(data stored in ACNUC7421 zone)

EMBL: CP000353

ID   CP000353; SV 2; circular; genomic DNA; STD; PRO; 2580084 BP.
XX
AC   CP000353; AAAI03000000-AAAI03000029;
XX
PR   Project:PRJNA250;
XX
DT   27-APR-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Cupriavidus metallidurans CH34 megaplasmid, complete sequence.
XX
KW   .
XX
OS   Cupriavidus metallidurans CH34
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Cupriavidus.
OG   megaplasmid
XX
RN   [1]
RP   1-2580084
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Martinez M.,
RA   Goltsman E., Pitluck S., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Mergeay M., Benotmane M.A., Vallaeys T., Michaux A.,
RA   Monchy S., Dunn J., McCorkle S., Taghavi S., van der Lelie D.,
RA   Richardson P.;
RT   "Complete sequence of the chromosome of Ralstonia metallidurans CH34";
RL   Unpublished.
XX
RN   [2]
RP   1-2580084
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Martinez M.,
RA   Goltsman E., Pitluck S., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Mergeay M., Benotmane M.A., Vallaeys T., Michaux A.,
RA   Monchy S., Dunn J., McCorkle S., Taghavi S., van der Lelie D.,
RA   Richardson P.;
RT   ;
RL   Submitted (18-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2580084
RA   Janssen P.J., Van Houdt R., Moors H., Monsieurs P., Morin N., Benotmane R.,
RA   Lapidus A., McCorkle S., Monchy S., Taghavi S., van der Lelie N., Dunn J.,
RA   Leys N., Mergeay M.;
RT   ;
RL   Submitted (04-FEB-2010) to the INSDC.
RL   Instute of Environment, Health and Safety, SCK-CEN, Boeretang 200, Mol
RL   2400, Belgium
XX
DR   MD5; 9b1c1ef2776a79c4fa01f3a8fa0ab8f4.
DR   BioSample; SAMN02598450.
DR   EnsemblGenomes-Gn; EBG00001134697.
DR   EnsemblGenomes-Gn; EBG00001134698.
DR   EnsemblGenomes-Gn; EBG00001134699.
DR   EnsemblGenomes-Gn; EBG00001134700.
DR   EnsemblGenomes-Gn; EBG00001134701.
DR   EnsemblGenomes-Gn; EBG00001134702.
DR   EnsemblGenomes-Gn; EBG00001134703.
DR   EnsemblGenomes-Gn; EBG00001134704.
DR   EnsemblGenomes-Gn; EBG00001134705.
DR   EnsemblGenomes-Gn; EBG00001134706.
DR   EnsemblGenomes-Gn; EBG00001134707.
DR   EnsemblGenomes-Gn; EBG00001134708.
DR   EnsemblGenomes-Gn; EBG00001134709.
DR   EnsemblGenomes-Gn; EBG00001134710.
DR   EnsemblGenomes-Gn; EBG00001134711.
DR   EnsemblGenomes-Gn; EBG00001134712.
DR   EnsemblGenomes-Gn; EBG00001134713.
DR   EnsemblGenomes-Gn; EBG00001134714.
DR   EnsemblGenomes-Gn; EBG00001134715.
DR   EnsemblGenomes-Gn; EBG00001134716.
DR   EnsemblGenomes-Gn; EBG00001134717.
DR   EnsemblGenomes-Gn; Rmet_3751.
DR   EnsemblGenomes-Gn; Rmet_3757.
DR   EnsemblGenomes-Gn; Rmet_3838.
DR   EnsemblGenomes-Gn; Rmet_3928.
DR   EnsemblGenomes-Gn; Rmet_3941.
DR   EnsemblGenomes-Gn; Rmet_3944.
DR   EnsemblGenomes-Gn; Rmet_4079.
DR   EnsemblGenomes-Gn; Rmet_4305.
DR   EnsemblGenomes-Gn; Rmet_4309.
DR   EnsemblGenomes-Gn; Rmet_4311.
DR   EnsemblGenomes-Gn; Rmet_4339.
DR   EnsemblGenomes-Gn; Rmet_4346.
DR   EnsemblGenomes-Gn; Rmet_4348.
DR   EnsemblGenomes-Gn; Rmet_4350.
DR   EnsemblGenomes-Gn; Rmet_4407.
DR   EnsemblGenomes-Gn; Rmet_4417.
DR   EnsemblGenomes-Gn; Rmet_4419.
DR   EnsemblGenomes-Gn; Rmet_4421.
DR   EnsemblGenomes-Gn; Rmet_4426.
DR   EnsemblGenomes-Gn; Rmet_4450.
DR   EnsemblGenomes-Gn; Rmet_4469.
DR   EnsemblGenomes-Gn; Rmet_4487.
DR   EnsemblGenomes-Gn; Rmet_4493.
DR   EnsemblGenomes-Gn; Rmet_4495.
DR   EnsemblGenomes-Gn; Rmet_4500.
DR   EnsemblGenomes-Gn; Rmet_4534.
DR   EnsemblGenomes-Gn; Rmet_4535.
DR   EnsemblGenomes-Gn; Rmet_4550.
DR   EnsemblGenomes-Gn; Rmet_4553.
DR   EnsemblGenomes-Gn; Rmet_4554.
DR   EnsemblGenomes-Gn; Rmet_4555.
DR   EnsemblGenomes-Gn; Rmet_4556.
DR   EnsemblGenomes-Gn; Rmet_4597.
DR   EnsemblGenomes-Gn; Rmet_4657.
DR   EnsemblGenomes-Gn; Rmet_4660.
DR   EnsemblGenomes-Gn; Rmet_4777.
DR   EnsemblGenomes-Gn; Rmet_4798.
DR   EnsemblGenomes-Gn; Rmet_4811.
DR   EnsemblGenomes-Gn; Rmet_4812.
DR   EnsemblGenomes-Gn; Rmet_4967.
DR   EnsemblGenomes-Gn; Rmet_5069.
DR   EnsemblGenomes-Gn; Rmet_5072.
DR   EnsemblGenomes-Gn; Rmet_5077.
DR   EnsemblGenomes-Gn; Rmet_5163.
DR   EnsemblGenomes-Gn; Rmet_5454.
DR   EnsemblGenomes-Gn; Rmet_5457.
DR   EnsemblGenomes-Gn; Rmet_5477.
DR   EnsemblGenomes-Gn; Rmet_5482.
DR   EnsemblGenomes-Gn; Rmet_5495.
DR   EnsemblGenomes-Gn; Rmet_5498.
DR   EnsemblGenomes-Gn; Rmet_5678.
DR   EnsemblGenomes-Gn; Rmet_5681.
DR   EnsemblGenomes-Gn; Rmet_5696.
DR   EnsemblGenomes-Gn; Rmet_5717.
DR   EnsemblGenomes-Gn; Rmet_5719.
DR   EnsemblGenomes-Gn; Rmet_5754.
DR   EnsemblGenomes-Gn; Rmet_5756.
DR   EnsemblGenomes-Gn; Rmet_6605.
DR   EnsemblGenomes-Gn; Rmet_6606.
DR   EnsemblGenomes-Gn; Rmet_6629.
DR   EnsemblGenomes-Gn; Rmet_6648.
DR   EnsemblGenomes-Gn; Rmet_6659.
DR   EnsemblGenomes-Gn; Rmet_6661.
DR   EnsemblGenomes-Gn; Rmet_6664.
DR   EnsemblGenomes-Gn; Rmet_6665.
DR   EnsemblGenomes-Gn; Rmet_6666.
DR   EnsemblGenomes-Gn; Rmet_6667.
DR   EnsemblGenomes-Gn; Rmet_6669.
DR   EnsemblGenomes-Gn; Rmet_6670.
DR   EnsemblGenomes-Gn; Rmet_6671.
DR   EnsemblGenomes-Gn; Rmet_6673.
DR   EnsemblGenomes-Gn; Rmet_6674.
DR   EnsemblGenomes-Gn; Rmet_6675.
DR   EnsemblGenomes-Gn; Rmet_6685.
DR   EnsemblGenomes-Gn; Rmet_6686.
DR   EnsemblGenomes-Gn; Rmet_6687.
DR   EnsemblGenomes-Gn; Rmet_6690.
DR   EnsemblGenomes-Gn; Rmet_6691.
DR   EnsemblGenomes-Gn; Rmet_6699.
DR   EnsemblGenomes-Gn; Rmet_6708.
DR   EnsemblGenomes-Gn; Rmet_6709.
DR   EnsemblGenomes-Gn; Rmet_6721.
DR   EnsemblGenomes-Gn; Rmet_6763.
DR   EnsemblGenomes-Gn; Rmet_6769.
DR   EnsemblGenomes-Gn; Rmet_R0070.
