLPDATWLPA
FT                   FLPREDVRDAFISPRAASLNDLPAGSIVGTASLRRQAMVLRLRPDLKVSVIRGNVETRL
FT                   RKLVAGEADATLLALAGLNRLGLQDRATRILETDEFLPAVGQGAIAIESRRDDDRINAF
FT                   VKAIGDSETEVALSAERSFLALLDGSCRTPIGGHCRVNGDRIHFRGLIISPDGTQSYET
FT                   TREGARADAAALGADAARELRERAGEKFFTLFAGA"
FT   gene            623362..624108
FT                   /locus_tag="Nham_0563"
FT   CDS_pept        623362..624108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0563"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61453"
FT                   /db_xref="GOA:Q1QQP4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP4"
FT                   /protein_id="ABE61453.1"
FT                   /translation="MAVLVTRPEPDNEATAAVLRARGLEVLLSPVLRFEAVAFEMDPDE
FT                   RYGAVVVTSGNALRALAAHPARESLLKLAVFAVGRHTAEAARQAGFQDVVAAGGDAVAL
FT                   RALIIKSVRTKPLAKGARILYLAAADRSCDLAGELGARGLAVVTATCYRMTPVASLSRE
FT                   VCDAFAAHRISAVLHYSRRSARAFLDAVRIGGVEISALAVPQCCISGTVASILRDAGAP
FT                   HVVVARAPAENAVLEALDCALRPLSR"
FT   gene            624195..625535
FT                   /locus_tag="Nham_0564"
FT   CDS_pept        624195..625535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61454"
FT                   /db_xref="GOA:Q1QQP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP3"
FT                   /protein_id="ABE61454.1"
FT                   /translation="MADDRHDDASQGGSSQKHSLPTDIETTGTSEAADHAGAAGGAADD
FT                   RQTVGEQSVPSHEPFRASSAADDRHDDASHLEANRISGTADDAGSGDASAAADDRQAVG
FT                   EQPAPPRAPSRALSAVIAAVTGAVAAGLVVGGAWLADWPPSSSSAPSAAPQAQVSMAEF
FT                   GALSNRVASVESKASRPAAPVPDPAVAARIDALGKSVVSLRGELATVRGQSDKLAAALK
FT                   DGAAVPHEADQTSDLAAISARLAQVEHQVEQTTQTLTAEATKHDAAPADDVPLRRAVAA
FT                   TLLNVSVRHGQPYGDLLAASKALVADPDTLKPLEVFADSGVPSATVLCRELLAIVPKLA
FT                   PAPAPVMATTGSTIVDRLQEGAARLVRIERIDASPADSTGAVVARITASARQNDVAAAR
FT                   AELNALPPADRTTAEPWIAKADAYDAALAASRQFAADAMAALTKPAP"
FT   gene            625543..627201
FT                   /locus_tag="Nham_0565"
FT   CDS_pept        625543..627201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0565"
FT                   /product="HemY-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61455"
FT                   /db_xref="GOA:Q1QQP2"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP2"
FT                   /protein_id="ABE61455.1"
FT                   /translation="MFRIILFLVLIALAALGATWVADQTGTIVMSWDVWRVETTLPAFA
FT                   LGLGLLVVAVLLVWSIVRGLWQAPRRIRRARRERRNRRGRDAITRGLLAIGHGDAAAAR
FT                   THARVARRLVSHEPLTLLLHAQSAQLDGDADRAQRAFRAMAERADTRLLGLRGLFIEAQ
FT                   RADDPQAAVAIAEEALKVSPSSIWASQAALGFRCARGDWTGALAILDKNVAAGLIDKAL
FT                   YRRQRGVLLTARALELEKSDRDASRNTVMEAVKYAPTLIPAVVLASKYLSEGNQMRRAM
FT                   RIIETAWLAQPHPDLADAYAHVMPGDSARERLARVETLAENASGHPESAMAIARAAIDA
FT                   SEFARAREVLEPLIAAPTQRVAMLMAEIEHNEHGDSGRARAWTLRAVRALHDPVWTADG
FT                   YVSDHWRPVSPVTGRLDAFQWQAPLAALPSSRPALVEAEFSDQIASDAPRFEALPAASQ
FT                   SAARDGDGATVAIESSSPETAAMSAEAATSTTFRTQSDLDKAGASDIPAVIAIVRAPDD
FT                   PGVDDNPQNDGFTEENPQVARQAGGLRGLLSRRGS"
FT   sig_peptide     625543..625608
FT                   /locus_tag="Nham_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.914 at
FT                   residue 22"
FT   gene            627348..627423
FT                   /locus_tag="Nham_R0010"
FT                   /note="tRNA-Thr1"
FT   tRNA            627348..627423
FT                   /locus_tag="Nham_R0010"
FT                   /product="tRNA-Thr"
FT   gene            627567..627821
FT                   /locus_tag="Nham_0566"
FT   CDS_pept        627567..627821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0566"
FT                   /product="YcfA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61456"
FT                   /db_xref="GOA:Q1QQP1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP1"
FT                   /protein_id="ABE61456.1"
FT                   /translation="MPCAECSVCINTHMDSRDIIAALKADGWKQVAQKGSHVQFKHPTK
FT                   PGRVTVPDPKKDLPIGTLRSIEKQAELKLRGRPCASSLP"
FT   gene            627800..628192
FT                   /locus_tag="Nham_0567"
FT   CDS_pept        627800..628192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0567"
FT                   /product="protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61457"
FT                   /db_xref="GOA:Q1QQP0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQP0"
FT                   /protein_id="ABE61457.1"
FT                   /translation="MRQFIALIHKDADSDYGVSFPDLPGCVTAGTTLDEARDMAAEALA
FT                   LHLEGMAEDGEGVPEPASLEEVMADPVNRDGVAVLVAAPAPAVKSVRINVTLPADVLEQ
FT                   IDRHAASEGFTRSGFLAHAAKKALAA"
FT   gene            complement(628229..629872)
FT                   /locus_tag="Nham_0568"
FT   CDS_pept        complement(628229..629872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0568"
FT                   /product="Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61458"
FT                   /db_xref="GOA:Q1QQN9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN9"
FT                   /protein_id="ABE61458.1"
FT                   /translation="MKAVAVTASQPASRAALYLRVSTGRQAESDLSIPDQRRQGIAFCK
FT                   ARGWEVAAEFVDAGLSGTDDKRPELQRLLDLATSDGSPFDVIIVHSFSRFARDHFALEY
FT                   HVRRLRKSGVRLVSMTQDLGDDPMSVMVRQVFALFDEYQSKENAKHVLRAMQENARQGF
FT                   WNGSAAPFGYQVVAAEQRGAKTKKKLAIDPVEAETVRLIFRLLREGDGTIGPMGVKAVV
FT                   VWLNGHGYRTRRGARWGIGPLHKLVTNPVYKGEAHFNRTDSKTRTAKPATEHIIVPVDA
FT                   IIDPAIFDAVQAQLKARNPKVAPPRVVTGPILLTGLATCATCGGGMTIRTGKSGRYRYY
FT                   VCAAAAQKGKDACPGRSLPMERLDNVVTDRIGEQLLTPERVAELLRGLMNRQTKRDDDL
FT                   AGRLTALRAKLTDAEGRLNRLYQAIENGIADPNDATLKDRVAAIKTERDIAKAAFDRAV
FT                   SEMRPEARITEDKIASFVATMRDNVLSGETAFRRAWLRSVIDKVEVDDTEIRIHGRRTV
FT                   LERLVMGGGAAPAGVPSFVREWRTRHDSNA"
FT   gene            630346..630993
FT                   /locus_tag="Nham_0569"
FT   CDS_pept        630346..630993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0569"
FT                   /product="DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61459"
FT                   /db_xref="GOA:Q1QQN8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN8"
FT                   /protein_id="ABE61459.1"
FT                   /translation="MTFSTNQLRNSIQRGDCIEVMQAIPSRSVDFILTDPPYLVRYKCR
FT                   DGRSIMNDDNAEWLEPAAHEMYRVLNRDSLCVSFYGWTQTDRFIAAWRSAGFRIVGHIV
FT                   FRKRYASAKRFVSYTHESAYVLAKGRPALPEHPPADVIDFPYSGNRLHPTQKPVMALMP
FT                   LITAFCPEGGLVLDPFCGSGSTLVAARQAGCDYLGIELDHRYHRIAARRLAA"
FT   gene            complement(631130..631822)
FT                   /locus_tag="Nham_0570"
FT   CDS_pept        complement(631130..631822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61460"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN7"
FT                   /protein_id="ABE61460.1"
FT                   /translation="MTMTNDPQVAFIAAHRDLKNRMAEQESIDTRVVDLARRKRSLQTC
FT                   HRYAMTERPRKPAPRETGAYVPELAARIDNDPNLSDGARRCARKLAELTYRSHRDARAL
FT                   PVTVTYLARALGRCRRTVQRYLRQLEEGGYVAVDVIASSRSRMCVGLVVRLLAPLFAAH
FT                   HRGRWPGSRANPGATAESLKQRYKHPFEATGHRVSVQNWTLHCMNGVFRALMQTNPLAG
FT                   LSQVRSAQ"
FT   gene            complement(632179..632664)
FT                   /locus_tag="Nham_0571"
FT   CDS_pept        complement(632179..632664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61461"
FT                   /db_xref="GOA:Q1QQN6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN6"
FT                   /protein_id="ABE61461.1"
FT                   /translation="MKKPVRRPTAEEIAAFEETGRAIARDRKFAKKAARKSVKAESRTP
FT                   VNTQTHEHGNTEIRDRVNAESSFSAKADSREHGNPFSQKHDNTDAQVVVDTEVRHSVNT
FT                   ETRISVPIVRLTIDLPEAVHTRFKTACAMTKRKMVDEVRDFIERRVAELEGEAGRRL"
FT   gene            complement(632633..633307)
FT                   /locus_tag="Nham_0572"
FT   CDS_pept        complement(632633..633307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0572"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61462"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN5"
FT                   /protein_id="ABE61462.1"
FT                   /translation="MIISFLNQKGGVGKTTLAVNTAARLARSGHKVLLIDADPQQTAAQ
FT                   WASLREKTPFVVASLPRPKMARDAMAMAADYTHTIIDGPARGQDIAHSVVIASDLVVVP
FT                   IEPGGPSLWAATETIAAVNNGRALKEALEAVFLVSRKHGNTVIGRDAKAYAADAGIQIL
FT                   RAEILNRVAFAEALTAGKTIFEWAARSEAAKDIDRLVKELLRYGEHENIRGHEETRQAT
FT                   DG"
FT   gene            complement(633461..633730)
FT                   /locus_tag="Nham_0573"
FT   CDS_pept        complement(633461..633730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN4"
FT                   /protein_id="ABE61463.1"
FT                   /translation="MRLVHPVASAFTRLAIKPAANNGRKLMNRLLTAFELQRRTQTELN
FT                   VLFRQASQTLARSRTGTPERRIALASLENISRALALSFAAGPGF"
FT   gene            634335..635249
FT                   /locus_tag="Nham_0574"
FT   CDS_pept        634335..635249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0574"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61464"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN3"
FT                   /protein_id="ABE61464.1"
FT                   /translation="MSEDRKDIYQRVTDSIVTELEKGVRPWLKPWSADHVAGRITRPLR
FT                   ANGVPYRGINILMLWASATEHSYTAPLWLTYKQAQELGGQVRKGEKGSLVVYANTITKI
FT                   EQDEATGEDLEREIPFMKGYTVFNAEQVDGLPAHFYAVQQPAIDPVERIEKAEAFFAAT
FT                   GAEINEGGNRACYNLAIDRVQMPPFVSFIEAEAYYATLAHEICHWTRHPKRLDRDFGRK
FT                   RFGDEGYAMEELVAELGAAFVCGDLALTPAPREEHAAYIGSWLKALKDDKRAIFSAAAH
FT                   AQRAADYLIGLQPIEKGEEREAA"
FT   gene            635520..636305
FT                   /locus_tag="Nham_0575"
FT   CDS_pept        635520..636305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN2"
FT                   /protein_id="ABE61465.1"
FT                   /translation="MPHFLISDPRTGAARVIDFAEFITIIKGTSIVSLATSDNFLELGL
FT                   SERLMLRIEGGGENFTAAVISTLNPDEIAPVRLQIVGDGEEVSAAVVEQRLRNLRQLYA
FT                   IAYLLSEGRGEELAAAVRADPNLDIESSLLKEHERLYLEAAGPGSWFVTAVTKVKGAGQ
FT                   AALYGLGTLYGEGRQLLLERLRTANAIQAEELKKRQIENYKLAAMTAIDIDKQIEKIKD
FT                   GESREAVRKLIAANSAAINPKIAGLLPSPSENEIDNKKK"
FT   gene            636332..636598
FT                   /locus_tag="Nham_0576"
FT   CDS_pept        636332..636598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN1"
FT                   /protein_id="ABE61466.1"
FT                   /translation="MNRSVLRMLFKKFRLHNERLAQVLSEKRAENDLAELSLIAEVARR
FT                   TEEIENPERRAYVVSQFPPTLQKSPAIQAALLSGRRKPADPAP"
FT   gene            636807..637097
FT                   /locus_tag="Nham_0577"
FT   CDS_pept        636807..637097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0577"
FT                   /product="plasmid maintenance system killer"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61467"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQN0"
FT                   /protein_id="ABE61467.1"
FT                   /translation="MKIRNVVHKGLRRFIDDDDATGLQAAVVPKLRRIISFLQDMEREN
FT                   ELRSVPSWKAHQLTGERKGTWSLFVTKNWRITFRIDQMEIEIIDLDYEDYH"
FT   gene            637107..637433
FT                   /locus_tag="Nham_0578"
FT   CDS_pept        637107..637433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0578"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61468"
FT                   /db_xref="GOA:Q1QQM9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM9"
FT                   /protein_id="ABE61468.1"