DR   EnsemblGenomes-Gn; Rmet_R0071.
DR   EnsemblGenomes-Gn; Rmet_R0072.
DR   EnsemblGenomes-Gn; Rmet_R0073.
DR   EnsemblGenomes-Gn; Rmet_R0074.
DR   EnsemblGenomes-Gn; Rmet_R0075.
DR   EnsemblGenomes-Gn; Rmet_R0076.
DR   EnsemblGenomes-Gn; Rmet_R0077.
DR   EnsemblGenomes-Gn; Rmet_R0078.
DR   EnsemblGenomes-Gn; Rmet_R0079.
DR   EnsemblGenomes-Gn; Rmet_R0080.
DR   EnsemblGenomes-Gn; Rmet_R0081.
DR   EnsemblGenomes-Gn; Rmet_R0082.
DR   EnsemblGenomes-Gn; Rmet_R0086.
DR   EnsemblGenomes-Tr; EBT00001725858.
DR   EnsemblGenomes-Tr; EBT00001725859.
DR   EnsemblGenomes-Tr; EBT00001725860.
DR   EnsemblGenomes-Tr; EBT00001725861.
DR   EnsemblGenomes-Tr; EBT00001725862.
DR   EnsemblGenomes-Tr; EBT00001725863.
DR   EnsemblGenomes-Tr; EBT00001725864.
DR   EnsemblGenomes-Tr; EBT00001725865.
DR   EnsemblGenomes-Tr; EBT00001725866.
DR   EnsemblGenomes-Tr; EBT00001725867.
DR   EnsemblGenomes-Tr; EBT00001725868.
DR   EnsemblGenomes-Tr; EBT00001725869.
DR   EnsemblGenomes-Tr; EBT00001725870.
DR   EnsemblGenomes-Tr; EBT00001725871.
DR   EnsemblGenomes-Tr; EBT00001725872.
DR   EnsemblGenomes-Tr; EBT00001725873.
DR   EnsemblGenomes-Tr; EBT00001725874.
DR   EnsemblGenomes-Tr; EBT00001725875.
DR   EnsemblGenomes-Tr; EBT00001725876.
DR   EnsemblGenomes-Tr; EBT00001725877.
DR   EnsemblGenomes-Tr; EBT00001725878.
DR   EnsemblGenomes-Tr; Rmet_3751.
DR   EnsemblGenomes-Tr; Rmet_3757.
DR   EnsemblGenomes-Tr; Rmet_3838.
DR   EnsemblGenomes-Tr; Rmet_3928.
DR   EnsemblGenomes-Tr; Rmet_3941.
DR   EnsemblGenomes-Tr; Rmet_3944.
DR   EnsemblGenomes-Tr; Rmet_4079.
DR   EnsemblGenomes-Tr; Rmet_4305.
DR   EnsemblGenomes-Tr; Rmet_4309.
DR   EnsemblGenomes-Tr; Rmet_4311.
DR   EnsemblGenomes-Tr; Rmet_4339.
DR   EnsemblGenomes-Tr; Rmet_4346.
DR   EnsemblGenomes-Tr; Rmet_4348.
DR   EnsemblGenomes-Tr; Rmet_4350.
DR   EnsemblGenomes-Tr; Rmet_4407.
DR   EnsemblGenomes-Tr; Rmet_4417.
DR   EnsemblGenomes-Tr; Rmet_4419.
DR   EnsemblGenomes-Tr; Rmet_4421.
DR   EnsemblGenomes-Tr; Rmet_4426.
DR   EnsemblGenomes-Tr; Rmet_4450.
DR   EnsemblGenomes-Tr; Rmet_4469.
DR   EnsemblGenomes-Tr; Rmet_4487.
DR   EnsemblGenomes-Tr; Rmet_4493.
DR   EnsemblGenomes-Tr; Rmet_4495.
DR   EnsemblGenomes-Tr; Rmet_4500.
DR   EnsemblGenomes-Tr; Rmet_4534.
DR   EnsemblGenomes-Tr; Rmet_4535.
DR   EnsemblGenomes-Tr; Rmet_4550.
DR   EnsemblGenomes-Tr; Rmet_4553.
DR   EnsemblGenomes-Tr; Rmet_4554.
DR   EnsemblGenomes-Tr; Rmet_4555.
DR   EnsemblGenomes-Tr; Rmet_4556.
DR   EnsemblGenomes-Tr; Rmet_4597.
DR   EnsemblGenomes-Tr; Rmet_4657.
DR   EnsemblGenomes-Tr; Rmet_4660.
DR   EnsemblGenomes-Tr; Rmet_4777.
DR   EnsemblGenomes-Tr; Rmet_4798.
DR   EnsemblGenomes-Tr; Rmet_4811.
DR   EnsemblGenomes-Tr; Rmet_4812.
DR   EnsemblGenomes-Tr; Rmet_4967.
DR   EnsemblGenomes-Tr; Rmet_5069.
DR   EnsemblGenomes-Tr; Rmet_5072.
DR   EnsemblGenomes-Tr; Rmet_5077.
DR   EnsemblGenomes-Tr; Rmet_5163.
DR   EnsemblGenomes-Tr; Rmet_5454.
DR   EnsemblGenomes-Tr; Rmet_5457.
DR   EnsemblGenomes-Tr; Rmet_5477.
DR   EnsemblGenomes-Tr; Rmet_5482.
DR   EnsemblGenomes-Tr; Rmet_5495.
DR   EnsemblGenomes-Tr; Rmet_5498.
DR   EnsemblGenomes-Tr; Rmet_5678.
DR   EnsemblGenomes-Tr; Rmet_5681.
DR   EnsemblGenomes-Tr; Rmet_5696.
DR   EnsemblGenomes-Tr; Rmet_5717.
DR   EnsemblGenomes-Tr; Rmet_5719.
DR   EnsemblGenomes-Tr; Rmet_5754.
DR   EnsemblGenomes-Tr; Rmet_5756.
DR   EnsemblGenomes-Tr; Rmet_6605.
DR   EnsemblGenomes-Tr; Rmet_6606.
DR   EnsemblGenomes-Tr; Rmet_6629.
DR   EnsemblGenomes-Tr; Rmet_6648.
DR   EnsemblGenomes-Tr; Rmet_6659.
DR   EnsemblGenomes-Tr; Rmet_6661.
DR   EnsemblGenomes-Tr; Rmet_6664.
DR   EnsemblGenomes-Tr; Rmet_6665.
DR   EnsemblGenomes-Tr; Rmet_6666.
DR   EnsemblGenomes-Tr; Rmet_6667.
DR   EnsemblGenomes-Tr; Rmet_6669.
DR   EnsemblGenomes-Tr; Rmet_6670.
DR   EnsemblGenomes-Tr; Rmet_6671.
DR   EnsemblGenomes-Tr; Rmet_6673.
DR   EnsemblGenomes-Tr; Rmet_6674.
DR   EnsemblGenomes-Tr; Rmet_6675.
DR   EnsemblGenomes-Tr; Rmet_6685.
DR   EnsemblGenomes-Tr; Rmet_6686.
DR   EnsemblGenomes-Tr; Rmet_6687.
DR   EnsemblGenomes-Tr; Rmet_6690.
DR   EnsemblGenomes-Tr; Rmet_6691.
DR   EnsemblGenomes-Tr; Rmet_6699.
DR   EnsemblGenomes-Tr; Rmet_6708.
DR   EnsemblGenomes-Tr; Rmet_6709.
DR   EnsemblGenomes-Tr; Rmet_6721.
DR   EnsemblGenomes-Tr; Rmet_6763.
DR   EnsemblGenomes-Tr; Rmet_6769.
DR   EnsemblGenomes-Tr; Rmet_R0070-1.
DR   EnsemblGenomes-Tr; Rmet_R0071-1.
DR   EnsemblGenomes-Tr; Rmet_R0072-1.
DR   EnsemblGenomes-Tr; Rmet_R0073-1.
DR   EnsemblGenomes-Tr; Rmet_R0074-1.
DR   EnsemblGenomes-Tr; Rmet_R0075-1.
DR   EnsemblGenomes-Tr; Rmet_R0076-1.
DR   EnsemblGenomes-Tr; Rmet_R0077-1.
DR   EnsemblGenomes-Tr; Rmet_R0078-1.
DR   EnsemblGenomes-Tr; Rmet_R0079-1.
DR   EnsemblGenomes-Tr; Rmet_R0080-1.
DR   EnsemblGenomes-Tr; Rmet_R0081-1.
DR   EnsemblGenomes-Tr; Rmet_R0082-1.
DR   EnsemblGenomes-Tr; Rmet_R0086-1.
DR   EuropePMC; PMC2670826; 19338657.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000353.
DR   SILVA-SSU; CP000353.
DR   StrainInfo; 124760; 1.