FT                   /translation="MTQGLRMKNPAHPGGFVKSEIIEPLELSVTDAAQALGVTRPALSA
FT                   LLNERAHLSPEMALRIEKAFGVSMDTLMRMQNSYDIAQARKREKEIKVAPFKGGPGDAK
FT                   RPGL"
FT   gene            637677..637982
FT                   /locus_tag="Nham_0579"
FT   CDS_pept        637677..637982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0579"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61469"
FT                   /db_xref="GOA:Q1QQM8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM8"
FT                   /protein_id="ABE61469.1"
FT                   /translation="MARPLIHPGEILADELQEIGITPTELARQIKVPANRITQIIQGRR
FT                   NITGDTALRLGHWFGASAQFWLNLQSAYDIRLAQAKAGREIAKLPVRREPAGVGTP"
FT   gene            638076..641291
FT                   /locus_tag="Nham_0580"
FT   CDS_pept        638076..641291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0580"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61470"
FT                   /db_xref="GOA:Q1QQM7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM7"
FT                   /protein_id="ABE61470.1"
FT                   /translation="MRILTNAGNDRVIDQLRAWLASGVATVDLMSPDFSLHAFAEAREM
FT                   LEKVSAARLLLGKDAMGGQSFFGGPSDISYRNKLQGRWLARNAHDWIKGSAEVRHTVAS
FT                   PPQSLIAMKGETQRHAVLGTCSFTTEGLGITPGSQLGLMQASDTQEEAAAFAAWFQSTW
FT                   ESLKQHAGKDQLATLLAETASQRAPSLLYFKFLFELFKDLGDELDEERIVKSATGIRNT
FT                   TVWKKLFKFQRDGVVGAIDKLERIGGCIIADSVGLGKTFEALAVIKYYELRNDRVLVLC
FT                   PKRLRDNWTLYKANDNRNILASDRFNYDVLNHTDLSRDGGLSGDIDLTHVNWGNYDLVV
FT                   IDESHNFRNKATHRDRDTRYDHLMKRIIKAGVKTKVLMLSATPVNNRLADLKNQIAFMT
FT                   EGSDIALIDHGISSIEATIRKAQGQFNRWLDLPADERRPSRLMDMLGFDYFKLLDMLTI
FT                   ARSRKHVQRYYGTAETGQFPERLRPINIKADVDLAGEFRPIREINNEIRRLTLGAYAPL
FT                   RYVLPHKQAAYDAKYSTKIRGGESTFRQVDREESLIHLMRVNLLKRMESSVASFALTIK
FT                   RQLDDVNALLAKIDSHDEAVDELSIDDVDVDDSAFEALLVGRKVKVLLQDVDRVRWRQD
FT                   LIEDRNRLATLLSAARAVTADRDAKLAALKELIARKVHTPINDDNRKILLFTAFADTAD
FT                   YLYRELAPWARSSLGINAAVVTGTGANKTTLTGLRSDMSSILSAFSPRSKERPAELAGE
FT                   GEIDLLIATDCISEGQNLQDCDFLINYDIHWNPVRIIQRFGRIDRIGSINERIQLVNFW
FT                   PNMELDEYLDLESRVSGRMVLLDVSATGEENVIEFQAGNQMNDLEYRRAQLQKMQDAVI
FT                   DLEDLSSGVSIADLTLNDFRIDLSGYLRENRDRLETLPLGTYAVVSMPEDSSGNNENAI
FT                   PPGAIFCLKAVGEAADRAAEPGYPLSPHFVIHVGDGGDVLLPYTQAKQVLDRLKKLSIG
FT                   RDLPDTQACGRFDKATRFGRDMEPYQKLLSRAVASIAGKSEERAVASLFSPGGTHALKG
FT                   EFAGINDFEVVAFLVILPEAGTA"
FT   gene            641288..642058
FT                   /locus_tag="Nham_0581"
FT   CDS_pept        641288..642058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61471"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM6"
FT                   /protein_id="ABE61471.1"
FT                   /translation="MTADGNIRAVVDALALPPGARVDARVPKKMLVEQGAPTPADKRAI
FT                   QEGIDELQWFAACKPATIGVPAFSDDTREYLEIAVIGCAFRPAAKAGRLIELIHRAIPY
FT                   PVLLITSDASGVAVSAAHKRKAQNEAGRTVIDRIVAATGLQPGAGDGAQLAFLQSVPLA
FT                   QQPRSDLYALYAGWLARIEALNAARLTGAFVASDDSVTIDQRREALDAHTRLAKEIETL
FT                   RGKARREKQLNRRVDMNMAIQRLEADLASYKKSL"
FT   gene            642076..644058
FT                   /locus_tag="Nham_0582"
FT   CDS_pept        642076..644058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0582"
FT                   /product="DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61472"
FT                   /db_xref="GOA:Q1QQM5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM5"
FT                   /protein_id="ABE61472.1"
FT                   /translation="MHGIEKLNLNDPETQSADVVAENIDALRSLFPEAFEEGKIDFEVL
FT                   KQLLGGAVDERDEKYGLNWHGKRKARQIALTPSTGTLLPCPDESVDWDTTQNLVIEGDN
FT                   LEVLKLLQKSYAGKVKLIYIDPPYNTGKEFIYPDRFQDNLDTYLKYTGQKGEDGLKTTS
FT                   NTENDGRFHTNWLNMIYPRLKLARTMLADDGAIFISIDDNEKANLKEICDEIFGEDNFL
FT                   TAIIVQSNKRGQTYKEIAKCHEYILVYYKTENGALGELDKDGDALPYADEHGGYDLWEL
FT                   RNRNPKFGRHNRPNLYFPIYVNPNSVGANGLASISLTKSDEYCREALPKNSEGADSCWR
FT                   WSSKKVQTDGIDATPITVFAKQRRDGEWNIYEKSRKSTTKAKSIWSDTAVISEQGTVEA
FT                   GKLGMSGVLDFPKPIELIRRCVFLGTNEDDLVMDFFAGSGTTAHAVMLQSAQDGLSRRW
FT                   ISVQLPEPTYEYKDGEKVAKPQNKIAFENGHETIADICKERIRRSANKLKEEYPGNNAD
FT                   LGFRVFKLAQSNIRAWEPEPSDIEGTLLANAEHLAQGRSEQDVLHELLLKLGLDLCVPI
FT                   EKKQIAGKAVHSIGGGALIVCLADGLTKDVVEALANGIVAWRKALAPAVDTRVVFKDSG
FT                   FADDVAKTNMAAILNQNGILDVRSL"
FT   gene            644069..647051
FT                   /pseudo
FT                   /locus_tag="Nham_0583"
FT   gene            complement(647248..647715)
FT                   /locus_tag="Nham_0584"
FT   CDS_pept        complement(647248..647715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61473"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM4"
FT                   /protein_id="ABE61473.1"
FT                   /translation="MNVYRPAEAIRQYRVLIDDVDDSTAGERAEVAAHREEYGDEYMPA
FT                   RRHGPENAALLLRFMHEVHGIPLSQASQSVVELLKELDVLRFNGRDPVVVATGLLRATG
FT                   NVIIAAATASLYAEAAKGSASEQSWQDVVDALWHADLVEDDTEQAKGRTLH"
FT   gene            complement(647842..648411)
FT                   /locus_tag="Nham_0585"
FT   CDS_pept        complement(647842..648411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0585"
FT                   /product="Resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61474"
FT                   /db_xref="GOA:Q1QQM3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM3"
FT                   /protein_id="ABE61474.1"
FT                   /translation="MTENIGYARVSTEEQNLDLQLTALREAGCKRIFRDKASGATARRK
FT                   GLTEAIASCGAGDVLVVWKLDRLGRSLLDLIGLIEGLNGRGVGLRVLAGHGAMIDTTRP
FT                   EGRMIFSMLAVLAEFERELIRERTIAGMRAARARGAAIGRPRKLSATQIRRAKTLIESG
FT                   RQTRARVAARLGVHVGTLRRAITGAD"
FT   gene            648625..648903
FT                   /locus_tag="Nham_0586"
FT   CDS_pept        648625..648903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61475"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM2"
FT                   /protein_id="ABE61475.1"
FT                   /translation="MRSIAVLLFLISFAILADAATRILTAAADENRTAIIADGPRGIVR
FT                   VMAGGREVARFDAAGLHVRNEIEYGGSISDTGVQYFDERAGGSRAPQ"
FT   sig_peptide     648625..648684
FT                   /locus_tag="Nham_0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.821 at
FT                   residue 20"
FT   gene            648869..652162
FT                   /locus_tag="Nham_0587"
FT   CDS_pept        648869..652162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61476"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM1"
FT                   /protein_id="ABE61476.1"
FT                   /translation="MNAREAAVRRSNRLRIRLLTLSGLVALAAAPAFAAEPTPGSACTG
FT                   VGNYTVSGGPELSGVGHLMVCSGSVWNSVLDFDAAANSVLPYALSLSGDISPAQITANQ
FT                   NDYNPAGLSTASVLRMSSDASRNVTSLAGGVDGRIVTLMNIGSNSIILKNDDGATGTAA
FT                   NRFALAGDLALTPNQAVILTYDSTASRWRAASNGTATSTFSCPSGFTKLQSQGQTLGCM
FT                   KDSVVAASGLNCRDAATSCWNSYGGRLPTYNEYKAAQASIGGFTIHANLEWVGSPSWNS
FT                   ADNESCGGIEPTAGGIPSSYPYTRTDHAYRCFIPAGSNGGPGSSANAAGSDTQVQFNDG
FT                   GTALGGDGGLIYNKATDTLTTGALTVNSALGVTGATGVAGTLALSGDISPAQITANQNN
FT                   YNPAGLSTASVLRVNSNASRNITSLAGGADGRVVTVMNIGSFPIVLKNDDGATGTAANR
FT                   FALTGDLALAAKQSAMLMYDSTALRWRQIANGTATGSGDNLGNHTATQNIVLGSNYLSG
FT                   DGGNEGIAVDASGKIGIGITPATALLTVNGDAVVNTSLTAFGGMLGSNGSVGTPGYRFY
FT                   FDPDTGLYSPGDNANVLGFVTGGTERARIDANGNVGIGTSPVSGTRISVADSGGGVSEI
FT                   ATLINSSPASAGTGVGIVYQGPSSIKLGSVGAMWEDGTGNNSGLYFNTRNTSYSSKMYL
FT                   SAAGDLGIGTIGVPKERLHIYSTDPAETGLTIATPGTGDQQAVLNLLTKSNGSDTLGDA
FT                   TSAGWQIWANGDGSTAFGAIGGPNTFGIGFVDGAGWDPAAFQILPNGRIGIGTHANGEL
FT                   PGTTLDVGGSFALSGDISPAQIAADQNDYDPAEYDIKTSVLRLTSDASHSITGIVDGAD
FT                   GRVLTLLNVGSNPIVLSNQNASSAAANRFAIGADFTIGADQSVSLIYDDTSQRWRSASL
FT                   PFESSGLVGPSGCATIGDLCADGTVFAGYHPITQEHLFIPTTDQGTTSQWKTSTGTNDI
FT                   ATDSTYDGRANTNQVANSTTFPAFKLCKDLTTGGHSDWYLPSRVELYYLWSVQGTIEAA
FT                   GNITNLQNASYYWSSTEYDTNSAWPQYFPNGTQGYANKLTAFRVRCVRR"
FT   sig_peptide     648869..648973
FT                   /locus_tag="Nham_0587"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            652618..652854
FT                   /locus_tag="Nham_0588"
FT   CDS_pept        652618..652854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61477"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQM0"
FT                   /protein_id="ABE61477.1"
FT                   /translation="MARNANYSRKEARRETKAPSFIAYAVTEKGEDKSFWTRIGAAWDH
FT                   EDGKGLTLQLDLVPVNGGRIVLRTPSEDQEKGA"
FT   gene            652851..653096
FT                   /locus_tag="Nham_0589"
FT   CDS_pept        652851..653096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61478"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL9"
FT                   /protein_id="ABE61478.1"
FT                   /translation="MSALLSPPEDIVMCKHVHIESARAALARAAWVRGEAPAYGEDAVT
FT                   DLLTDIRHLCAAAGLDFDRCDRVAAMHFEAEHGGAS"
FT   gene            complement(653153..653446)
FT                   /locus_tag="Nham_0590"
FT   CDS_pept        complement(653153..653446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61479"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL8"
FT                   /protein_id="ABE61479.1"
FT                   /translation="MVTRAPRGDKGKTAATKTDALRIKLRGRDNAPLSIAEWRDALFEA
FT                   ARQLAQYEPDYRIKTADIYLRIVDENGTQVRINAKNEITIYPYKAAADEHGV"
FT   gene            complement(653479..654057)
FT                   /locus_tag="Nham_0591"
FT   CDS_pept        complement(653479..654057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL7"
FT                   /protein_id="ABE61480.1"
FT                   /translation="MTNWLKPYSKLPATRATALPAKQDFNAKLAAFKKAHGFRERYTML
FT                   CHCSRHGRPFEVVFERASEADRFTVSAVNKLAEHAGGGSSAAPQEKRFDVKQFNTSGWH
FT                   CAWCSAQSWIHCHCGRNNCDYRFRQTGGTLYKCEPGCGATGDIVPMTEIAASAASGAPA
FT                   SMKGRGASALPSTNRTSLPRPDLPRLTGK"
FT   gene            complement(654054..654815)
FT                   /locus_tag="Nham_0592"
FT   CDS_pept        complement(654054..654815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61481"
FT                   /db_xref="GOA:Q1QQL6"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL6"
FT                   /protein_id="ABE61481.1"
FT                   /translation="MATLKSETGSDALGFVGWTLYAMVGLCFCLVAFEFVGIRLPVSDS
FT                   PGLRLLEILAYSAIGCAMLHLILTVVYAFVRTISATLLAGLEIVLGFAERLGTTLAQFA
FT                   IRLLLALARLALVPVVWPWRTFQARVLAPWQERRRQTAELRRLYADVKDQYRTFDDFLR
FT                   AFNGESRNDKDTRKDDRRDERADPAPADAFAAACALFGLAAADSFTNAAFKAAYRKRMK
FT                   EAHPDLSGNTALAAKLNEARDLINARKGWKR"
FT   gene            complement(654831..656558)
FT                   /locus_tag="Nham_0593"
FT   CDS_pept        complement(654831..656558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0593"
FT                   /product="TRAG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61482"
FT                   /db_xref="GOA:Q1QQL5"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL5"
FT                   /protein_id="ABE61482.1"
FT                   /translation="MDLETIAYLGLGVSTFALVSWRSQKTETTFGSAEWLQPWVASRKG
FT                   MFRRGGLVLGDWTGLSPVYYRGAGHALTVAPTGSGKGTSAIVPNLLRHPFIFLIDPGGE
FT                   NTAIAAKVWRKKGYAFSCLNPWRMHTTAPWSLPSHSLNPLGILDSESETFASDADLLAD
FT                   MIVTRTGSESGSSAFFKDEAQSGIRAFLMHIVTTEPEERRTLTTLREYIAANAESWDAL
FT                   IASMKTNKAAGGIVAREAEQMERREANAGGEFSAVLSTMKQDTNFIEDPIMQAALSRST
FT                   VDLTVLKGRRGNEKLPGAVLSVIIPLEYLDTHAAYARLIVGCALWTMQRGPLARERVLF
FT                   LMDEFPALKRMDRIAGGLATLRKYRVWLWPVIQNIGQLKELYRANWQTFLSNAGLKMFM
FT                   GAGDLETAQYISELCGDATIEVTTKTPGGESVSPAVRRLVTIEEVMHANGGQQIVFVDN
FT                   LKPLLLRKTPYWNRPSLRRAFHRNPYQAGTPGLPFRTPFAALCGVFLRCAAWLAGPPPS
FT                   VVALIFFALATWSHLGISLGRGTEASNPACLYLQTDGVKRGYVRSAQTPCPLFIFTEL"
FT   gene            657378..657731
FT                   /locus_tag="Nham_0594"
FT   CDS_pept        657378..657731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61483"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL4"
FT                   /protein_id="ABE61483.1"
FT                   /translation="MTETPQKTRDSSTNSGNTRLDYMLLRLAFTGNLTAIRGALSEGAN
FT                   VNAIHEQTGLSALHIAVGTNNLELTQYLIEEAGATIGPDRSGRWPTIIAAECEVDAVLS
FT                   DYVLDVEANISGV"
FT   gene            658042..658419
FT                   /locus_tag="Nham_0595"
FT   CDS_pept        658042..658419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61484"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL3"
FT                   /protein_id="ABE61484.1"
FT                   /translation="MDARKEAVMSRSGSDKRHRKTMLAARFNNHEAEAVRQLADRAGTS
FT                   VASVIRGAVLRTPATRATRRPTINHQMAARLLGELGRVAEVFRSAQAAGRIDPNDPFVA
FT                   AAFRDLAEMRTVCFQAMGRSP"
FT   gene            658416..659858
FT                   /locus_tag="Nham_0596"
FT   CDS_pept        658416..659858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61485"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL2"
FT                   /protein_id="ABE61485.1"
FT                   /translation="MILKGNQRAGGTDLATHLMNAFDNERVEVAQIRGTVAEHLHGAFA
FT                   EYEALAAGTRCKEPLYSLSVNPSAPLAREQYYAAIDRIEQRLGLSGQARAVVFHVKHGR
FT                   EHAHVVWCRIDTAKMRAVQLSHDRQKLRGLARELAMEFGLELPEGLAEDKRTERARKKE
FT                   QTLAEKAQAEATGITPEQRRAEITQAYRRSDSAEAFRAALKEKGYVLAAGDKRVYVVVD
FT                   RFGKIHSLARQIDGVRTREIGQKLAAIEAQVEGVDAVKATIAQREASSRARIDQRVKHA
FT                   MAERAAKLATLHKARRHKLGGKDQQLATTHGAERMSLHAAHKAEADKPFARAAGAIFAL
FT                   FDRVPGLRSVIAPLRRNPKINPTERHRIEREALERRHQRERLVLDRRTKALSRLEAWEL
FT                   RSLATAVRRQVQEMEAAREQKAETVQDQIVVNKLDIVLPHGELHAEANKKKGWKARQDK
FT                   LGAGKNREQDQSRGYRRGRDEP"
FT   gene            659855..660082
FT                   /locus_tag="Nham_0597"
FT   CDS_pept        659855..660082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61486"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL1"
FT                   /protein_id="ABE61486.1"
FT                   /translation="MKKEEAHTDHGTVLKPDQAALVFDTDGRMSVVLPDMSPDAEIPTG
FT                   WQLMLAIIQKYNDPDWVAEMVGDRHRPETH"
FT   gene            complement(660095..660171)
FT                   /locus_tag="Nham_R0011"
FT                   /note="tRNA-Pro6"
FT   tRNA            complement(660095..660171)
FT                   /locus_tag="Nham_R0011"
FT                   /product="tRNA-Pro"
FT   gene            complement(660345..661097)
FT                   /locus_tag="Nham_0598"
FT   CDS_pept        complement(660345..661097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0598"
FT                   /product="phage Gp37Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61487"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQL0"
FT                   /protein_id="ABE61487.1"
FT                   /translation="MANNSSIEWTEATWNPVVGCTIISPGCTNCYAMRMARRLEAMGQP
FT                   KYAGTTRMSGGRPKWNGVVRIDEESLLLPATWKTGRLIFVNSMSDLFHENVPLAFIKRV
FT                   FTTMRKTPQHTYQILTKRAERLGELSAKLAWPANVWMGVSVENEDYVYRIDCLRRTQAA
FT                   IRFLSLEPLLGPLDNLDLTNIDWVIAGGESGPHARPVEADWIRNIRDQCFDEGVAFHFK
FT                   QWGGANKKKTGRVLDGRTWDEFPAGSGV"
FT   gene            complement(661087..662214)
FT                   /locus_tag="Nham_0599"
FT   CDS_pept        complement(661087..662214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61488"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK9"
FT                   /protein_id="ABE61488.1"
FT                   /translation="MNTAKFFDERTDQSEVKARIVQKYFYAWANVIMPTAQKNGGRVAY
FT                   IDLYAGPGRYKDGAASTPLLVVGHAIADPKLASMLVTLLNDSDGNKTSTLQNEIDALPG
FT                   IGNLKHKPVVSCGEIDEEAEKYFSQVKLVPSFSFIDPFGYKGLSLKIIKGVIKDWGCDC
FT                   VFFFNYNRINAGIGNQVVADHMDALFGKVRADALRARLPGLSPELREALILEELAAEIK
FT                   ALGGTFVLPFTFRNASGTRTSHKLIFVSKNFKGYAIMKDIMAKESSTEDQGVPSLAYSP
FT                   ADWSMPLLFSLQRPLDQLRATLLKDFAGQELSVVQIYERHSVDTPYVLKNYKEILTALE
FT                   AEGKVAVRSLKGSRRKGTFADHLLVRFPAGGVDGE"
FT   gene            662441..662620
FT                   /locus_tag="Nham_0600"
FT   CDS_pept        662441..662620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK8"
FT                   /protein_id="ABE61489.1"
FT                   /translation="MKRRCPGDLQATLGPSPSDGDCTFLDRRPAAAYMSKAETWRELSG
FT                   GEIEFIMRRLRSAD"
FT   gene            662774..663919
FT                   /locus_tag="Nham_0601"
FT   CDS_pept        662774..663919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0601"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61490"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK7"
FT                   /protein_id="ABE61490.1"
FT                   /translation="MVKMVQALQAALVSLAVCLSVTAPASADDALLKDMVSFQGQIAFM
FT                   QMKVPGMVLAVVRNGESIVVGYGERADGAREPDGDTVIRVGSISKAFAGQVLASLTADG
FT                   TVRLSDRLQDRLGWPSVMVPKKDGREITLLDLATHGSGLPREVALERDPARPDLVSREM
FT                   YKVALKDQGLLFAPGTGLHYSNYAFDLLGEALSNSAGKPYAQLLQERVFAPAGLKDTAV
FT                   RLSDAQKARLFQGHGPDGKAYPLTEVSDMQAAASGLFSTPNDMVRWLKWHLDRFGRDDA
FT                   EMRTLDHATYRVRDGLDPVSGLDESGHMDAMGLGWVVMNPADARPLVLQKAGGRQGTLS
FT                   YIAFSPARGVGVFISINAFDFAAGAAMPAFANELISQLAPR"
FT   sig_peptide     662774..662857
FT                   /locus_tag="Nham_0601"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            664478..664762
FT                   /locus_tag="Nham_0602"
FT   CDS_pept        664478..664762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61491"
FT                   /db_xref="InterPro:IPR021937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK6"
FT                   /protein_id="ABE61491.1"
FT                   /translation="MKTVLSAVLAIGTLVSASAPALAQHRTLAQFRATFAQYPAFAQSD
FT                   AYCLQGDGWGYSGDCRFSTFEACRATASGIGGTCDRNPSGSNYYPTLGW"
FT   sig_peptide     664478..664549
FT                   /locus_tag="Nham_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(664806..665036)
FT                   /locus_tag="Nham_0603"
FT   CDS_pept        complement(664806..665036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK5"
FT                   /protein_id="ABE61492.1"
FT                   /translation="MSSIEPLAREVCELVCRQNGMAEADIPAWVDSHWEAAAAEIEAGN
FT                   CDDNGEIIPGPDWQKGAEAYRERMAAKHKPK"
FT   gene            666361..666591
FT                   /locus_tag="Nham_0604"
FT   CDS_pept        666361..666591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61493"
FT                   /db_xref="GOA:Q1QQK4"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK4"
FT                   /protein_id="ABE61493.1"
FT                   /translation="MIRFAAILSLLPLLAISAAASAQTAAEKHHSECARDVARYCRAKM
FT                   NDGDMVVLACLKEHRAKLSKKCARTLVEHGQ"
FT   sig_peptide     666361..666429
FT                   /locus_tag="Nham_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 23"
FT   gene            666725..667204
FT                   /locus_tag="Nham_0605"
FT   CDS_pept        666725..667204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0605"
FT                   /product="protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61494"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK3"
FT                   /protein_id="ABE61494.1"
FT                   /translation="MLDRLRHFITEVVTLEAPGHRSFDETGCKLAATALFVHVISLDGK
FT                   PSGVEIRKLHDLIESRFGLDPGTADKLIESAALVEGEAVDLYRFTSVLMRSLNDEDRLR
FT                   IVEMMWELVYADGRVSEFEENVVWRAADLLAISSRDRIELKHRVAGKRTAVDPAT"
FT   gene            667327..668097
FT                   /locus_tag="Nham_0606"
FT   CDS_pept        667327..668097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0606"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61495"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK2"
FT                   /protein_id="ABE61495.1"
FT                   /translation="MTLITGASSGIGAELARVFSAHKHRVALVARRADRLDTLAAEIAA
FT                   AGGAPPIVIPCDLGRTDAGDRIAAVLAAESADVEYLVNNAGYGLFGSAAELDRADQLAM
FT                   IDLNVRALTDLSLRFSESLIRLRGGILNVGSIAGFLPGPGMAVYYASKAYVLSFSEALR
FT                   GELGPRGVRVTVICPGPVPTEFQARAGMKPGFDSAILNVSAKDIARDGYRGLMANKRAV
FT                   LPGLGIKMLPFLLRLFPRDVILRAVAGFQMRRRS"
FT   gene            complement(668215..668290)
FT                   /locus_tag="Nham_R0012"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(668215..668290)
FT                   /locus_tag="Nham_R0012"
FT                   /product="tRNA-Ala"
FT   gene            668688..668978
FT                   /locus_tag="Nham_0607"
FT   CDS_pept        668688..668978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0607"
FT                   /product="protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61496"
FT                   /db_xref="GOA:Q1QQK1"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK1"
FT                   /protein_id="ABE61496.1"
FT                   /translation="MRAILDIVLIILDLYVWLLIASAILSWLIAFNVVNTRNQFVAAVA
FT                   EFLERITEPLLGPIRRLLPNLGGLDISPIILILIILFMQRVITYYIYPAVF"
FT   gene            668990..669310
FT                   /locus_tag="Nham_0608"
FT   CDS_pept        668990..669310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0608"
FT                   /product="protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61497"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQK0"
FT                   /protein_id="ABE61497.1"
FT                   /translation="MEPWRHSSQGLSIALRVTPRGGRDGIDGIEMLADGRPVVKVRVRA
FT                   IAEGGEANRAVMAVLAKALGVRKIDVRILAGATSRLKQVAVGGDPVKLGDALRALTAAQ
FT                   PE"
FT   gene            669328..670212
FT                   /locus_tag="Nham_0609"
FT   CDS_pept        669328..670212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0609"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61498"
FT                   /db_xref="GOA:Q1QQJ9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQJ9"
FT                   /protein_id="ABE61498.1"
FT                   /translation="MTASIIDGKVIAADLRARVAFEVARVKRDHGLTPGLAVVLVGSDP
FT                   ASEVYVRSKHKQTQAAGMASFEHVLPADVAQPDLLALVARLNADPAVHGILVQLPLPKG
FT                   LDTETIVAAIDPAKDVDGLHPHNAGRLAGGLPALSPCTPLGCIILTKSVHSSLEGMDAI
FT                   VIGRSNLVGRPLVQLLLNENATVTIAHSRSRNLPELCRRADLVYAAVGKAEMVRGDWLK
FT                   PGATVIDVGITRRPAADGKTRLIGDVAFDEAMEVAGAVTPVPGGVGQMTVACLLVNTLR
FT                   AACAIKGLPAPGV"
FT   gene            complement(670344..670874)
FT                   /locus_tag="Nham_0610"
FT   CDS_pept        complement(670344..670874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0610"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61499"
FT                   /db_xref="GOA:Q1QQJ8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ8"
FT                   /protein_id="ABE61499.1"
FT                   /translation="MRIDAISIGPNPPFEVNVIIEVPVGGEPIKYEMDKDAGTLVVDRF
FT                   LYTAMRYPGNYGFIPHTLSQDGDPCDVLVASTRAIVPGAVMSVRPVGVLLMEDEAGGDE