XX
CC   On Feb 4, 2010 this sequence version replaced gi:93356399.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351356
CC   Source DNA and bacteria available from John J. Dunn (jdunn@bnl.gov)
CC   Contacts: John J. Dunn (jdunn@bnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2580084
FT                   /organism="Cupriavidus metallidurans CH34"
FT                   /plasmid="megaplasmid"
FT                   /strain="CH34"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266264"
FT   gene            834..929
FT                   /pseudo
FT                   /locus_tag="Rmet_6605"
FT   CDS_pept        834..929
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6605"
FT                   /note="hypothetical protein"
FT   gene            946..2040
FT                   /gene="repA"
FT                   /locus_tag="Rmet_5817"
FT   CDS_pept        946..2040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="Rmet_5817"
FT                   /product="replicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5817"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12676"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LB00"
FT                   /protein_id="ABF12676.1"
FT                   /translation="MPIKRSMAIDEDRSVLVGDNEPSRIIVPGNENGLVPSEKFQRLFD
FT                   EAQAMEREDAWQSGEVGFLSRASVQVTLPYRAPKGAPPVWTRTSGNISLMIQPGYFTQQ
FT                   RSERATNGRQKLVSETVSLGYPYGSYPRLMLAWIGKEIMAKKKRGEFTGTVEDRRISLG
FT                   NSLSEFMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSVPVPNQAPNHEPLS
FT                   IDRVGYLLADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALKALKQS
FT                   PFALDVYSWLTYRFFTIQRRTEIPWEALQMQFGTETESERKFRALFRKALKDVLVVYPG
FT                   AKVDADSSKALILQPSRTSVRKLS"
FT   gene            complement(2143..2346)
FT                   /gene="csp"
FT                   /locus_tag="Rmet_5818"
FT   CDS_pept        complement(2143..2346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csp"
FT                   /locus_tag="Rmet_5818"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5818"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12677"
FT                   /db_xref="GOA:Q1LAZ9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ9"
FT                   /protein_id="ABF12677.1"
FT                   /translation="MATGTVKWFNETKGFGFITPDDGGADLFAHFSEIQGSGFKTLKDG
FT                   QRVTFEVKQGPKGLQASAIKPA"
FT   gene            2768..3424
FT                   /gene="parA"
FT                   /locus_tag="Rmet_5819"
FT   CDS_pept        2768..3424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="Rmet_5819"
FT                   /product="ATPase involved in plasmid partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5819"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12678"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ8"
FT                   /protein_id="ABF12678.1"
FT                   /translation="MAAKIITVFNQKGGCGKTTVSMHIAGTLGLRGARSLLVDMDEQGT
FT                   ATRWAAQASDERPFPASVIGLAPSGGAMHREVRKFVNDYDYILVDCPPAVHSAAPSSAL
FT                   LISDLAIIPVVPSPPDLWAAVAAKTLAQHAQVQNETLQIRVMANMVQRRVSIARQAIEI
FT                   LGDDGDVPLLNAMVGSRSAFRECQAIGCTVHGVPGAREAVQEVDMMVDEILSLIE"
FT   gene            3430..4446
FT                   /gene="parB"
FT                   /locus_tag="Rmet_5820"
FT   CDS_pept        3430..4446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="Rmet_5820"
FT                   /product="plasmid partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5820"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12679"
FT                   /db_xref="GOA:Q1LAZ7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ7"
FT                   /protein_id="ABF12679.1"
FT                   /translation="MATKLKSLKAGMLAGMAAEKTRSDAIDRFARAEAAISQHPNGLLQ
FT                   SARAIPPQSTFSAESDESVIEGRTLIKIPIAQLHDNPFNARRIYDPAVVQERAASIATH
FT                   GQKTPGLAASDPTRPGHYILIDGHYRKRALASAGKLEMECFIETDLSDLDFYRLSFLLN
FT                   EQRSDQSALDNAIAWRQLLDEGKVQKEDEICELTGMSAGTVNKTLALLKLPESVLAVMR
FT                   ERPSAIGIATGYELTLYCKVAGEDRTRDLATRIMNDGMSSREVEAIRKQAQEGKSRKVK
FT                   EISRQYKIRTESGQLLGTIKEWDSGRVMLDVQLTDRSAREDLLDVLKARFGLDKTLI"
FT   gene            complement(4514..6094)
FT                   /gene="xerD"
FT                   /locus_tag="Rmet_5821"
FT   CDS_pept        complement(4514..6094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="Rmet_5821"
FT                   /product="tyrosine-based site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5821"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12680"
FT                   /db_xref="GOA:Q1LAZ6"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ6"
FT                   /protein_id="ABF12680.1"
FT                   /translation="MPDDRDTLAATKLTRTEFAVVRAYAQGMKPLEIANRYLQDPDDDD
FT                   DLTEHQAIQRILALRDRLVQFALQHDRPDIAEMFEALRGRSDAGMTRRVDALTSIEQLG
FT                   QGRPLPGHQVSLWFGPSLSRRLMAAGIRTIADMTDLANRKGSGWWRHVPRIGRHSAEII
FT                   VRWLATQSAQTALKVSPHVLASAQIVDRKALYARPLGRGMAFPVPLELMRAPETFAPWA
FT                   MALGEELKDVQGWVAARASSPNTWKSYRREAERFLLWAAGQGKSLRAMAADDLDAYRAF
FT                   LANPEPSSFWCGPAGPRDKAHWRPFEGPLRTSSCEAAMRVISALLRALRKGDPARLARS
FT                   GVVDDGTATVQASSKPATLPRETIESFLAWLSASPSSPRQRAALAAALLLARHGIRIVE
FT                   LASFRLVHFSYSPSAAPPTGRLLLEAKSTARRGEIVLDQDAWSALSAHWTDRQLAWDTL
FT                   SEGWDPDAALLAPIEYPSTARGRAKQSIATAGYSASGLEQLLRASWRRFAETHDVDVEA
FT                   FTPRQLRLG"
FT   gene            7265..10009
FT                   /locus_tag="Rmet_5822"
FT   CDS_pept        7265..10009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5822"
FT                   /product="Transcriptional regulator, LuxR family,
FT                   ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5822"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12681"
FT                   /db_xref="GOA:Q1LAZ5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ5"
FT                   /protein_id="ABF12681.1"
FT                   /translation="MSAATSRKPGDSDTQRRGLVASKLVPPRALPNHLVRSRLVDVMVD
FT                   AASARLILVRAAAGFGKTTLMQQYLERCQAGQRACVWLRCDAADNDLQRFLLHLHTGLL
FT                   RLPGLTRHQRDERSDTIAGETIAHEIIEIAASYAHPFAILLDDLEVIQNDAITEYLQQL
FT                   VRVLSPQGVLVIGTRATPDLGLGGLRARGQLLDINPAALRFSAEEAASFIRDKCGLPLP
FT                   DGEIATLWRCTEGWAAAVYLATLSLRGHPNHAAFVRSFSGTNIELAEYLAEDILMGQSE
FT                   SCRDFLLQTSLLGQLSAPLCDAVTGRHDSREMLSFLERNNLFITPLDGEHQWYRYHSLF
FT                   ASFLQHRLQVTYPDKARALHVAASRWYLSEDRPVPAIEHLLQAGLDDEALPLIAIHTPA
FT                   LFQAGRVRLLARWLDRIDRKRLLADPHRMGLAYAWVLLLNRRYSEAMQTMAALLAADVP
FT                   ADQQAKIAFEVETLRCVLLAMTDQIEACLAAGLAHLERIPPDAPFRYASVVNSQAFSLV
FT                   ASHRYEDARRVLSRLMPGANDVRTGFQRGIADSLEGVIDLVQGRLSNALARFRAVAERG
FT                   WSPSEVSSLRHAFLPAWATALYEANALEDCARVLAEAMPYCKGYAPPDAMIAGFILSAR
FT                   LALLGGDRDRWLRMLAELEEIGRGIQLPRAICSAWLERVRVATIEGRLDAADQALRSAE
FT                   LHADWAASDSYGHANDIDFPDSIGWRLAIAHGEHEQTASELADAIAVATQRQRHWRALK
FT                   LRLLLAMALDGAGRQSEAFEPLTEAMRLASHEGLVRTFVDEGDRLADLLRRWADAREAE
FT                   IVRAGIDLQFVRTVLAQIPTPLAVAGEEVNKARGAAIAEPLTTREQEVLQMLAAGHRNR