FT                   KIIAVPTSKLTQRYDRVKNYNDLPDITLQQIRHFFEHYKDLEPGKWVKVLRWGGAEDAH
FT                   RLILEGIARAKGE"
FT   gene            complement(671077..671628)
FT                   /locus_tag="Nham_0611"
FT   CDS_pept        complement(671077..671628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0611"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61500"
FT                   /db_xref="GOA:Q1QQJ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ7"
FT                   /protein_id="ABE61500.1"
FT                   /translation="MDLEDRAPTCFDQDMSTTLIELRPAKVADASAVAATHDEAWRSAY
FT                   RGIIPGAELEKLINRRGPHWWDSAIRKGSRVSVLVFGDNVAGYANYGRNRARSLQYDGE
FT                   IYELYLRPEFQGLGFGRRLFTAARRDLMQSGLKSMVTWALSDNEPATEFYRALGGRMVA
FT                   RSSERFGPKSLDKVAFAWTG"
FT   gene            complement(671772..672542)
FT                   /locus_tag="Nham_0612"
FT   CDS_pept        complement(671772..672542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0612"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61501"
FT                   /db_xref="GOA:Q1QQJ6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ6"
FT                   /protein_id="ABE61501.1"
FT                   /translation="MQAVRRDIVAGAVGVAAASALDASAAQAAADDELKAIPELAPHWK
FT                   KLDLAAILRKPAAFASVSQNNSLYQPWGAQAAEKQWERGNLAATVKVVNAARKASNFKS
FT                   FNWIGYEVFRANYPQSEFDRVQYESWTGALDFPPEKQKADNELVPELRALVQPGDLEFN
FT                   ELAFQTAFVGTQLPLELSRKRIDVLVLTGIHTDWCIEGNARAARDNGYLPIVIGDATGT
FT                   KKPEQLAGALERINNFFAPVISSDTFVRLLGQSN"
FT   sig_peptide     complement(672456..672542)
FT                   /locus_tag="Nham_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.755 at
FT                   residue 29"
FT   gene            complement(672837..674096)
FT                   /locus_tag="Nham_0613"
FT   CDS_pept        complement(672837..674096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0613"
FT                   /product="amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61502"
FT                   /db_xref="GOA:Q1QQJ5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ5"
FT                   /protein_id="ABE61502.1"
FT                   /translation="MPHNLPSTVDVAIVGAGAAGLGAANALKDSDLSIIVLEARDRVGG
FT                   RAHTIVPTPGIVFDLGCGWLHSADRNSFVGIAGRLGFEIDKTRPPWHEQSFDAGFPITE
FT                   REDFMAALDAFDGRMEEAAESDTDKAASLYLAPGNRWNPMIDAISTYVNGCELDSVSVH
FT                   DVDAYEDTGINWRVRRGYGALIAAYGRPCPLALNTRVWRIDHSGRRIRIETSKGTLTAA
FT                   QAIVTVPTNLIANQTIRFHPELPAKVDAAAGLPLGIDDKVMLALDDPESTFPKDGNLRG
FT                   ATMQTKMGTYHLRPFGQPCIEGFFGGSFARELEDAGDGALAAQAIDEIVALLGSTYRSK
FT                   LKPLAESRWARDPFAQGAYSHALPGHAGERAALAAPVDGRLFFAGEATSPHFFSTAHGA
FT                   RDSGERVAREVMDAVRLPKR"
FT   gene            complement(674305..677028)
FT                   /locus_tag="Nham_0614"
FT   CDS_pept        complement(674305..677028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0614"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61503"
FT                   /db_xref="GOA:Q1QQJ4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQJ4"
FT                   /protein_id="ABE61503.1"
FT                   /translation="MTIQPAVPTSPTNAAPEAARVTPMMEQYLEIKAANPGLLLFYRMG
FT                   DFYELFFEDAEIASCTLGITLTKRGKHQGADIPMCGVPVERSDDYLHRLIAAGHRVAVC
FT                   EQMEDPAAARRRGNKSVVRRDVVRLITPGTLTEDTLLDARANNYLLALARARASSGGNR
FT                   IALAWIDISTAEFIVTECSTGELAATLARINPNEVIVSDALYGDPDMAALLRELPSVTP
FT                   LTRDVFDGATAERRLCDYFAVATMDGLSAMSWLEATAAAAAVTYVDRTQIGKRPPLSPP
FT                   SREAAGSTMAIDPATRANLELTRTLAGERRGSLLDAIDRTMTAAGSRLLAQRLAAPLTD
FT                   IAAIARRLDAVAAFTSDSAARDDIRTILRTAPDMSRALARLSVGRGGPRDLAGLRDGIM
FT                   AADRTLARLSALPDPPQDIVAAMQALRRPSRELARELGEALAENLPLMKRDGGFAREGY
FT                   EPTLDEARKLRDDSRLVVAAMQARYTEETGVKTLKIRHNNVLGYFVEVTAQHGDKLTSA
FT                   PLNATFIHRQTLAGQVRFTTSELGEIEARIANAGDRALGLELEIFDRLAAVVVEAGDDL
FT                   RAAAHAFAQLDVAASLAKLATDENFTRPEVDASLGFAIEGGRHPVVEQALKRAGQPFIA
FT                   NACDLSPGPGQTSGQIWLLTGPNMAGKSTFLRQNALIALMAQIGSFVPATRARIGMIDR
FT                   LFSRVGAADDLARGRSTFMVEMVETAVILNQASERALVILDEIGRGTATFDGLSIAWAA
FT                   IEHLHEANKCRALFATHYHELTALSAKLPRLFNATVRVKEWHGEVVFLHEVLPGAADRS
FT                   YGIQVAKLAGLPPSVVARAKSVLAKLEAQDRGSTVRALVDDLPLFAVPSRAADESAPPG
FT                   EAAPLIEALKALHPDEMSPREALEALYALKAKLPKP"
FT   gene            complement(677143..678699)
FT                   /locus_tag="Nham_0615"
FT   CDS_pept        complement(677143..678699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0615"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61504"
FT                   /db_xref="GOA:Q1QQJ3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ3"
FT                   /protein_id="ABE61504.1"
FT                   /translation="MPAAAAHPAAVPGLRRNMVTICAMTATIMQALDTTIANVALPYMQ
FT                   GSLSASQDQINWVLTSYIVAAAIMTAPVGWIANRFGRKRIFILCSAGFTLASVMCGLSQ
FT                   DITQMVLFRLLQGVFGAALVPLSQAVLLDSYALHERAKAMAIWGMGVMMGPIMGPSLGA
FT                   WLTETYSWHWVFFVNLPFGLITVMGLIIFMDETRLDTKLQFDWFGFTALAIGIGALQLA
FT                   LDRGEQLDWLESWEIVIEFIVSAVGFYYFFAHSLTTKRPFVQFVIFKDRNFATALIFMA
FT                   VIGVVLFSTMALASPLFQNAYGYPILTAGFLLATRGIGTFVAMMMVSRLMTTFEARTLI
FT                   AVGLSLIAITLYDMTGWTADISVRAIAINSIVQGYGIGLVFVPMTTAAFMTLPDHLRTD
FT                   GTAMLTLVRNVASSIGISIVIARLTSGTIRVHAVLAEHINPFNDALQMPNVAGAINLNT
FT                   DMGRAMMDLIVSTQAQIIAFSQDFELVALVTICAIPLVLMLKSTKAAMRAPSTDHATVM
FT                   E"
FT   gene            complement(678704..679870)
FT                   /locus_tag="Nham_0616"
FT   CDS_pept        complement(678704..679870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0616"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61505"
FT                   /db_xref="GOA:Q1QQJ2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ2"
FT                   /protein_id="ABE61505.1"
FT                   /translation="MAEPALKFPSDRKDAPTEAEAPPTPTTVARPRRRLLASIRRYRRP
FT                   LLLVVLPLIALIAGLTFYLSGGRYVTTDDAYVGAQKVLITPEVSGKIDSVTVKEGQHVK
FT                   TGDPLFEIDPAPFRFAVQQAQAKLNDATIEYNTLKSNLANYAQSSALAQESINVKQRDV
FT                   DRKTALAKNNVGSQLDLDNSLSALVQAEGINQILLQQISSTRNKLLGDPDLPLAKFPDY
FT                   VQARAALADAQRNLANTELRAPIDGIATQVDNIQLGRFVAAGTPVFSVVDLGHPWVDAN
FT                   PKESDFTYVAVGQPVDLSIDSFPDHVFKGTVGSLSPGTGATFAILPPQNATGNFVKVVQ
FT                   RIPVRIYFDKDDPMVARLKSGMSVYVSIDTHHRRTLAGLLGLSRAKQD"
FT   gene            complement(679863..680351)
FT                   /locus_tag="Nham_0617"
FT   CDS_pept        complement(679863..680351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0617"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61506"
FT                   /db_xref="GOA:Q1QQJ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ1"
FT                   /protein_id="ABE61506.1"
FT                   /translation="MPDRSIESDFLFTVFEVQRLLRLFADKQASRYGLNRAQWAVLAKL
FT                   ERTEGLKQADVAELMEMRPITLTRLIDKLCKAGLIERCGDETDRRVNRLYLTKAARPLL
FT                   AKLAALRSEITRAALADISVSDAHRLIEQLEAVKDNVRNALQGGGHVNDDKAKEQRYG"
FT   gene            680588..681079
FT                   /locus_tag="Nham_0618"
FT   CDS_pept        680588..681079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0618"
FT                   /product="putative ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61507"
FT                   /db_xref="GOA:Q1QQJ0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQJ0"
FT                   /protein_id="ABE61507.1"
FT                   /translation="MTATKPTFPVPGHDHDRCAAEAISHAERICARRAQKFTPIRRQVL
FT                   QALLSSHRPLGAYEVIEELAKSMPRPAPITVYRALDFLMENGLVHRIESRNAFLACGHD
FT                   HDASAMVVFLICERCGSVGEIPASRVAQSLSDAVRTTGFTPKLSVVEITGTCAHCQTAA
FT                   "
FT   gene            681152..681412
FT                   /pseudo
FT                   /locus_tag="Nham_0619"
FT   gene            681426..682721
FT                   /locus_tag="Nham_0620"
FT   CDS_pept        681426..682721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0620"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61508"
FT                   /db_xref="GOA:Q1QQI9"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQI9"
FT                   /protein_id="ABE61508.1"
FT                   /translation="MNKLENPSQRDVAGPSPRHKTTQVMVGSIAVGGGAPIVVQSMTNT
FT                   DTADVEGTIAQVAALSRAGSEMVRITVDRDEAAAAVPHIRDGLRKRGIATPLIGDFHYI
FT                   GHKLLADHPACAEALDKYRINPGNVGFKDKRDKQFTDIVEMAIKYGKAVRIGANWGSLD
FT                   QELLTHLMEENANSAAPLEARAVTREAMVQSALLSAKRAEEIGLPKNRMILSAKVSAVQ
FT                   DLIAVYQTLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDTIRISLTPEPG
FT                   GDRTREVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQDFIRDEMPGWK
FT                   TQYPGVEQLNVAVMGCIVNGPGESKHADIGISLPGTGEAPAAPVFVDGKKFRTLRGPAI
FT                   AQDFKALVIDYIDQRYGSGGKTPTDATTAAAE"
FT   gene            complement(682799..684406)
FT                   /locus_tag="Nham_0621"
FT   CDS_pept        complement(682799..684406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0621"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61509"
FT                   /db_xref="GOA:Q1QQI8"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI8"
FT                   /protein_id="ABE61509.1"
FT                   /translation="MTETFLTSLLVLTVLAASAALARRLVTAPAIVFLVVGIALAFVPG
FT                   LPPIEMQPESVLLMVLPPLIYSAGVSMSWREFRSNLRPIALLAIGCVIFTTCAVAAATH
FT                   WLLGLPWGVGFVLGAIVSPPDVVAPLAIAKRLHLPHRILVILEGEGLANDATALILYRF
FT                   AVLAVSTGTFSLPSAAGSFGLILLGEIAFGALVGWLSLRLRQWAHDERVEILLSLLTPY
FT                   LAYWVPEHFGGSGVIATVVAGLYVSWNGPLLISAATRLQGIFFWDLAIWLIEGVLFLLM
FT                   GFEVRVLMEKAKAVPLNEVLVAIALTSAIVIAARFIWVFPGTYLTRVLSTRIRRRDPTP
FT                   PWRYVVVIGFTGIRGVVSLAVALALPLTLPSGEAFPYRDLIQLTSFGVIFVTLFGIGLT
FT                   LPFVVNLLGISQHGRREALNERDAEIAARRTIIEAARDALNTIIVERKLPEGLAKFLQA
FT                   RHETRMRALPEPPGEGDEHSPATKGSSMVREIIGIERTHLHRLLREGKITDETRRRIER
FT                   DLDLEEAVVDNREKHSPL"
FT   sig_peptide     complement(684338..684406)
FT                   /locus_tag="Nham_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.732 at
FT                   residue 23"
FT   gene            complement(684615..685301)
FT                   /locus_tag="Nham_0622"
FT   CDS_pept        complement(684615..685301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0622"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61510"
FT                   /db_xref="GOA:Q1QQI7"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI7"
FT                   /protein_id="ABE61510.1"
FT                   /translation="MAGKDAEDPSLLRFRKLPRPVRIIYARPRTFIAFAVGVVACLLLP
FT                   HSLRLVTRLLIGWDVFAALYLILVFTVVFGSGLTHIRRNARLQDDGRFVILLVTAIGAF
FT                   ASIAAIVFELGDHNHSAPELALATLTIALSWAAVHTTFALHYAHEYYRGATPGGLQFPS
FT                   GDRHEDADYWDFVYFSFVIGMTAQVSDVGITDRIIRRTVTAHGVISFVYNTALLALMVN
FT                   IAASAI"
FT   gene            complement(685310..686236)
FT                   /locus_tag="Nham_0623"
FT   CDS_pept        complement(685310..686236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0623"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61511"
FT                   /db_xref="GOA:Q1QQI6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI6"
FT                   /protein_id="ABE61511.1"
FT                   /translation="MTSGLSSADFVKRLDTTADETETLLGTLLSDAVLPDEIARPKRLM
FT                   DAMRYSSLGGGKRLRPFLVVESSAVFGVPRDSALLAGAALECIHCYSLIHDDLPAMDNS
FT                   DLRRGRPTLHKTADDATAILAGDGLLTLAFDIITRDEVHQDPAVRLLLTRALARAAGIG
FT                   GMVGGQMLDLAGEGRFGDREPVDVARLQQMKTGALLRFGCISGALLGQASQKDYQALDA
FT                   YGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFVTQLGIDGAKKRVRDLLAK
FT                   ADEALSAFGARGDVLRAAAHFVADRKN"
FT   gene            686485..687165
FT                   /locus_tag="Nham_0624"
FT   CDS_pept        686485..687165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0624"
FT                   /product="Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61512"
FT                   /db_xref="GOA:Q1QQI5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQI5"
FT                   /protein_id="ABE61512.1"
FT                   /translation="MRRAIGVTVLAVVGLLLLPYLLTPLYRTGHPVSTLMIWRKLSGAS
FT                   MSRQWIDFAAMSPALPRSVVASEDAKFCSHHGIDWDSLRDVLDDAEDGEVKRGGSTITQ
FT                   QVAKNLFLWPGRSVIRKALEFPLAMWIDAVLPKQRILEIYLNIAEWGPDGQFGVEAGSR
FT                   YAFGRSATGLTAREAALMAAILPNPVRRSARKPGPGVRRLAGTYMVRARAAELRSCWRD
FT                   DRGS"
FT   gene            687338..687523
FT                   /locus_tag="Nham_0625"
FT   CDS_pept        687338..687523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0625"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61513"
FT                   /db_xref="GOA:Q1QQI4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQI4"
FT                   /protein_id="ABE61513.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADAISKPTYAEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVLKAKSES"
FT   gene            687651..688301
FT                   /locus_tag="Nham_0626"
FT   CDS_pept        687651..688301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61514"
FT                   /db_xref="GOA:Q1QQI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI3"
FT                   /protein_id="ABE61514.1"
FT                   /translation="MSVIGFPLLLIPLAICNIIVFLMPGVLLTEPVVTLTLVSGVAWPV
FT                   TLGDVLLALGIVLLLFEVIKGSRPGGKYLTDHLLSLAVFAGAAAEFVMLPQFGSSTYFM
FT                   LTLLALVDFLSGFALRARRPARAVAVPSQEAPEAAAPELRFDPAPVPAPAAVSSPAPAP
FT                   AVPTAVPMAESIPKSAPEPVIVHPETTADEQQPDIPAPGIQPGGVTSSDQPRR"
FT   gene            complement(688432..688833)
FT                   /locus_tag="Nham_0627"
FT   CDS_pept        complement(688432..688833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61515"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI2"
FT                   /protein_id="ABE61515.1"
FT                   /translation="MDRHDPCEANRKRGRGVPKRHIPTGAGLMMTIAGTGRIAAIAANT
FT                   ARDDGVAEKSGDAAPVSVIAPVERPPVWRSAPRHDALFVTQLIAMAQHSPQTRVLRRAA
FT                   PQVAHAAYHSTSDRNLDSAQTGSRLRRVV"
FT   gene            688966..690744
FT                   /locus_tag="Nham_0628"
FT   CDS_pept        688966..690744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0628"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61516"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI1"
FT                   /protein_id="ABE61516.1"
FT                   /translation="MTSISPAANPSSGADASQAVNAPADRPQAPQVQAPQVSEILAALG
FT                   RAAFVWDIASDAITWTDEARSIFQDIDPALLATGAGFASLIEPSGSIRADILLATPPAR
FT                   RHGEGVPYRIEYGVRASASAPMLWIEESGCWFADADGKAVRAEGIVRLENERRARDEQL
FT                   IRLSRDDALTGELNRTHLTAALAEAIEEAARYRSSFAFMMVGIDHLARINDAFGFDVAD
FT                   EVIGDVARRIRARLRSGDVLGRFSGNKFGVILKNCTVDDMSVAAERLLAGIRDEIVPTR
FT                   SGPVSVTASIGAVLAPRYARNADEAINRAQEILEAAKSRRSGSFAVWRPSVERDAQRRI
FT                   NIRVTDEIVTALNERRIVTAFEPVVDARTREPAFYECLVRMHQQDGQVLLAPDVVPVAE
FT                   KLGLIRLVDHRVLELVIAELAEAPGVRLSLNISPETTMDADWWAAIESLMGAHPGVAER
FT                   LIVEITETVAIQDIDDVREFVTRLKTFGSRIAIDDFGAGYTSFRNLRKLGVDIVKIDGA
FT                   FVQNLARSSDDRAFVQTLIDLARRLDIRTVAEWVQDEQSAVMLRDWGCDYIQGRLIGLA
FT                   SPERPWSGPEAIPAAR"
FT   gene            complement(691013..691240)
FT                   /locus_tag="Nham_0629"
FT   CDS_pept        complement(691013..691240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61517"
FT                   /db_xref="InterPro:IPR021111"
FT                   /db_xref="InterPro:IPR038125"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQI0"
FT                   /protein_id="ABE61517.1"
FT                   /translation="MSDTWLPSLKTDTPQAGFELAVKLSRVGVKYTQPSDEVRSSLRSD
FT                   YDHDTTQLIASSHVIAVHFQTVAAANNWWR"
FT   gene            complement(691376..692434)
FT                   /locus_tag="Nham_0630"
FT   CDS_pept        complement(691376..692434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0630"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61518"
FT                   /db_xref="GOA:Q1QQH9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH9"
FT                   /protein_id="ABE61518.1"
FT                   /translation="MKQLRNTVIRAGLEALYFSGAHHLLRPIFAGIGTVFMLHHVRPRR
FT                   NSPFQPNHHLEVTPEFLRMTLAHVRSRGIDIVTADEMHRRLIERDVSRRFACFTFDDGY
FT                   RDNRDFALPAMREYDAPLTVYVANDFADGTGRLWWVALERIIAAVDRIDSTIGGAAVRL
FT                   DTRTVEDKQAAFAQIHDLLRALPDDRDVAREMSGLCARYGVDEAGISRELCLSWDELKP
FT                   FATDPLVTIGAHTVSHCNLAKRSEQQALEEITVSRTRIEAVLQRPVVHLAYPYGDRSAA
FT                   GPREFAFAKAAGFDTAVTTRPGMIFPENAEHPTALPRISLNGNYQTARVLPVLTSGAAT
FT                   AMWNGFRRVDAT"
FT   gene            692718..694109
FT                   /locus_tag="Nham_0631"
FT   CDS_pept        692718..694109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0631"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61519"
FT                   /db_xref="GOA:Q1QQH8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH8"
FT                   /protein_id="ABE61519.1"
FT                   /translation="MRGFFRWSSKWWPGLIPLAILWAVAAWTTTGPLEADLSAHAAAAL
FT                   KDSVLDKTAISAAGRDITFSAEAFSEQERSNAVASVEAVPGVRLVDDRTALVAEAKPFV
FT                   WTVEREVGKVTLSGSAPLPVVRNKLLDAARTTFAGIDIADRMNLSRGAPPRFETAAALL
FT                   IGEIGKLKTGKATISDGTVNLSGMARELGGREAIAAALKNLPEGYSVANDIHAPPYIFE
FT                   ANKDPVAATLTLTGYVPDNAVHAAIAASAGRKFGEKVVDKLKASLGAPAGFDAVVTRAL
FT                   GSLSRLSTGRLVVSDRDVDLSGDALYDAAGRQIRADLPKDLPRGWQAKMEVSVKPAAAP
FT                   VDAAVCQQLFADLLGKRTIQFETGRATLDPDSIGLLDRLTETALRCPTATIEIAGHTDS
FT                   DGDASFNQTLSERRAQAVVDYLVKAGMPADRFKPMGYGSVQPIAANDTDEGKAKNRRID
FT                   FTVRQ"
FT   sig_peptide     692718..692804
FT                   /locus_tag="Nham_0631"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.531 at
FT                   residue 29"
FT   gene            694114..694440
FT                   /locus_tag="Nham_0632"
FT   CDS_pept        694114..694440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61520"
FT                   /db_xref="GOA:Q1QQH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH7"
FT                   /protein_id="ABE61520.1"
FT                   /translation="MVYLAVFHWGWLAGSLLLGFAMGWIAVVHRGRGITKRAAQSLSVL
FT                   AAALIVAAFTHLVPGRFGYWLDLGLVMLGVYLVGCAVGSWLRDRVVSRQAASGGSAGHS
FT                   NVLE"
FT   gene            694559..695614
FT                   /locus_tag="Nham_0633"
FT   CDS_pept        694559..695614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61521"
FT                   /db_xref="GOA:Q1QQH6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH6"
FT                   /protein_id="ABE61521.1"
FT                   /translation="MLGSIRRAISVLRRKQILHKLGVAISVTVIAVAFYVLFHILRDTD
FT                   VDEVIEAVRQTEPRLIALSGLFVAAGYFTLTFYDLFAVRAIGVTHIPYRVAAFAAFTSY
FT                   SVGHNVGASVFTGGAVRYRVYSSCGLSAIDVAKVCFLAGLTFWLGNAAVLGLGIAYHPE
FT                   AATSIDQLPAWCNRLIAIAIILGLIGYVIWVGIRPRRVGSGPWTVVLPGGPLTLLQILI
FT                   GIVDLGFCALAMYVLVPDQPNVGFVVVAVIFVSATLLGFASHSPGGLGVFDAAMLVGLW
FT                   QMDKKDLLAGMLLFRLLYYVVPFVISIILLTLREIIISARMKRVGDVRSGSSAGPTGKL
FT                   SCLREHGDSGA"
FT   gene            695595..696947
FT                   /locus_tag="Nham_0634"
FT   CDS_pept        695595..696947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0634"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61522"
FT                   /db_xref="GOA:Q1QQH5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH5"
FT                   /protein_id="ABE61522.1"
FT                   /translation="MATPAPDRIRPTAEGAAPRTRVSASRFASWTDRLRRAALILLVAG
FT                   LVLAALVVFGGLQPPRAIVAFVCIVGAALVPWQVHDPAASREADLGANPVDTAAVHAIV
FT                   AGMPDPNVLLDRAGRVIHLNAAAAQLVPALRQNELAQFALRSPEIVTALREAVATRETR
FT                   RTTYLNHAPVDRWMELIVTPVPVPTAFGGVDHCMLLTFHDQTPLRRVEEMRADFVANAS
FT                   HELRTPLAALSGFIDTLQGPARDDAGARDRFLGIMHAQATRMARLIDDLLSLSRVELSA
FT                   HVRPDALVDLIPIVRQVVDGLEPLAAERQVRIEVELPQTPVMICGDREELLRLFENLIE
FT                   NALKYGASGSRVVVSSMMDVSLDGAPEFRVAVRDFGRGIAPEHLPRLTERFYRIDAGDS
FT                   RAQGGTGLGLSLVKHILNRHRGRLLIESVPGHGATFTAGFPPAQAVSRPEV"
FT   gene            697072..698097
FT                   /locus_tag="Nham_0635"
FT   CDS_pept        697072..698097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0635"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61523"
FT                   /db_xref="GOA:Q1QQH4"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH4"
FT                   /protein_id="ABE61523.1"
FT                   /translation="MSFIKAIVAAGLVAASASAFSLPARAADITGAGATFPFPVYSKWA
FT                   DAYKKETGNSVNYQSIGSGAGIKQILAKTVTFGATDAPLKADKLDKDGLLQWPMVMGAI
FT                   VPVVNVEGVTPGELVLSGELLGDIYLGKVTRWDDPAIAKLNPKLKLPSAPIAVVHRSDG
FT                   SGTSFNFTNYLSKVNAEWKSKVGEGTAVEWPAGVGAKGNEGVSGNVGQTKNSIGYVEYA
FT                   YAKQNKLTYAALINKAGKIVQPTVASFQAAAGNADWAHAPGYYVILTDQPGEASWPITA
FT                   ATFILMHKEPIDKTASAEAIKFFKWSFEKGGKMAEDLDYIPMPDQVLKQIEKTWTSEIK
FT                   S"
FT   sig_peptide     697072..697152
FT                   /locus_tag="Nham_0635"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            698224..699222
FT                   /locus_tag="Nham_0636"
FT   CDS_pept        698224..699222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0636"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61524"
FT                   /db_xref="GOA:Q1QQH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH3"
FT                   /protein_id="ABE61524.1"
FT                   /translation="MAEMAVHGSAMEAAGRYDRTRALNAFKFSDTAFYWTTRVSAILVL
FT                   VLLGGIIVSLIVGAWPAIMEFGSAFLTTQRWAPSADPPVLGALSPLYGTILTSVIAMTI
FT                   AIPVGIGIAIFLTELCPLWARRPIGMAVELLAGIPSIIYGMWGFFVLGPFLANTVQPFF
FT                   IDLFAGVPILGSIFGGPPSYLSLFNASLILAIMVLPFITAISRDVFATVPPVLKEAAYG
FT                   VGCTTWEVVRHVVLPYTRVGVIGGVMLALGRALGETMAVTFIIGNSFRISPSIFAPGTT
FT                   ISAAIASEFAESDGLHQSSLMLLGLLLFVLTFVVLAAARLMLLRLEKKAGK"
FT   gene            699305..700150
FT                   /locus_tag="Nham_0637"
FT   CDS_pept        699305..700150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0637"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61525"
FT                   /db_xref="GOA:Q1QQH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH2"
FT                   /protein_id="ABE61525.1"
FT                   /translation="MNPIYASRRRRDLIVRVLCFAAAAFGVSWLGLILFTLFYNGLAGM
FT                   SWQIFTQNTPPPGASEGGLLNAIVGSIMMTVIGVGVGAPIGLFAGTYLAEYGKHDRLSP
FT                   VIRFINDILLSAPSIIIGLFIYGAVVVPMGGFSALAGSLALAVIVIPVVVRTTEDMLNL
FT                   VPNSLCEAASALGLPRSLVIKRIAYRAARAGLITGVLLATARVAGETAPLLFTALSNQF
FT                   FSMDVTHTIANLPVTINNFVQSPYAYWKDLAWSGALLITLTVLALNIGARLIGSERTAK
FT                   "
FT   gene            700147..700965
FT                   /locus_tag="Nham_0638"
FT   CDS_pept        700147..700965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0638"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61526"