FT                   VIAEKMFVSELTIKSHLRKINAKLGAQSRTEAVAIGRSLGLLR"
FT   gene            complement(10072..10959)
FT                   /gene="tauD"
FT                   /locus_tag="Rmet_5823"
FT   CDS_pept        complement(10072..10959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="Rmet_5823"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5823"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12682"
FT                   /db_xref="GOA:Q1LAZ4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ4"
FT                   /protein_id="ABF12682.1"
FT                   /translation="MNAREQTAAEQIAAPFSITPVTPVIGAEIGDIDLRETLDDPTYQA
FT                   LRQALVRHKVLFFRDQDITPAQHVALARRFGELEVHPVFPHHPDHPELVLLGGNKDTKG
FT                   RENIYHSDVSWRAVPSMGSMLRCVECPPMGGDTIWVNMAQAYAGLPDDVKARIEGLEAV
FT                   HDLMPGFGARMSAEERLVNREKFPPATHPVVRTHPESGEKILYVNEGFVTHLANYGAHI
FT                   QYRVGADFRLGELDLLQYLYRQATVPEYQVRMKWRPNTIAFWDNRSTQHYAVQDYFPAV
FT                   RRMMRATIIGERPV"
FT   gene            complement(11005..11997)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5824"
FT   CDS_pept        complement(11005..11997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5824"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5824"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12683"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ3"
FT                   /protein_id="ABF12683.1"
FT                   /translation="MDNARRRALRRLGWGMAGVAGMQIALPSRATPTYPSRAVRLIMPY
FT                   AAGGTGDVVARLIAEGLAKTWQRPVVVDNKPGAGGMIGADLVAKSEPDGYTLLMALTGL
FT                   VQAPSLYGKAAYNPVRDFAPISELATSHLALVVQQDFPARTAKEFAEHVARQGQPLPYG
FT                   TYGLGSSGHLQMEIFARATGISLVHVPYKGEGPLVNDLLGRQIPAGVVGAVTARQYAQA
FT                   GKLRPLAVAGGSRSPLLPDVPTFRESGYAGLERQGWIGLFAPANTPRDVVDKISRDVNR
FT                   VIVSDALRARLVDMGIIVKGSTPSAFADVVKAEQEYWADAIRAANIRLE"
FT   gene            complement(12014..12910)
FT                   /locus_tag="Rmet_5825"
FT   CDS_pept        complement(12014..12910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5825"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5825"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12684"
FT                   /db_xref="GOA:Q1LAZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ2"
FT                   /protein_id="ABF12684.1"
FT                   /translation="MKARRVSTHSTENKTTRTKETRSMSKLTNKVAIVSGSGRGIGREI
FT                   ALKLASEGAAVVVNDLDAEPAEAVVREITTMGGRAVACVGSVTEADFGTRFVGTALQTF
FT                   GGLDIIVNNAGYTWDNVIQKMTDDQWSAIMDVHVTAPFRILRAAADYFRETSKQEAEQG
FT                   REVFRKVVNISSASGVIGNAGQANYSAGKAAINGLTKALAKEWGRYKVNVNSVAFGLIK
FT                   TRLTEAVAGEGHATIDIAGNEIKVGVNPQLMKNIEATIPLGRGGTPAEAAGSVYLLCIP
FT                   ESNYITGQVLVVGGGRP"
FT   gene            complement(12907..14091)
FT                   /locus_tag="Rmet_5826"
FT   CDS_pept        complement(12907..14091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5826"
FT                   /product="Acetyl-CoA C-acyltransferase (Propanoyl-CoA
FT                   C-acyltransferase)"
FT                   /EC_number="2.3.1.176"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5826"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12685"
FT                   /db_xref="GOA:Q1LAZ1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ1"
FT                   /protein_id="ABF12685.1"
FT                   /translation="MTNKVVVAGVGMIPFTKPGASDDYGVMGARAAKAALADAGIDYAL
FT                   VQQAYVGYVFGDSTSGQTAIYGVGLTGIPVINVNNNCATGSTALYLARQAVESGAVECA
FT                   IALGFEQMVPGALKGAYTDRPGPMERFARVMNDVQGFDEQAPRAAQFFGGAGRAYMKEF
FT                   GIRPETFARISVKARQHAARNPFAVFRNTVTLEDVMTSPKVFDPLTRLQCCPPTCGAAA
FT                   AILCTEAFARKHGLDTRVAIAAQAMTTDRNSTFDEGDMRKVVGYDMTHAAATQVYERAG
FT                   IGPGDVDVVELHDCFTANELITYEGLGLTPEGTAEKFILDGDNTYGGRVVTNPSGGLLS
FT                   KGHPLGATGLAQCAELVWQLRGEAGDRQVAGARLALQHNLGLGGACVVTLYQRQ"
FT   gene            complement(14159..15715)
FT                   /locus_tag="Rmet_5827"
FT   CDS_pept        complement(14159..15715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5827"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5827"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12686"
FT                   /db_xref="GOA:Q1LAZ0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAZ0"
FT                   /protein_id="ABF12686.1"
FT                   /translation="MYLTQGLHRRVQQTPDHVATIFRSRRRTYREFSERVSRLAGALQQ
FT                   LGMNPGDRVSMLSLNSDRYLEYAMSVWWGGGVLNPVNTRWSVPEIVYSLDDCDTGILIV
FT                   DDHFLAMAEPIRATAKRAPILIHAGDGAPPAGMLGFEALLADASPVPDAMRGGEDLASI
FT                   MYTGGTTGKPKGVMQSHLNLWSSSISRLAQFPLDEATITLHAAPLFHTAAMAKAVGVFV
FT                   IGGTHTMVPTFDPAEVLETLERERVNDIMLVPTMLQAILACPDFARRDVSSLKRINYGA
FT                   SPINGAVLDAALAAMPNVEFSHAYGLTEASPVVSVNPPANHGPVGRASGLYRSAGRPGF
FT                   GVFVKVVDPNGDEVPRNTIGEIIVRGPNIMQGYWNKPEETRQALRNGWLHTGDGAYMDD
FT                   AGYLFIVDRIKDMIVTGGENVYSAEVENALAQHPAVHSCAVIGVPHERWGEAVHAVVVL
FT                   RPGLQAGEDELRTHCRALIASYKCPKSVEFRTELPLSAAGKILKRDLRTRYWQDQPRQV
FT                   S"
FT   gene            16129..16806
FT                   /gene="ycaC"
FT                   /locus_tag="Rmet_5828"
FT   CDS_pept        16129..16806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaC"
FT                   /locus_tag="Rmet_5828"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5828"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12687"
FT                   /db_xref="GOA:Q1LAY9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY9"
FT                   /protein_id="ABF12687.1"
FT                   /translation="MTQPANFNGARPVIDPADTAMLLIDHQSGLFQTVGDMPMPELRQR
FT                   AAALAKMATLSKLPVITTASVPQGPNGPLIPEIHENAPHAKYVARKGEINAWDNPEFVA
FT                   AVKATGKKTLIIAGTITSVCMAFPSISAVADGYKVFAVVDASGTYSKMAQEITLARVVQ
FT                   AGVVPMDTAAVASELQRTWNRDDAQQWAEIYTKIFPAYQLLIESYLKAQDVQKNGEALD
FT                   SSR"
FT   gene            complement(16992..17993)
FT                   /gene="pstS1"
FT                   /locus_tag="Rmet_5829"
FT   CDS_pept        complement(16992..17993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS1"
FT                   /locus_tag="Rmet_5829"
FT                   /product="phosphate transporter subunit;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5829"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12688"
FT                   /db_xref="GOA:Q1LAY8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY8"
FT                   /protein_id="ABF12688.1"
FT                   /translation="MGRHIAALALLFAAVSAFAGDVTGAGSTFVYPLMAKWAATYYART
FT                   GRQIDYQPIGSGNGIRQIKAASITFGTTDMPLKPEELERAGLAQFPIAVGGVVPVINLQ
FT                   GIGAGQIHMTGALLADIYRGKIANWNDAAIASANPGVQFPDLKITVVHRSDGSGTTFNW
FT                   TDYLSKVSPEWKAAVGAGTTVRWPIGMNASGNEGVSLYIHNIRGAIGYVELTYALQKSL
FT                   PYALVQNRDGLYVKPSRESFSAAVTAVEWNPRLDFYQVLTNAPGPNAWPITGTVFVLMQ
FT                   RSAAHPSNTKDALAFFQWALAEGQSDASAEHYVALPPELVKQVIAYWAETFK"
FT   gene            complement(18170..19339)
FT                   /locus_tag="Rmet_5830"