FT                   /db_xref="GOA:Q1QQH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQH1"
FT                   /protein_id="ABE61526.1"
FT                   /translation="MTDVSAAASRPAVPPSVIDPDAPAKVAARNLNFYYGQHQALKNIN
FT                   LSIAANRVTAFIGPSGCGKSTLLRVFNRMYDLYPGQRVEGQVLLDNTDILDPRLDLNLL
FT                   RARVGMVFQKPTPFPMTIYENIAFGIRLYEKLSKSEMDDRVEKALQGGALWNEVKDKLN
FT                   ASGLSLSGGQQQRLCIARTVALRPEVILFDEPCSALDPISTAKIEGLIDELKEHYTIAI
FT                   VTHNMQQAARVSDTTAFMYLGEMVEFGPTNKVFTSPADRRTQDYITGRFG"
FT   gene            700994..701710
FT                   /locus_tag="Nham_0639"
FT   CDS_pept        700994..701710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0639"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61527"
FT                   /db_xref="GOA:Q1QQH0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQH0"
FT                   /protein_id="ABE61527.1"
FT                   /translation="MAFEHTTKAFDDDLQELTRLVAEMGGLAERQIVESLDALIRRDTA
FT                   LGARVVAADAEIDRLQRMIEERAVLTIARRQPMAVDLRAIVGAMRVAADLERIGDLAKN
FT                   MGKRVVALDSDFHPMKLIRGLEHMTDLVQSQVKAVLDAYAARDLPAAMAVWKGDEEVDA
FT                   ICTSLFRELLTYMMEDPRNIGFCIHLMFCAKNIERIGDHATNIAETVFYMIEGQQMLDK
FT                   RPKGDTTGFASAAPGN"
FT   gene            701735..702436
FT                   /locus_tag="Nham_0640"
FT   CDS_pept        701735..702436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0640"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61528"
FT                   /db_xref="GOA:Q1QQG9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG9"
FT                   /protein_id="ABE61528.1"
FT                   /translation="MSARILVVEDEEALTTLLRYNLDAEGYEVETVARGDEADTWLKER
FT                   TPDLVVLDWMLPGLSGIELCRRLRARPETRQLPIIMLTARGEESERVRGLATGADDYVV
FT                   KPFSVPELLARVKGLLRRASPERLATILSFGDIELDRDKHRVARSGRPIDLGPTEYRLL
FT                   EFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLINPGGEPDPIRTVRGAG
FT                   YALDERFAKAE"
FT   gene            complement(702736..703242)
FT                   /locus_tag="Nham_0641"
FT   CDS_pept        complement(702736..703242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0641"
FT                   /product="Global cell cycle regulator GcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61529"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG8"
FT                   /protein_id="ABE61529.1"
FT                   /translation="MTVITWTDDRVEQLKKLWEAGLSASQIAAELGNVTRNAVIGKVHR
FT                   LGLSGRAKSPSSTVPRPRKARPAQHVMRVSRPVSRGNTALAHDFEVELEPDPIAFDNVV
FT                   PMSQRLSLLELNEATCHWPVGDPSSPEFFFCGGKALNGLPYCAHHSRIAYQPAADRRRQ
FT                   PPKVR"
FT   gene            703690..704901
FT                   /locus_tag="Nham_0642"
FT   CDS_pept        703690..704901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0642"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61530"
FT                   /db_xref="GOA:Q1QQG7"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG7"
FT                   /protein_id="ABE61530.1"
FT                   /translation="MTRAAPSHLLPVFARADLSFESGEGAWLVGSDGGRYLDFTSGVAV
FT                   NALGHCHPHLVAALQAQAAKLWHVSNLFKSPDGERLAARLCEQSFADFAFFANSGAEAV
FT                   ECAIKVVRRYHASKGHPERYRLVTFEGAFHGRTLAALAATGSKKYLDGYGPPTDGFDQV
FT                   PIDDIEAVKKAVGPATAGILIEPLQGEGGVREPSHAFFRALRQFCDERGLLLAFDEVQT
FT                   GMGRTGDLFAYRRIGVAPDVMSLAKALGGGFPIGACLATAEAASGMTPGSHGSTFGGNP
FT                   LAVAAANAVLDVMLEPGFFERTRKMSLLLKQKLASVVDRHRDVLSEVRGEGLLIGLKAV
FT                   VPSGDLVGALREEKLLTVGAGDNVVRLLPPLIVSEVEIEESVRRLERACAKLSGASAKK
FT                   EAAQ"
FT   gene            704898..705824
FT                   /locus_tag="Nham_0643"
FT   CDS_pept        704898..705824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0643"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61531"
FT                   /db_xref="GOA:Q1QQG6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQG6"
FT                   /protein_id="ABE61531.1"
FT                   /translation="MSTAPRHFLDLFDVPTTELRAILDASVAMKKRRKEGRIADKPLDG
FT                   KTLAMIFDKPSTRTRVSFDVGMRQLGGEAIMLTGAEMQLGRGETIADTARVLSRFVDII
FT                   MIRILSHDALTELAAHATVPVINGLTRRSHPCQVMADVMTFEEHRGPIKGRTVAWTGDD
FT                   NNVLASWAHAADRFSFNLNVATPPELAPNKLLKDWIRSSGASIKLGTNPEAAARGADCI
FT                   VTDTWVSMGDKDGEHRHNLLKPYQVNAKLMSLAKPDALFMHCLPAHRGDEVTDEVIDGP
FT                   QSVVFDEAENRMHAQKGILAWCLGAAG"
FT   gene            complement(706114..707997)
FT                   /locus_tag="Nham_0644"
FT   CDS_pept        complement(706114..707997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0644"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61532"
FT                   /db_xref="GOA:Q1QQG5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG5"
FT                   /protein_id="ABE61532.1"
FT                   /translation="MRPPPKARATRGFPDEEETSPMNLRNIAIIAHVDHGKTTLVDRLL
FT                   QQSGTYRDNQRVVERAMDSNDIERERGITILAKCTSVEWADTRINIVDTPGHADFGGEV
FT                   ERILSMVDGVIVLVDAAEGPMPQTKFVVGKALKLGLKPIVAINKVDRPDARVIEVVNEV
FT                   FDLFAALDATDDQLDFPILYGSGKNGWMGATVEDNDKGMRPLFDLVIKHVAPPVVEEGP
FT                   FRLLGTILEANPYLGRIITGRIASGSVKPNQAVKVLSRDGKTVESGRITKILAFRGLER
FT                   QPVDLAEAGDIVAIAGLTKGTVADTFCDPAVENPIQAQPIDPPTVSMSFIVNNSPLAGT
FT                   EGDKVTSRLIRDRLLREAEGNVALRVAEATDKDSMEVSGRGELQLAILIENMRREGFEL
FT                   SVSRPRVVLTKDDNGQLLEPIEEVVIDVDEEHSGVVVQKMSERKAEMMEMRPSGGNRLR
FT                   LVFHAPTRGLIGYQGELLTDTRGTAIMNRLFHGYYPYKGDIQGRRNGVLISNDQGEAVA
FT                   YAMFKLEDRGPMMIEPGWKVYRGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRL
FT                   TPPIRMTLEKALAYIEGDELVEVTPKSIRLRKKHLDPNERKRAEKTKEMVA"
FT   gene            complement(708219..708998)
FT                   /locus_tag="Nham_0645"
FT   CDS_pept        complement(708219..708998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0645"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61533"
FT                   /db_xref="GOA:Q1QQG4"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG4"
FT                   /protein_id="ABE61533.1"
FT                   /translation="MAAQQDQNHPDRPYNNLLRRLSNADFKLIEPFLITVTGESDNLLY
FT                   NPGDNVQIVHFPCGPSLASYLVPNEDGRDVETILVGREGAVGGIVSHGFLPAYTRIMIN
FT                   AGGPFVRLRVSKLEAAKAKSPTLRNLFARYADCMLAQVFQSTACNAIHSVEQRTAKWII
FT                   SAIERTGTDLVPLTHEQLSAMLGVGRSYTSRVIQTFKAEGVLETRRGAILVHDRDALAS
FT                   RSCLCHDAVKRHFEEVLRGVYPTEEARPAKQSLSSAK"
FT   gene            709160..709579
FT                   /locus_tag="Nham_0646"
FT   CDS_pept        709160..709579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0646"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61534"
FT                   /db_xref="GOA:Q1QQG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG3"
FT                   /protein_id="ABE61534.1"
FT                   /translation="MMEVMATFVPDSPAAVPDTIPGDVLIVEDDAIIALDFEQTVTEFG
FT                   VTSVRIASNVAQALAMIAERAPDFALLDIGLFEEKSFAVAKRLAALKTPFAFVTGYSGE
FT                   RAFPAEYSDRPKLSKPFSCDELFAVLSDWRSCGAR"
FT   gene            complement(709940..710185)
FT                   /locus_tag="Nham_0647"
FT   CDS_pept        complement(709940..710185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61535"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG2"
FT                   /protein_id="ABE61535.1"
FT                   /translation="MAPKKPKPGVRTRDGGEYTCPGCGAIYRVTVFTSPFKDTGHADCE
FT                   VCNLPIKSWNQATAWWSYKLTKRPRQVIREPAKTSP"
FT   gene            710606..711787
FT                   /locus_tag="Nham_0648"
FT   CDS_pept        710606..711787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0648"
FT                   /product="NnrS"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61536"
FT                   /db_xref="GOA:Q1QQG1"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG1"
FT                   /protein_id="ABE61536.1"
FT                   /translation="MAMSDVENARGRPLAIWTIGFRPFFLMAGIWSAAALAGWIAMLTT
FT                   GLTLPSRFDPLTWHIHEMLFGFVLAAIAGFLLTAIPNWTGRAPISGRPLAALAALWLTG
FT                   RLACLMSASIPLWLAAATDLAFPFVLCAVVAREIIAGRNWRNMPMPVPIAVLGLADLLM
FT                   YLELAGFSVPAGLGWRLGLAAIIVLISVVGGRIIPVFTRNWLVKQGAANLPAAHGRVDN
FT                   VALGALHAGMIGWALFPALSPVGGLLLLAAALNLWRLVRWRGIATSAEPLLTVLHVGYL
FT                   WVIVGAALLGASMLTAHVPEAAAIHALTAGAIGTMVLGVMTRVSLGHTGRALAADRTTA
FT                   LIYLLVILAAVARVAAAASGSLPMLIEISAALWIASFGLFALRYGPMLLAPRV"
FT   gene            complement(711895..712149)
FT                   /locus_tag="Nham_0649"
FT   CDS_pept        complement(711895..712149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61537"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQG0"
FT                   /protein_id="ABE61537.1"
FT                   /translation="MRTYILSLAAAVSLGAAAPAMAYDTGSLLSMQEALAVATDIGLVT
FT                   VSDAEFAGYEWQIEGRDISGRYIEVDVDATTGEVLNVDR"
FT   sig_peptide     complement(712081..712149)
FT                   /locus_tag="Nham_0649"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            712225..712611
FT                   /locus_tag="Nham_0650"
FT   CDS_pept        712225..712611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61538"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF9"
FT                   /protein_id="ABE61538.1"
FT                   /translation="MRSTVARSELRDCLAAAAFSWPYVGERKTKASALDPAFCIMQCSP
FT                   VWRSAISAFPSNARRLAFGIQEPDHPIRTPSQIRQSAPKARRFLVLHDRVCISAVDDRA
FT                   VSIYIRECRGRYGESTWRRTIGST"
FT   gene            712584..713510
FT                   /locus_tag="Nham_0651"
FT   CDS_pept        712584..713510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0651"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61539"
FT                   /db_xref="GOA:Q1QQF8"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF8"
FT                   /protein_id="ABE61539.1"
FT                   /translation="MAPHYRKHLNVLAPVVVVIGFMIGLVAYSPELYRVFCSATGYGGT
FT                   TQRVYSGPTAASSKTVTVRFDTNVAPDLPWRFEPEQRSVTVHLGEQKMVFFTAENLGKE
FT                   PIVSHATYNVSPDTSGPYFKKIQCFCFNEERLDPHEKIEMPVVFFVDPAFAKDSDNKSV
FT                   DTITLSYTLLRSVNPSESKNLSRFLPNAPPDPLHGKQLFSERCTACHALDADKAGPRLG
FT                   GVVGRKAGALPGYHYSPALKNAGLVWSRDNLEHWLADPKKLVPGSRMPVRVLDAPSRHD
FT                   IVAYLQTVGQERNKRAGSNPPAPGGEF"
FT   gene            713834..714502
FT                   /locus_tag="Nham_0652"
FT   CDS_pept        713834..714502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0652"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61540"
FT                   /db_xref="GOA:Q1QQF7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF7"
FT                   /protein_id="ABE61540.1"
FT                   /translation="MDTSHLAEHLGTIGSLAASFFVVATYTMRTMIPLRVFGMLANLVL
FT                   MITAISLHNVLQFGLHAGLFCLNGYRLHQMLLLVREVKKSVNSDLSMDWLKPFMTKRKC
FT                   EAGDMLFYKDEKAETMLYIVSGRYRLVESGIELPVGAIVGELGMLSPSNERTQSLECIE
FT                   SGTVLSVSYRQVEELYVQNPEFGFYFLRLASARLFQNIGKLEERLADRTAPAAATPELA
FT                   "
FT   gene            714499..715371
FT                   /locus_tag="Nham_0653"
FT   CDS_pept        714499..715371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61541"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF6"
FT                   /protein_id="ABE61541.1"
FT                   /translation="MNPGVPKAAGALPAIRSIFAAVLGGDDNPMPALPAGLPDRVRPVA
FT                   AEAVNRLIDYQGPGYAQLYVARLRRFIGRRNVDDAIFADIARLMAVRMAYDDAVRMAQL