FT   CDS_pept        complement(18170..19339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5830"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12689"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY7"
FT                   /protein_id="ABF12689.1"
FT                   /translation="MVRRSGFLRRRTQGAIAGSVATICAHSNGRVNLRCAAHKSPPATT
FT                   ASDAAVTPGFKPEAHNGGLDSRTRFARHALRCSDSITTGGPLAATENTGSQSQPQSQSP
FT                   ADLTALPDNPDLVPGMPYRHYKGGAYLVTGVGRFEADMTPVVVYESMRDRSLLWVRHAD
FT                   VFTEPVSTATGDVARFAPHWAPALSCLDFLPRKTVLQVLALYDAPYRKYHDRRHVLEMF
FT                   EQAHALGIALNPAQALAVLFHDAVYVPGFEHNEAASAALLDTMVEDVNADVIHLARQII
FT                   LDTRTHEASVPDAATVLDLDLLRLAADDDVFDAHGLAVFDENRGLLASRVQLSGEALYH
FT                   AFMVRRAAFLGALAQRPKLFLTTAFAEFEGPARRNIARVLASFGQAKAN"
FT   gene            19628..20458
FT                   /locus_tag="Rmet_5831"
FT   CDS_pept        19628..20458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5831"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5831"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12690"
FT                   /db_xref="GOA:Q1LAY6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY6"
FT                   /protein_id="ABF12690.1"
FT                   /translation="MATILLFEPHPLLRLGLHHLLSQAHVPGDLVDLDPTTLHAPEPWV
FT                   HHADLLIIGMPADSGAGWPILAELCLRLQPLRVLVLADHLPAPMPEGGLPEKVRGLLAK
FT                   TCSSEALEAAIRLVLAGGECFPSHAPANRVHEPLADAVPAELSRLVATPVVVPLHGADA
FT                   AAPAHADTHAVPTETPAVGAHLLNITERQYEVLALLARGYPIKTVSRLLNISVATAKTH
FT                   ACTLYQRLHVRNKGEAVYVALQRGASLNWPGPTPARPTHIPMSSLSAQHACEAA"
FT   gene            20613..21206
FT                   /locus_tag="Rmet_5832"
FT   CDS_pept        20613..21206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5832"
FT                   /product="conserved hypothetical protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5832"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY5"
FT                   /protein_id="ABF12691.1"
FT                   /translation="MLRDDADEMLISTSMTTYLIARNEMMCRILARRMELQDVPQPVRW
FT                   HCPEWLPNGATARVSQHTIDNPDEAEPLPPGGVDLVVVDCSAEDDPHELLDRVHAQLAP
FT                   RRWLVLSDALDAALIGHAAKLGAGGCQAVPAPVDLVCAAAALVWAGGQCFPREALAMSH
FT                   VRPVPPPATLADISSTPVLPPHTRVYPEGSPAIG"
FT   gene            21302..21580
FT                   /locus_tag="Rmet_5833"
FT   CDS_pept        21302..21580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5833"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5833"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY4"
FT                   /protein_id="ABF12692.1"
FT                   /translation="MDRSLDILAVHGFAVREGRGKWACCYEIRLAIVGGPLLYRGELHG
FT                   RNFATEEAAIIAAVEIGEREAGRHIDAARAMIVALARITDGAHHEMS"
FT   gene            21863..21937
FT                   /pseudo
FT                   /locus_tag="Rmet_6606"
FT   CDS_pept        21863..21937
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6606"
FT                   /note="aminopeptidase P (fragment)"
FT   gene            21934..22614
FT                   /locus_tag="Rmet_5834"
FT   CDS_pept        21934..22614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5834"
FT                   /product="Putative phosphatase, conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5834"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12693"
FT                   /db_xref="GOA:Q1LAY3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY3"
FT                   /protein_id="ABF12693.1"
FT                   /translation="MSRWQLVSFFGESAFLLPCAVFLYAWLRWHGANAVARHWLIAFSL
FT                   TACLVLVSKLAFMGWGIGSAALNFTGFSGHAMMAASILPVFACLAVPSRYRTLSLLAAV
FT                   AGVLLALAVGMSRLALHAHSMSEVVSGLALGFCVSLPFIMRHEVPHGPVAMLLASGVLA
FT                   TVLVLPVSGVAGVTHIWVQGIATFLSGRDRPYERGEWAWQADCRVCQINVAARPDCATR
FT                   RCAC"
FT   gene            22530..22805
FT                   /locus_tag="Rmet_6607"
FT   CDS_pept        22530..22805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6607"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45206"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY36"
FT                   /protein_id="ADC45206.1"
FT                   /translation="MGLASGLPRLPDQRRRTAGLRDPALRLLTPSRSQALEGFVRLPTD
FT                   DAPYVRNHDCTWFPARALGRSWRRNGMLPPSGTLHFTISIDSVMRY"
FT   gene            22727..24133
FT                   /locus_tag="Rmet_5835"
FT   CDS_pept        22727..24133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5835"
FT                   /product="UDP-sugar lipid carrier transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5835"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12694"
FT                   /db_xref="GOA:Q1LAY2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY2"
FT                   /protein_id="ABF12694.1"
FT                   /translation="MASEWNVAAERHSALHYLYRLGDAVLIAVCGIAMGALYFHDGIRS
FT                   AAPVNGFLTMLCALGALLIFPAFGIYESWRGRSRAVLGLRIAAAWTLVFISGLLGAFLI
FT                   HQIGAVSRVWSMGWFIGTGVMLALSRVVMFRMLANVRQQGINAKRVLIFGYGPLGREMY
FT                   DRVQHFRDAGYRVVGVYDEESDAIPYDVTPLRQIEEVSGFVRDHGVREIWLTLPMAACR
FT                   DLSGVVRQFRNEMIDIRWVPDVSSVELLGHRFSEFMGLPVIDLNSPPVSGITGVVKASF
FT                   DRVFSLGVLVCLSPLLLLIAAMVKLSSPGPVLFRQQRLGIDGQPFNVYKFRTMRQHQDG
FT                   GGVTQAVRGDPRVTRVGAFLRRTSLDELPQFINVLRGEMSVVGPRPHAMEHNELYKELI
FT                   DRYMLRHRVKPGITGWAQINGLRGQTDTVEKMRKRIEFDIYYIQHWSFQLDLRIILRTA
FT                   LHGWTGTTAY"
FT   gene            24259..24510
FT                   /locus_tag="Rmet_5836"
FT   CDS_pept        24259..24510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5836"
FT                   /product="Acyl carrier protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5836"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12695"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY1"
FT                   /protein_id="ABF12695.1"
FT                   /translation="MKATIRNILGEVARLDVPLATLADNDDLYAAGLSSLATVHVMLAL
FT                   ENAFDIEIPDQMLTRQLFRSVDSLAAAVEAIRQQQEAA"
FT   gene            24507..25709
FT                   /locus_tag="Rmet_5837"
FT   CDS_pept        24507..25709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5837"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5837"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12696"
FT                   /db_xref="GOA:Q1LAY0"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAY0"
FT                   /protein_id="ABF12696.1"
FT                   /translation="MNTGAKVTLAHANPDAGGAMASDALLAAAREAAMVAQRFADAVDQ
FT                   EARFPHEAFEVLRDQGLLGAMVPAVLGGSGASLATVAAICKVLGETCASTGMIYAMHQI
FT                   QVACLLDHGTGSPWHQHLLARIASEQLLLASATSEEAIGGALRSSGCAVNVDGDRFHLL
FT                   KMAPTISYGAHADGILITARRNADASPSDQVLVCALKSDYTLQGLNAWDTLGMRGTCSN
FT                   GFRLEATGQVDQVLPVPFGEIADATMTPVSHILWSSLWLGIASDAVSRAKTFFQGQARA
FT                   RPGQLPPSASRVSEAVSLLQMMEGRVDLALAHQRSRHAGASVSAAFALAAEMNGLKTAM
FT                   STMALEVVQQALLVCGMAGYKHGTPFSLGRHLRDLWSAPLMINNDRIQTNTANLLLADR
FT                   S"
FT   gene            25721..26686
FT                   /locus_tag="Rmet_5838"
FT   CDS_pept        25721..26686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5838"
FT                   /product="putative Seryl-tRNA synthetase SerS2-like