FT                   KLAEAAAGPDVAPDDVRKLRLDELVSSLPERVANPVLRALEYLGWLHLPVIVRFSAANG
FT                   FGRRRLRIEASLKRWRLSSLRYARERVWVERWLHMIDRSLTKQPAAVAAVVATAEMVQG
FT                   YGDGYTQSLRDWNLIVDHLVKPTFDGALSCPDLAGAITEARAAVNSDPRQESLKRVIAG
FT                   IRERAGAGA"
FT   gene            715576..715986
FT                   /locus_tag="Nham_0654"
FT   CDS_pept        715576..715986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61542"
FT                   /db_xref="GOA:Q1QQF5"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF5"
FT                   /protein_id="ABE61542.1"
FT                   /translation="MLLPSLSSSIAVGPLAGWMAVLTVKHVIADFVLQNSWMAIGKDQK
FT                   TGWALPLLAHCLVHLALALALILVIAPRFWFIAFIDFAIHIVVDRAKGFCASTFNVTQE
FT                   HQHPWFWTLIGVDQALHHLTGFGLSIVMAFNA"
FT   gene            716128..716526
FT                   /locus_tag="Nham_0655"
FT   CDS_pept        716128..716526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61543"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF4"
FT                   /protein_id="ABE61543.1"
FT                   /translation="MSSRDAFENDLCPVNDDLLGAMYRANEHGLPQLIASIAPDVRAML
FT                   AMFCYRRSHLHALALSVASSCSERDLVQLGGRVGSTLFALSREARLPHVASSSHGQRKP
FT                   ITLSTRPLTTFAPLDDQVDDDEAALVSA"
FT   gene            716744..717505
FT                   /locus_tag="Nham_0656"
FT   CDS_pept        716744..717505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0656"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61544"
FT                   /db_xref="GOA:Q1QQF3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF3"
FT                   /protein_id="ABE61544.1"
FT                   /translation="MQLEGQAAIVTGGASGLGAAAARKLAAQGVRVAVCDINTKLAEEL
FT                   AKEIGGTAVTCDVSDAASGEAAMVAAAKVHGPARVLVNCAGIGLARRVVGREGPHALAD
FT                   FNHVISVNLIGTFNMLRLAAAEMSTLEPLEGGERGVVINTASIAAYDGQVGQAAYSASK
FT                   GGIVGMTLPIARELAQFGIRVLTIAPGLFLTPLLGALPQAARDSLASTIPFPHRLGSPD
FT                   EYASLAMHMIDNPYLNGEVVRLDASLRMAPK"
FT   gene            complement(717590..718333)
FT                   /locus_tag="Nham_0657"
FT   CDS_pept        complement(717590..718333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61545"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF2"
FT                   /protein_id="ABE61545.1"
FT                   /translation="MFASMLKVSSGKLAFVLLQGALATSALAHDIHAKSDATVPPAFDV
FT                   TSASASTDGRLATFAMEVTGDAGSIKPEKVGKLAGAKVDAYVWPTKLDPAAVGFAKGSG
FT                   ILALAVTAHPDFDDTPLFDENGDGDPTNDGANWHSHWVVLASDKGCAGGLRVQDISPGQ
FT                   DLLPATAPGLPLALDSPGMSPIINGKTVRITVPVKGAENVNFDAVAAHLQVNETGKTPL
FT                   LCVTGTYKVASGNLTLPGTITREKK"
FT   sig_peptide     complement(718247..718333)
FT                   /locus_tag="Nham_0657"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            718425..719000
FT                   /locus_tag="Nham_0658"
FT   CDS_pept        718425..719000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0658"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61546"
FT                   /db_xref="GOA:Q1QQF1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF1"
FT                   /protein_id="ABE61546.1"
FT                   /translation="MSSAALETAYLIGRLDRLARSGVNVAGLNPAQWEALRYLSRANRF
FT                   SRTPAALADYAGSTRGTISQTLIALEQKGLASRQASRRDGRSVELALTRRGEAVLRNDP
FT                   LKRLAGDIAVATGGDPGALLATLQAILSATIARNDGRAFGICRTCRYFRCNAEPTSASP
FT                   HHCSLLDEPLSDADSGAICQEHDDEAAA"
FT   gene            complement(719163..720449)
FT                   /locus_tag="Nham_0659"
FT   CDS_pept        complement(719163..720449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0659"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61547"
FT                   /db_xref="GOA:Q1QQF0"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQF0"
FT                   /protein_id="ABE61547.1"
FT                   /translation="MTDHRKLLRSIFDAAVAAAHPDGILDAYLPRAPKGRVVCLAAGKS
FT                   AAAMAAAAERHYLDAAGLDPARLTGVAATRHGHGVPTRRIEVIEAGHPVPDEASLRGAD
FT                   LSLRLARTATADDLLLVLLSGGGSANWIAPADGVSFAQKQHVNRALLRSGAPIGEVNTV
FT                   RRHLSRIKGGRLARAGRRAAIVTLAISDVPRDEPAAIASGPTVPDPTTLADARALVAKY
FT                   NLALDDAVTRALNDPANESCKAGDAAFARARFEIVARPKTSLAATIRIARDAGYEVLDL
FT                   GADLEGEARDVAADHAKLALQARADGRTLAILSGGELTVTVRGNGRGGPNQEYALSLVS
FT                   QLKNTPGISALAADTDGADGGAGNASDPAGAVIDAATFAAMRAQKLDPAAYLANNDATA
FT                   FFAATGDLLLTGPTLTNVNDIRVILVDAV"
FT   gene            complement(720687..722759)
FT                   /locus_tag="Nham_0660"
FT   CDS_pept        complement(720687..722759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0660"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61548"
FT                   /db_xref="GOA:Q1QQE9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE9"
FT                   /protein_id="ABE61548.1"
FT                   /translation="MGDGGLNTSRGGHRGRETGIIDLGHEPPLSADGSEAAVIDRRRIS
FT                   VQWFSGTILTGLCGAALIGGAVFASLDGETTFARVPERVEGALRGSFGAGDHQITLHKS
FT                   DRLPPPSEAAAARQLIRVSTVTRAGNRDVMRVRPFVRVSGNLSMATSDLSAKIPPFNAQ
FT                   RLLTDVGSHAPTAAEDASDAAAAAAAEPDAEVSFVTRDLAPILPKAKIAATVPIDEVLM
FT                   RVRDASNWRGNGGVRYTMADATADAAGATSSIKMAYAAEGGIDPYAGFEARIVPENVTL
FT                   LPKTKEQLTGGNPVGERVHLVKKGDTVVSVLRDQGATPEEAKAIAATLGPRGRDGGLKE
FT                   GQKLRILMAPAAPGQRLQPYRVIVANDSTIEAVAALSDLGKYVAVDVASMNSAAEIADN
FT                   SDNDDDGSGVRLYQSIYETALRDKVPPAVIEDMVRIYSYDIDFQRKVQPGDSFDVFYAG
FT                   DDEGTPTTEKNEVLYASLTVGGETKKYYRFQTPDDAIVDYYDETGKSAKKFLVRKPVAS
FT                   AIMRSGFGIRRHPILGYVKMHTGVDWATPYGTPIFATGNGVVEKAEWEGGYGKYVRIKH
FT                   NNGYETAYGHMSAFAKGMAPGKRVRQGQVIGFVGSTGRSTGAHVHYEILVNGRFVDPMR
FT                   VRLPRGRSLDGPVLASFEKERDRLDAMMNSRNASARVSDAAGSLALPQARQVTNR"
FT   gene            723627..725115
FT                   /locus_tag="Nham_R0013"
FT   rRNA            723627..725115
FT                   /locus_tag="Nham_R0013"
FT                   /product="16S ribosomal RNA"
FT   gene            725322..725398
FT                   /locus_tag="Nham_R0014"
FT                   /note="tRNA-Ile1"
FT   tRNA            725322..725398
FT                   /locus_tag="Nham_R0014"
FT                   /product="tRNA-Ile"
FT   gene            725431..725506
FT                   /locus_tag="Nham_R0015"
FT                   /note="tRNA-Ala2"
FT   tRNA            725431..725506
FT                   /locus_tag="Nham_R0015"
FT                   /product="tRNA-Ala"
FT   gene            725920..728782
FT                   /locus_tag="Nham_R0016"
FT   rRNA            725920..728782
FT                   /locus_tag="Nham_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            728859..728973
FT                   /locus_tag="Nham_R0017"
FT   rRNA            728859..728973
FT                   /locus_tag="Nham_R0017"
FT                   /product="5S ribosomal RNA"
FT   gene            729220..729816
FT                   /locus_tag="Nham_0661"
FT   CDS_pept        729220..729816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE8"
FT                   /protein_id="ABE61549.1"
FT                   /translation="MRDVVRSAVIAIAVAGLTLSAAALSGGSAFAQAKPVSAAAEAVSP
FT                   ADAPVKQIALTEKQIEGVLAAQKHMDALDDKLPDSPNVKPDSRVATELEAISKKSGFAS
FT                   YAEYNTVMDNISLVLSGFDPATKKYIGAEAVLKQQIAAVQADTKMPGKEKKQALDDMNA
FT                   ALQAPAPAIENKGNIDLVAKYYDKLVGALSEGEDE"
FT   sig_peptide     729220..729315
FT                   /locus_tag="Nham_0661"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.677 at
FT                   residue 32"
FT   gene            730228..731748
FT                   /locus_tag="Nham_0662"
FT   CDS_pept        730228..731748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0662"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61550"
FT                   /db_xref="GOA:Q1QQE7"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE7"
FT                   /protein_id="ABE61550.1"
FT                   /translation="MAEDQAPPSGPDLAQGVDPGAFKDGKLVGHVGDREILLIRDGTEI
FT                   FAIDAHCSHYHGPLADGLVVDGAVRCPWHHACFDLRTGEAIRAPAFNALDVWEVEQRDG
FT                   LIFVRGQRERPAAKVAKPDHPENIVIVGGGAAGFAAAEMLRRQDYKGGIVILSSDDAAP
FT                   VDRPNLSKDYLAGSAPEDWLPLRPDDFYQQAGIDLRLRTTVTAIDPKARQLTTTGGGIG
FT                   YDRLLLATGAEPVRLPIPGANLPHVHTLRTLADCRAIIDAARTAQRAVVVGASFIGLEV
FT                   AASLRARGIEVHVVAPESRPMERILGAEMGDFVRALHEEHGVIFHLEDTVAAIGERKVT
FT                   LGSGGSLEADFVVFGVGVKPRLELAEKAGLTIDRGVLVNEFLETSVPGIYAAGDIVRWP
FT                   DPHAAENIRVEHWVVAQRQGQVAARNMLGHREKYDAVPFFWSQHYDVPINYVGHALKWD
FT                   QIEVEGSVADRDCLLRYKHQGRVLAVSSIYRDIDHLKAEVAMERAVAS"
FT   gene            731802..732356
FT                   /locus_tag="Nham_0663"
FT   CDS_pept        731802..732356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0663"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61551"
FT                   /db_xref="GOA:Q1QQE6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE6"
FT                   /protein_id="ABE61551.1"
FT                   /translation="MSEDVRDIKFALFDTAIGACGIVWTARGIKAVQLPLSDEDKTRTR
FT                   IRQRYGRLAEAIPPAGVQTAIDGMIALLEGKPKDLSDVVLDLDGVCEFDLGVYDIARTI
FT                   PPGRTMTYGDIARRLGGVELSRDIGQALGRNPCPIVVPCHRVLAAGDKPGGFSANGGVA
FT                   TKLKMLAIEGAAVNHTPSLFD"
FT   gene            732580..735114
FT                   /locus_tag="Nham_0664"
FT   CDS_pept        732580..735114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61552"
FT                   /db_xref="GOA:Q1QQE5"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE5"
FT                   /protein_id="ABE61552.1"
FT                   /translation="MSGATPDPSSQDRGRRAAAGPGLTQALRRARWAIAWERVWPHLAR
FT                   LLSVAGLFLAVSWAGLWLVLPAAGRAVALAAFVLLALAVLLPLVWFRWPSREEGLSRLD
FT                   RSAGTRHRPVTALADTLATRDPVALALWQAQRARTLASIRRIRAGLPSPRLVMHDRWAL
FT                   RALVMVLMVATFIAAGGERTERVAAAFDWNGVLASANVRVDAWVAPPPYTGKPPIILSA
FT                   TNKDAASSDTAALPVPAGSTLIVRSSGGRLDVAVGGGVTESASADKPPEGTNERHFTIA
FT                   TDGTARVRAPSGQPQWTFSAVPDRAPAISLAKHPERQARGSLQLSYRMEDDYGVTEAHA
FT                   VFSTRTESAAKDGATARPLFDAPQFALVLPNARTRNGVGQIVKDLSESPYAGADVTLTL
FT                   TARDDAGNEGRSEPFDMRLPERVFTKPLARALIEQRRILALDANQNAPVYTALDALLIA
FT                   PEVFTPKVGEYLGLHSVTRQLEEARTDAQLREVVASLWALAVSIEDGNITDVEKALRAA
FT                   QDALKDALERGASDEEIKKLTENLRAALDKYLQQLAEQMRNDPQQLARPLDRNTKVMRP
FT                   QDLDNMIERMERLSRSGDKDAARQLLDQLQQMLENLQMAQPGQSQDGDMQQSLNELGDM
FT                   IRKQQQLRDRTYKQGQDLPRDHDRERDGQKAMGDLQQDQQALHDRLRTLQQELAKRGMG
FT                   PSQRGRQGQEAGQEDGGDGLGQADSAMGEADGRLGEGNADDAVDAQGRALEALRKGARS
FT                   LAEAMQQSEGDGQAEDGPGSQAGRQNGGNQTDPLGRPLHGREFGNDSSVRIPGEIDVQR
FT                   VRRILEELRRRLADPSRPKVELDYIERLLKDY"
FT   gene            complement(735123..735506)
FT                   /locus_tag="Nham_0665"
FT   CDS_pept        complement(735123..735506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0665"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61553"
FT                   /db_xref="GOA:Q1QQE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE4"
FT                   /protein_id="ABE61553.1"
FT                   /translation="MARVLIADDEDSMRSLVARAVAMDGHETVTAADGAEALDILTGDA
FT                   RGFDLLLTDIKMPIMDGIALALAAARDFPDLVILLMTGFADQRERASGLNAIVHDVVTK
FT                   PFSVADIRAAVAGALRARQMDKR"
FT   gene            complement(735510..736364)
FT                   /locus_tag="Nham_0666"
FT   CDS_pept        complement(735510..736364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0666"