FT                   protein"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5838"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12697"
FT                   /db_xref="GOA:Q1LAX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX9"
FT                   /protein_id="ABF12697.1"
FT                   /translation="MDAHTLTEARPAGGADPMAAQPPTFLESLLAAGLLIQTGVRGLYG
FT                   RSAVFEGIADGLNAAFTRIGADQNAEVLRFPPAIGKDDFETSEYLKSFPQLAGTIHSFC
FT                   GDDRGHRQLLARLEDKQDWTDQQQFTGVVMTPAACYPIYPVIGKRGPLPAEGKIVDVMS
FT                   YCYRHEPSLEPTRMQLFRQREYVCLGSPERIVAFRELWMERGLAFGRALQLPVEVDVAN
FT                   DPFFGRGGKIVADSQRELKLKFELLIPVNDGAPPTACMSFNYHMDHFGALWHIGLHDGG
FT                   VAHTGCVGFGIERLVLALLKHHGLDPARWPQAVRETLGGI"
FT   gene            26687..27670
FT                   /locus_tag="Rmet_5839"
FT   CDS_pept        26687..27670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5839"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5839"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12698"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX8"
FT                   /protein_id="ABF12698.1"
FT                   /translation="MYGDGKVRTRGGAYALHGGNPVWSHANRHIDLWIELLHGWELEPI
FT                   AALPFTVTLDFEGDQFTSLNIPSADLELLYGIVKDELSTYGRLETHVAAQTNRGNVVLL
FT                   EVDNYQLPQSPGAYRRQHARSCIAIDVLVPEATAVGYYHHDGYHTASGDDYVSIFRSLD
FT                   GESSWGAASFPQAEVVRRRFAAQAEDALLRASMDLLRSHLARRPRQNPIKAFREAFPAH
FT                   LEQLMSRGEPNFQIYAASVLRQLGANFELMGRYVRWLVMNGKVVPDTVAEACYTMASEA
FT                   MVMQFRLMRAVISHKPDGCQDCLAQLEAAYQGTVPALAACFGETVS"
FT   gene            27667..30237
FT                   /locus_tag="Rmet_5840"
FT   CDS_pept        27667..30237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5840"
FT                   /product="Beta-mannosidase"
FT                   /EC_number="3.2.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5840"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12699"
FT                   /db_xref="GOA:Q1LAX7"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX7"
FT                   /protein_id="ABF12699.1"
FT                   /translation="MTARDPEPALLPVLRPGVAVGDARLEGDWTLLETFANAVAHPGEL
FT                   DDGGHWLPAPVPGTVASALRAAGRWDEAAPPPLHQHDYWYKLRFQGDGRRLLRFNGLAT
FT                   LAEVWFNGTKVLTVRHMFTAHQVEVELAGDNVLHLCFRAMHPWLRTQRGPVRWKPRMIV
FT                   PPTLRAVRTTLLGHMPGWCPPVHAVGPWRDIELLDPMGADVTHGVRAELSSHLDGDDGV
FT                   VVLQLHFPGPAPEQGTFAAIGPDHAVWQGELRRVGGHTLAGTLRVAQAQRWWPHTHGEP
FT                   ALYRVEASIGALGIACGHTGFRTITEDRSGDDGAFALRVNGERVFCRGACVSSHDLPGL
FT                   ADTDASVARWLQLARDAGANMVRVSGVTCYPGEAFYRQCDALGLMVWQDFMFANFDYGS
FT                   ESSASPALMADAAGEVAQWLTSTRAHASLAVLCGGSEAEQQAAMMGTPRNVWRQPLFDE
FT                   LIPSLVREHRPDVIYVRNSPSEGAWPFQPDTGVSHYYGVGAYQRPLSDARMANVRFTSE
FT                   CLAFANVPCGRTLSEAGLFQPLHDPRWKARVPRDAGAAWDFEDIRDFYLRDLFDVDPPR
FT                   LRYEQPERYLALSRAVVAEIMTEVFGEWRRAGSTCQGGLVWQLQDLVPGAGWGIVDARA
FT                   RPKSAWHALRQVWQPLQVILTDEGLNGLHAHVINESATPRTVCLTLRCLRDGEAVAARA
FT                   EQTLTLAPRETRRLGAAEMFDHFFDFTYAYRFGPPAHDVVIATLHTMDEDNGLLNQPPG
FT                   PPLSQSVYLPDRRAAALREPGLQASVAREGDQWWLTVGTRRFARWVHIVDHAMQPETDW
FT                   FHLGPGETRRIRLMHDAGVTSGASAIPSGEVSALNASRPVSYDG"
FT   gene            30636..31364
FT                   /locus_tag="Rmet_5841"
FT   CDS_pept        30636..31364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5841"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5841"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12700"
FT                   /db_xref="GOA:Q1LAX6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX6"
FT                   /protein_id="ABF12700.1"
FT                   /translation="MITHRSDLHVNHLLNALPRHEWEALSRHFELVRLRAGELLTDSGQ
FT                   RIVHVYFPTTSVVSLLSLLEDGATVEFAAVGNEGLVGIPVVTGGDTMPSRVEVRSPGFA
FT                   YRIPARVLRSELGQLPALQRVTLLYVQAVLTQIAQTAACNRHHSLNKQLCRWLLLAIDR
FT                   MSTNELVITQQVIANMLGVRREGVTEAAGKLEDLGLIHHSRGHITVLDRCGLEKHSCEC
FT                   YKLVKREYDRLLPALADVHA"
FT   gene            complement(31445..32497)
FT                   /locus_tag="Rmet_5842"
FT   CDS_pept        complement(31445..32497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5842"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5842"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12701"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX5"
FT                   /protein_id="ABF12701.1"
FT                   /translation="MERGTETVLGTLAGCGGGADSAAAIAPANTRPGGLHGEDAIWQET
FT                   NCYMDLWIELLYGWGLDPRAALAFTVTQDFEGDHFTFFKYPQADIEQLYGTVVQEMAVY
FT                   DTLEAHVAEQVGRGHTVLVEVDSYYLPDTRATAYRRGHVKTTIAVDRIDTAAQRLSYYH
FT                   SVGYYTAEGEDYRGLLRLDPALRDNGDVLFPYAECAKRVRTPLQGAALANAVAVQMRRH
FT                   LGRRPAHNPVSRWREAFGDQVGNVLARGDAYFHHYGFNLPRQLGANFEMLGHCLTWLGE
FT                   HGYRVPASAIRGAATIASECKVLQFRLARAVARGRPDLCAETLDTLEAAHSEVIDGLLQ
FT                   SFGSIDPAHS"
FT   gene            32872..34368
FT                   /gene="manC"
FT                   /locus_tag="Rmet_5843"
FT   CDS_pept        32872..34368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="Rmet_5843"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5843"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12702"
FT                   /db_xref="GOA:Q1LAX4"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX4"
FT                   /protein_id="ABF12702.1"
FT                   /translation="MPVIQPVKRPVIQPVILAGGAGTRLWPLSREQYPKQLLNLVANDT
FT                   LLEATAARLEGVAARTGRPAGVEAPQIVVCGEEHRFMVADMLKRKGKRARVVSEPCGRN
FT                   TAPALTMAALHAMASAGEGGDAVLVATPADHSVTDSDAFRDAIAAAVLHAERGAIVTLG
FT                   VRPTAPETGFGYIRAAVPVPPGGFLIERFVEKPHLELAQHYVDSGEYWWNCGIFVVLAS
FT                   VWLKAVMQLQPEMHARCCAAYETGQPSESGKDDVFRIGQEAFDTCPSDSIDYAVMEKLD
FT                   GLRGIPGMLVPMDAGWSDVGSWAAIWDIATKDNAGNAGRGRVLFDGASSCLAHSEGRLI
FT                   ACVGVQDVVVVETADAVLVVDKHHVQDVKNVVQRLRQEHGAEIVNHRKVHRPWGCYDSI
FT                   DHGDRFQVKRIVVEPGASLSLQMHYHRAEHWVVVRGTARVTCGETTSILTENQSTYIPI
FT                   GTLHRLENPGKTPLEIIEVQSGAYLGEDDIVRVEDNYGRK"
FT   gene            34430..36772
FT                   /gene="epsB1"
FT                   /locus_tag="Rmet_5844"
FT   CDS_pept        34430..36772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsB1"
FT                   /locus_tag="Rmet_5844"
FT                   /product="protein-tyrosine kinase"
FT                   /EC_number="2.7.10.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5844"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12703"
FT                   /db_xref="GOA:Q1LAX3"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX3"
FT                   /protein_id="ABF12703.1"
FT                   /translation="MSTMSSAGAMPAPGSSATRKGGRHLRAWMDHAGWIVAAGVIGATI
FT                   AAMIGISRPNLYDAHTLVQIYQKGDGSGTTQRTEPFDVGMLRSRAVVGPVVERLRLYIS
FT                   VEPLRAPLLGGVAAHFAQAGKLRGPWPERLGYAWGGERVDIRTLDVPERLLNVPMTLEV
FT                   LPGDAYRLTLDGELVTDGKIGSRVEENGVSILVSRIDARAGTRFTVTRHDTAQTIDTVA
FT                   RELRIGSDGSDTSTVRIAWQSSDRTAVAALINGIADSYITGQAETRRDEAASTLAFLSG