FT                   /product="Zinc finger/thioredoxin putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61554"
FT                   /db_xref="GOA:Q1QQE3"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE3"
FT                   /protein_id="ABE61554.1"
FT                   /translation="MHIVCPHCTTSYAVDSASFGEAGRTVRCARCKETWRAMPENIAVT
FT                   EVRVPSMAEAEADAAEWNYPPQTSDIPSIDSPPIASELPQSPELGGLQQDLSGTGTTPA
FT                   QQDNTPQDDKRPRSTATSRLGARLKPSFALRLPAVNLNTVCVAMAAVVLALIIWRAEIV
FT                   RLLPQTAIFYRLAGLEVNLRGLAFKDVKMSTETVDGKPVLVIEGMIVAQTRKPVELPRL
FT                   RFSVRDAHDTEIYAWNAVLEQPALKPGESAWFRTRLASPPPEGRSIDVRFFNRQDLAAG
FT                   GGA"
FT   gene            736545..737204
FT                   /locus_tag="Nham_0667"
FT   CDS_pept        736545..737204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0667"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61555"
FT                   /db_xref="GOA:Q1QQE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE2"
FT                   /protein_id="ABE61555.1"
FT                   /translation="MIRFENVGLRYGLGPEILRDLSFQIPAHSFQFLTGPSGAGKTSLL
FT                   RLLFLSLRPTRGLVNLFGQDVSLLDKDAIADLRQRIGIVLQDFRLLDHMTTYENVALPF
FT                   RVMGRDESTYRREVIDLLKWVGLGERMDALPPILSGGEKQRAAIARAVIARPQLLLADE
FT                   PTGNVDPTLGRRLLRLFIELNKTGTAVIIATHDITLMDQYDARRLVLHQGRLHIYE"
FT   gene            737197..738168
FT                   /locus_tag="Nham_0668"
FT   CDS_pept        737197..738168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0668"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61556"
FT                   /db_xref="GOA:Q1QQE1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE1"
FT                   /protein_id="ABE61556.1"
FT                   /translation="MSNAGDDHGVLMDLGRERPQVPARARNMSPIVPRASIAGRALVAV
FT                   VAIMTFLASITTGAVLLVSASAADWQSEVASEITIQVRPVAGRDIERDVTAVAGAMRAE
FT                   PGILDVRPYTREESAKLLEPWLGSGLSLDDLPVPRMIVARAAPGTRLDLEGLRSRVTQL
FT                   APSASVDDHRAWIDRMRSMTGATVFAGIGVLALVIIATIISVSFATRGAMAANRPIVEV
FT                   LHFVGASDRYIANRFLRHFLRLGLKGGVIGCVAAMLMFGFSESIASWFSGTPVGDQFAA
FT                   LLGTFSLRPSGYLVLAAQTVLIAAITAFASRRTLFATLDDID"
FT   gene            738264..738980
FT                   /locus_tag="Nham_0669"
FT   CDS_pept        738264..738980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0669"
FT                   /product="protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61557"
FT                   /db_xref="GOA:Q1QQE0"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQE0"
FT                   /protein_id="ABE61557.1"
FT                   /translation="MSEQARHDKPETSRRAPARRRATLLAAVVAAAGIGFVGAAVGFVG
FT                   FLSQLRGVETKPASNADGIVVLTGGSSRISDAVELLAGGYGKRLLISGVHPTNGVSDIS
FT                   RSLPDNQRLLTCCVDLDRSAVNTRSNASETRRWVDEQGFRSLIVVTSNYHMPRAIVELS
FT                   YAMPDITLIPFAVIGDKWREEPWWTSGATLRLLLSEYAKYLAAEVRVRLAYLGLELAPE
FT                   IGDQPTGSVEPRRPGS"
FT   sig_peptide     738264..738383
FT                   /locus_tag="Nham_0669"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.802 at
FT                   residue 40"
FT   gene            739006..739773
FT                   /locus_tag="Nham_0670"
FT   CDS_pept        739006..739773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0670"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61558"
FT                   /db_xref="GOA:Q1QQD9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD9"
FT                   /protein_id="ABE61558.1"
FT                   /translation="MTSIFLRSLVFNVLFYLTMAIWIVAALPTFVMPRAALVGVVKAWG
FT                   RWNIWLMRVICGTRVTILGTGRIPKGPVIIASKHQSMWETFALFSLIDQPIFILKRELT
FT                   WLPFFGWYLMKAGMIGIDRKAGMRSLKMLARMAQEQMHRGRQLVIFPEGTRRPVGAPPA
FT                   YKSGVALVYAECEVPCVPVALNSGLCWPRRTFLRYPGTITVEFLDPLPPGLRRAEFMSR
FT                   LTASIEGATGSLVEAGRREQARLFGRVPNAPAD"
FT   sig_peptide     739006..739122
FT                   /locus_tag="Nham_0670"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.731) with cleavage site probability 0.406 at
FT                   residue 39"
FT   gene            complement(739897..740481)
FT                   /locus_tag="Nham_0671"
FT   CDS_pept        complement(739897..740481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0671"
FT                   /product="ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61559"
FT                   /db_xref="GOA:Q1QQD8"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD8"
FT                   /protein_id="ABE61559.1"
FT                   /translation="MNAQRQFEPPSGPSDDDLWVFAYGSLMWRPGFDFAEQVPARLIGE
FT                   HRALCVYSFDHRGTPEKPGLVLGLDRGGACRGIAFRVAASRREATIAYLRGREQTTHVY
FT                   REVMRSVWLADDARRRVSALAYVVDRGHVQYAGRLTPAEQVRYVRQGHGRSGNNRDYVQ
FT                   STVKSIEAQGFRDAKLHQLAELLRDDTPMRD"
FT   gene            740662..741852
FT                   /locus_tag="Nham_0672"
FT   CDS_pept        740662..741852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61560"
FT                   /db_xref="GOA:Q1QQD7"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD7"
FT                   /protein_id="ABE61560.1"
FT                   /translation="MTATTVAPSKYRRWPIFVMPVLVVIAAAAWSAFWFYAASQVDQTV
FT                   DAWRAREAASGRIYDCAKRTLGGFPFRLEVHCEDATVELKSQTADQAAIAPLTARLGDI
FT                   LVIAQIYTPKLLIAEFKAPATLSQNGQPVMVVNWKTARSSIVGLPGTPQSADIVFDDLA
FT                   IDRIAAPAQTPVARASHVELHGRIAENSKPDYPTIETVLELTGASLRDVHPVLTKPFDA
FT                   VVRAMVHGLKDFTPKPWPERFREMQAAGGRVEIMQSRIQQGDLIAIAAGSLGLTANGRL
FT                   DGELHMTATGFEKVIPALGIEKMLEQGVPQDTLDKVAPGVKTQDIDNLFGALDRAIPGL
FT                   GKAVRENANVGVAAGLAAIGQEATLEGKKARSFPLRFVDGAVFVGSLKVAQTPPLF"
FT   sig_peptide     740662..740781
FT                   /locus_tag="Nham_0672"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.564 at
FT                   residue 40"
FT   gene            complement(742041..742982)
FT                   /locus_tag="Nham_0673"
FT   CDS_pept        complement(742041..742982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0673"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61561"
FT                   /db_xref="GOA:Q1QQD6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD6"
FT                   /protein_id="ABE61561.1"
FT                   /translation="MTAAPLFQRVALIGFGLIGGSIARAARAQGLAGEIVATAHSAKTR
FT                   ARVAELGIADRVVETNAEAADGADLVILSIPVGVCGAVAQEIASHLKPGAIISDVGSVK
FT                   GAVVRDMAPHLPAGVHFVPAHPVAGTEHSGPDSGFAELFINRWCILTPPEGTDPAAVDR
FT                   LRAFWTAIGARVETMTPEHHDLVLAITSHLPHLIAYTIVGTAEELGDVTSSEVMKFSAG
FT                   GFRDFTRIAASDPTMWRDVFLTNKDAVLEMLGTFNEDLSKLTRAMRRGDGEALFEHFTR
FT                   TRAIRRGIVEIGQNSAAPDFGRLQTSATKKNS"
FT   sig_peptide     complement(742896..742982)
FT                   /locus_tag="Nham_0673"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.849 at
FT                   residue 29"
FT   gene            complement(742979..744076)
FT                   /locus_tag="Nham_0674"
FT   CDS_pept        complement(742979..744076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0674"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61562"
FT                   /db_xref="GOA:Q1QQD5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQD5"
FT                   /protein_id="ABE61562.1"
FT                   /translation="MSRPVPNPGILDIAPYTPGKSPVPEAGRKVFKLSANETPFGPSPK
FT                   AMDAYRNAVAHLQDYPEGTSRVLREAIGRAYGLDPDRIICGAGSDEILNLLAHVYLSHG
FT                   DEAVSTTHSFLVYPIATTANGAENVVAPEVDYTADVDAILQRVTPKTKMVWLANPNNPT
FT                   GTYLPFDEIKRLHGGLPPHVLLVLDAAYSDYVSRNDYELGIELAATTGNTVLTHTFSKI
FT                   HGLAALRIGWMFGPAHVVDAVNRIRGPFNVSTPAMLAAAAAIGDTAHVQMSKVHTEKWR
FT                   NWLTDEVTKLGLKVTPSVTNFILIHFPTTKGKTASEADAFLTKRGLVLRALDNYGLPNA
FT                   LRMTIGTEEANRLVADGLRDFMAQK"
FT   gene            complement(744213..745106)
FT                   /locus_tag="Nham_0675"
FT   CDS_pept        complement(744213..745106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0675"
FT                   /product="Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61563"
FT                   /db_xref="GOA:Q1QQD4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD4"
FT                   /protein_id="ABE61563.1"
FT                   /translation="MRPVVELSAADELPMTKAPPAPPSLDELRKEIDAIDEQVHSLLMR
FT                   RGDIIDRLISVKQTQEIGSAFRPAREADMMRRLAQRHRGILPLDTVESIWRVIISTFTY
FT                   VQAPFSLHADLSLGESAMRDSARFHFGFTVPFVPHFNAQAAVEAVANSKGDLALVSATS
FT                   SRAPWWLALETEGAPKIIARLPFIERADHPATLPVFVVSRVADNARVTEVETWSVRVSG
FT                   WNADTARALSPLAEIVAVPDTAFDGAALLVSVTGGTSLDTIKSALFEAGASVRSTALVG
FT                   SHATRYTMPSSGASKS"
FT   gene            745394..746593
FT                   /locus_tag="Nham_0676"
FT   CDS_pept        745394..746593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0676"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61564"
FT                   /db_xref="GOA:Q1QQD3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1QQD3"
FT                   /protein_id="ABE61564.1"
FT                   /translation="MVNAQSVPTPAHAEYRAQEADHPTSQVAMFAGDQPLPLDCGIDLA
FT                   PFQIAYQTYGELNAGKSNAILVCHALTGDQHVANVHPVTGKPGWWVTLVGPGKPLDTDK
FT                   YFVICSNVIGGCMGSTGPASTNPATGTVWGLDFPVITIPDMVRAQAMLIDRLGIDTLFS
FT                   VVGGSMGGMQVLQWCVAYPQRVFSALPIACSTRHSAQNIAFHELGRQAVMADPDWRDGR
FT                   YVEQGTYPHRGLGVARMAAHITYLSDAALHRKFGRRMQDRDLPTFSFDADFQVESYLRH
FT                   QGSSFVERFDANSYLYLTRAMDYFDIAADHNGVLAAAFRDTRTRFCVVSFTSDWLFPTS
FT                   ESRATVHALNAGGARVSFAEIETDRGHDAFLLDLPEFFDIAHAFLVSAGKTRGLAAAGE
FT                   "
FT   gene            746595..747263
FT                   /locus_tag="Nham_0677"
FT   CDS_pept        746595..747263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0677"
FT                   /product="Methionine biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61565"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD2"
FT                   /protein_id="ABE61565.1"
FT                   /translation="MSVEQPTLPLNDVAPLTGGCYRGDHLLLAEMIAPNSKVLDVGCGD
FT                   GDLLQLLETRGIDGRGIELSREGVNHCVAKGLAVVQGDADTDLVNYPDDAFDYVILSQT
FT                   LQATRQPKAVLENLLRIGRRAIVSFPNFGYWKMRVQLLVGGHMPRTDNLPATWYDTPNI
FT                   HFCTIKDFVQLCGEINVKMERAVALDLYGRPLRFNAPWWFWNMFGEQGVFLLSRGEKNE
FT                   "
FT   gene            complement(747324..747944)
FT                   /pseudo
FT                   /locus_tag="Nham_0678"
FT   gene            748176..748778
FT                   /locus_tag="Nham_0679"
FT   CDS_pept        748176..748778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nham_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABE61566"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1QQD1"
FT                   /protein_id="ABE61566.1"
FT                   /translation="MFQLVAFRRLPRILALAVCSLAVVAFAAPASARPHHRAGHHAHVH
FT                   HHKHHHHVRRHHRYRHHQHRHRHTRVSRSRADETGFSDGGFVSNIVSEARRYIGGNPTG
FT                   RSRLWCARFMNMVLARSGHRGTGSDMASSFAHYGRRVSGPQVGAIAVMSRRGGGHVGVV
FT                   SGVDRRGNPIVVSGNHGRRVAESVYPRSRVYAYVVPN"
FT   sig_peptide     748176..748259
FT                   /locus_tag="Nham_0679"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.790 at
FT                   residue 28"
FT   gene            complement(748951..749829)
FT                   /locus_tag="Nham_0680"
FT   CDS_pept        complement(748951..749829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nham_0680"
FT                   /product="conserved hypothetical protein"
FT