FT                   ELPRVKDELERAEAALTRYRSRTGSMQPSQDAQSYLNSSIDYQKQIAQLKLDRTKLLQR
FT                   FTEESNEVRTMDSQIQQLTRDRKELDTRMQTLSVSERESVALTRDVKVAEDMYMSLRNR
FT                   LEQLSLAKLDSTRQTRVVDIALTPVSPIGVGTAPLTMGGGLLGICLAMCVVSVRQRMKP
FT                   AVATANDAEETLGLAMLGDVAYSREQVELERLLTAKDQDIGTMLALQAPEPGRQVAQAL
FT                   PHGAGDAEPGHWGLHDQYLLARNAPHSMAVEGLRSVRAALHFLRREGSNKVVAVTSPTA
FT                   GAGKTFVSVNLAVLFAEAGQRVLLVDADLRRGRVSSWFGQPAGPGMAEVLAGRATLVDA
FT                   ARPTVVNGLSILPAGAPPTNPSELLMRPAFADCLRAGAERFDLVLIDTPPVLAVADAML
FT                   VANVVGATLLVLRADSTLPSQVEETIKRLTRAGASLSGGILNGVMPKRSNRVGFGTMNP
FT                   YLGMPTVMPAVRQIAHVPAVEDKTTTS"
FT   gene            36880..38727
FT                   /locus_tag="Rmet_5845"
FT   CDS_pept        36880..38727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5845"
FT                   /product="conserved hypothetical protein; predicted
FT                   alpha/beta-hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5845"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12704"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX2"
FT                   /protein_id="ABF12704.1"
FT                   /translation="MRRVVFEGCAGWLHEAGGDTGVVMCAPQGHEMLWSHRAWRHLADA
FT                   LAMSGVPVLRFDYRGTGDSADLEPGADMFGGALADIAAAVLALRRETHVTRVVLCGLRL
FT                   GASLAALAAARGREVSGVVMLAPVVNGRLYLRELRALHAGWRNSMIPELEVPPTPAGEQ
FT                   DVLSFRLSAATIAAIQAMRLDDVVPARRVLLLDAWPDAASPVAAMALKLGEAGVDVDMA
FT                   PFAEYPEMMRSTEFADVPVEAWKHVADWVKAGTARQPEVSASAEAAPDSANSANSAGDA
FT                   LVGEGMDGVVEHPVWLDEARMFGILCVPAEANANARQANTVVIFPNTGGNHHIGDGRMF
FT                   VDVSRQLARAGTAALRLDVSALGDSPAPACKMSVSAIYSMKPRADLAAAVDWARARGFG
FT                   DVVVAGVCSGAFMGLYAALSNPGVSGLLLVNLVKFRWDEADDAAVGDHLRSMRVYLAAA
FT                   RQWETWQRLFRGEINARRLLSATLRRVRQRVHDRVSAVGGRMRRNDVQQTMPEFAAAAV
FT                   RELDRRGVPTMFLYGATDVGLHELRLGLGKHLEAIQGLRNVQFRTLPLLDHSLFLDASR
FT                   QAFAEQLIEHLRWMSMDSSETSDTPEAAISFTPVTQRAA"
FT   gene            38779..40389
FT                   /locus_tag="Rmet_5846"
FT   CDS_pept        38779..40389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5846"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5846"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12705"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX1"
FT                   /protein_id="ABF12705.1"
FT                   /translation="MPNLRRSFLATLGALTGAGVATAAGARDLGAPANPKSDAAEKVVS
FT                   VADFPGLDGTGKSPSDEAFRAALQAVAGQVHAPAFGENPNNIGGARIVVPRGTYLLTRP
FT                   GVLFNARQFPSRTCGFTIEGDGPPGTVVILYKPGRDGSGALFNNQDKALGVRLRNLQFH
FT                   GMDARSDLITSVSSGGAQDYAFDDCMFTGTWRYGVDLTGDNCNSEWKFWRCTWAGTWDS
FT                   FLHVGEKNTSDQFLNYWFEHCRYWCSSPWIDMRRGGHIKLTDCDVSGYEPSTQTYLFNL
FT                   RGNNHAMGVCSFKAHGLRVEQKSRNAGLMLCEWEQGNIGFRECDFGSQGFRPFAADTVS
FT                   AVFSPGNTAGAQVVFDNCQIMGRHQYVSGNTPAAQGRAVYRNCDFVNYTYPDEALMFSE
FT                   ANNLAGNRRVVTLEGCRGKGAANVYADAEIGWHVAASAAVRTKVMALRVARGQRGSMPT
FT                   AILPLNAVVTRVVFDTAGDRGSYAIVSGDATKLSVFKASGPAEERLPFRCNTRQRCTLT
FT                   LTPGSDPGTEVVALIEYIG"
FT   gene            complement(40410..41255)
FT                   /locus_tag="Rmet_5847"
FT   CDS_pept        complement(40410..41255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5847"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5847"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12706"
FT                   /db_xref="GOA:Q1LAX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAX0"
FT                   /protein_id="ABF12706.1"
FT                   /translation="MTQSNQDNRGAKMQLQGKVAVVTGAGSGIGRAVAQALAQRGCHLA
FT                   LADRNQEGLAETAALPELNSVKVSLHTLDVADRDAVAAFPQTVLAHHDRIDLLVNNAGV
FT                   ALAGSFEQVSETDFDWVMAINFHGVVRMTRAFLPLLHRSDDARIVNISSLFGLISPPGQ
FT                   SAYSASKFAVRGFSNALRHELADSRVGVTVVHPGGIATSIARNARVSADIPQAQMQERL
FT                   ANSQKMLRMPPPKAADIIVRGIEKRSARVLVGSDAVVMSWLERLFPVRYWNLLARRAKL
FT                   "
FT   gene            41436..42629
FT                   /locus_tag="Rmet_5848"
FT   CDS_pept        41436..42629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5848"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5848"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12707"
FT                   /db_xref="GOA:Q1LAW9"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW9"
FT                   /protein_id="ABF12707.1"
FT                   /translation="MHEKRPGVRRLTVYAGVALTIQILVLGIWIIRFYILGDQSAPMLG
FT                   IDFAIFWSAAKVAVEHGAASVFSPEWMLPMERALGLSDYSAWPYPPTFLLVVLPLGQLP
FT                   FGAALILYSVLGLLVYGAVLLRICRGIDRGYLSLLLAFPGAAIAIGLGQNSLFTLAAAG
FT                   AALALLEVEAALAGVCIAVLAIKPQFGILFPLALICGRHWKVFGVSALCTAVFVGASVV
FT                   LLGQDAWRAFAAFLPQFGTLAVEQGGNMMWPGMPTAFALGRSIGLSVNGAYLLHGLVAA
FT                   PAVLAMAFLWAQRARFELRAASFILATLLLQPYVMFYDLAWLILPMAFLLRDGNRLPLS
FT                   PLEWIVFALAWVAPAQALLSAYLHQYLNVLPIVMIALLVMLVRRHLAMTAVAPAYQP"
FT   gene            complement(42711..44957)
FT                   /gene="epsB"
FT                   /locus_tag="Rmet_5849"
FT   CDS_pept        complement(42711..44957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsB"
FT                   /locus_tag="Rmet_5849"
FT                   /product="tyrosine-protein kinase"
FT                   /EC_number="2.7.10.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5849"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12708"
FT                   /db_xref="GOA:Q1LAW8"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW8"
FT                   /protein_id="ABF12708.1"
FT                   /translation="MSNVRHFREPSPEPWEESDNAVDMTSYVDVLIRYRWTFLVVAGTI
FT                   LGVGLLYALMARPIYRADIMVQVEESNPTNNASKLIASISPGLDVKPAATAEMELLRSR
FT                   AVVGKAVETLRLDIDAKPRYFPLIGASIASYNKELSKPGLFGFGGFAWGSESIVVDRLD
FT                   VPEQMEDRRMVVTALGDGKYRLEFASSEKSAEGTVGQPLTVATDSGTVSIDISQMDARA
FT                   GTQFRVRRVPRATAIANLQDQLMIGERGKQSGVIGVALEDTSAVTAAAILNEIASEYVD
FT                   QNLRRKAAEAEKSVNFLESQLPQLKQQMETSEARYNAMRNQRGTIDLSEESKLILAQSV
FT                   QIQGKLQELRQKRQELIVRFTANHPTIEILDSQIAGLTAQLNGVSGKIQKLPDVEQDVV
FT                   RLMRDVKVNTELYQSLLNDVQQLRLLKASKVGTARLIDAADVPIKPVRPNRMLVTGVSV
FT                   AMAVVMGLLAVGVRRVFDGGITDAEEIETQCGMTVYATIPMSPNQARLARNKESGGDVL
FT                   ALDQPDDPAIESLRAFRTALQFALLSAQRNNVVVFTGPSPEAGKSFVSVNFAVVAAAAG
FT                   RKVILVDSDLRRGLLNERFNVSRKPGLTEALTGTRLDQVIQHDVAPGVDFIATGAEPPL
FT                   AADLLQSPGMDTLLAELRSRYDLVLIDTPPVLAASDAGILAPKAGAVFMVARADKTTTA
FT                   ELTAARRLVEQTGGEIKGVLFNGLKIEGRWYRSHYHFGKYRYLNRYGHDHAKQA"
FT   gene            complement(44957..45451)
FT                   /gene="epsP"
FT                   /locus_tag="Rmet_5850"
FT   CDS_pept        complement(44957..45451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsP"
FT                   /locus_tag="Rmet_5850"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5850"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12709"
FT                   /db_xref="GOA:Q1LAW7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW7"
FT                   /protein_id="ABF12709.1"
FT                   /translation="MEVMREGKEAAFIRSILVVCIGNRCRSPMAAALLGRALPQCRVLS
FT                   AGLAPPVGAAADPRAVRLLAVEGSDLTDHRARAVSAALVAGADLVLVMDEEQRDALEDM
FT                   YPQARGKTYRLCEQEQTDVPDPFSGSMSMFVIALGLIKMGVESWSARIHAAEPAHRHGG
FT                   A"
FT   gene            complement(45455..46543)
FT                   /gene="epsA"
FT                   /locus_tag="Rmet_5851"
FT   CDS_pept        complement(45455..46543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsA"
FT                   /locus_tag="Rmet_5851"
FT                   /product="EPS I polysaccharide export outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5851"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12710"
FT                   /db_xref="GOA:Q1LAW6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW6"
FT                   /protein_id="ABF12710.1"
FT                   /translation="MACAALLLSACAVSPGMQFSSSAPVNAVSPNAMPDVTPITLDLVH
FT                   EQQAHSKPTNAGVEDLYGTPTPYRIGPGDIISVVVWDHPELVFPTQTYSIGAAFEIPTS
FT                   SGGSNMPGYVVSPAGDIQFPYAGVMRVAGKTANEVRDEMARILSRVVRDPQMTVRVLGF
FT                   RSQRVYVDGEVKTPGMLAIDDAPMTLVEALNRAGGVLNLTGDNSRVRVTRGERSWYVNI
FT                   PALLAKGTDPARILLQSGDIVRVEQREDSKIFVTGEVVKPSSLLMRNGRMTLNEALGDA
FT                   GGVNPSSANAEQIFVIRRATDGKPKVYHLDGTSPVALAIAESFELEPKDVVYVDARDLV
FT                   RWSRVMTLLIQPVVGTATIVKP"
FT   gene            46881..47642
FT                   /locus_tag="Rmet_5852"
FT   CDS_pept        46881..47642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5852"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5852"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12711"
FT                   /db_xref="GOA:Q1LAW5"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW5"
FT                   /protein_id="ABF12711.1"
FT                   /translation="MKGVIINADDFGYDDDTFQATVACFDAGLLTSATILAGSPATAHA
FT                   CQYARDNHSRFSFGLHFNIVEGRRPHGASSTLCRKDGSLFPPKIQRARAMAGLIDAADI
FT                   RREFRLQLDELRDHGVNVSHVDGHGHLHKYPAVMRVLRDEMLRAGIERVRPPQNCYFLK
FT                   NHMRGAMNVMLLRHFNGLRSPDFYVGADTRQQGWALRLPAMLPEGVTEMSVHPGFAEPW
FT                   RREEGEPLMHPTPLATAFRQAGVVLMRYHDI"
FT   gene            complement(47677..48909)
FT                   /locus_tag="Rmet_5853"
FT   CDS_pept        complement(47677..48909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5853"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5853"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12712"
FT                   /db_xref="GOA:Q1LAW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW4"
FT                   /protein_id="ABF12712.1"
FT                   /translation="MTIPNTLGPIARQPVDDDIPPSPAQSLAQAGAPSTVARPVLFLGP
FT                   LPPPHHGFSASNQRMVDQIRQHAPVVVLDVAPRASGRFGGRLGGLQALGNRARQLWRMV
FT                   RLVTNRKPGNRPHTLYMGLSGGLGQLLDAPFVALAHWSGMDIYFHHHSFAYINRPTWYT
FT                   RLILRCAPRGRHLTLCDRMRAELARLYRLTPDRVQVLSNLSLIDLPATTSTEAPARRHS
FT                   EAINVGFLSNITAAKGIFTFLEVVRLAQEIGIPVCARIAGPVARHIRARFDTELARTPC
FT                   TRYLGPIHGTEKEAFFQDIDVLMFPTTYHNEAAPLIVLEAHSHGVPVVAHDRGCIGSMI
FT                   DERNGVLVPADADFAEAAIAYLRNMMLAHSQAESQAESKRAALLADFQAQRGRAEAVLA
FT                   RAVADISHCPD"
FT   gene            complement(48906..50051)
FT                   /locus_tag="Rmet_5854"
FT   CDS_pept        complement(48906..50051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5854"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5854"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12713"
FT                   /db_xref="GOA:Q1LAW3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW3"
FT                   /protein_id="ABF12713.1"
FT                   /translation="MIDIYHNILWPRYKGAVFSEAFSHAHKAGHKVRFFHISSTGYGRT
FT                   AYSGVDTSYHRYPYEILFDEPYEAIPTWKMSLRLMREVWRSKNRLILMPGYHRVEFWAM
FT                   LVACMLSGKRRAVFCDSTIQDQADHPMKRRLKRFFFSRCDGVFVYGRRSAEYAIAMGAD
FT                   PTKVICHCQAAALPHSYNAAEANRIRIANAPPAEAPRFLFAGLVCRAKGIEDLLRAFVE
FT                   VRRQLPAATLVLAGPVVAADQLPELARSLGLGDAAQFLGAMDIDQLAQQYSRATCLVLP
FT                   SHTEAWGLVVNEALNYGCPAVVSDCCGCIPELIKEGRTGHTFVTRDVDDLARVLLKATS
FT                   SFADVQATMRNCVDVVRKYTPARAGRSIIKGCQKILKRART"
FT   gene            complement(50095..50715)
FT                   /gene="wcaF"
FT                   /locus_tag="Rmet_5855"
FT   CDS_pept        complement(50095..50715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaF"
FT                   /locus_tag="Rmet_5855"
FT                   /product="glycose-acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5855"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12714"
FT                   /db_xref="GOA:Q1LAW2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW2"
FT                   /protein_id="ABF12714.1"
FT                   /translation="MFQDLSTFRMPPGFRGRSAVVVQLWWCVQSLFFHHSPHFANGFRC
FT                   WLLRRFGARVGHHVVIRPSVRITYPWKVSIGDYAWIGDGAELYSLAEIEIGNHAVVSQF
FT                   SYLCGGDHDYRSSDFAIRGRPIRIADEAWVASHTFIAPGVSIGKGAVIGARSAVFTDMP
FT                   AGMLCVGSPCRPLRPRLDTASQNQTRPHSQAAAPSELDSAQVN"
FT   gene            complement(50858..52120)
FT                   /gene="wcaI"
FT                   /locus_tag="Rmet_5856"
FT   CDS_pept        complement(50858..52120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaI"
FT                   /locus_tag="Rmet_5856"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5856"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12715"
FT                   /db_xref="GOA:Q1LAW1"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW1"
FT                   /protein_id="ABF12715.1"
FT                   /translation="MKILLYCLNYAPELTGIGKYTGEQAEWLAARGHQVRVITAPPYYP
FT                   AWKIDRAYRGLRYRREMRHAVDVMRAPLWVPERPSGVKRLLHLASFAVTSLGWLARQVA
FT                   WRPDVVFTVEPPLFCSPATLLFARLTGAKAWLHIQDYEVDAAFKLGLLKGGLPQRMAST
FT                   FERFIMRRYDHVSSISHTMVALARQKGVDATRVSMLPNWVDLAALARRGDADFRARLGI
FT                   PANAVVALYSGTIGTKQGIEILADAARHLCSRDDLHFIICGAGAGVPALRTQCEGLARV
FT                   HFLPLQSAEDFPALLDCADIHLMPQRADAADLVLPSKLTNMLASGKPVVATAAPDTELG
FT                   KLVIQFGSLVEPGNSVAMADAIAALADDPPRRQALGSAGKAWAAAHLDRDAVLAEFERT
FT                   LLRLRAPRGVADQAAADLAGK"
FT   gene            complement(52211..52381)
FT                   /locus_tag="Rmet_6608"
FT   CDS_pept        complement(52211..52381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6608"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45207"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY37"
FT                   /protein_id="ADC45207.1"
FT                   /translation="MENGDARTRTMQDRPALEPSPLTHRLLFARAQPCQALARACGGER
FT                   SLPATLPTLRT"
FT   gene            52443..53846
FT                   /locus_tag="Rmet_5857"
FT   CDS_pept        52443..53846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5857"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5857"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12716"
FT                   /db_xref="GOA:Q1LAW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAW0"
FT                   /protein_id="ABF12716.1"
FT                   /translation="MTTIKGELLEGETETGMAAAAQGGQYGAAAERASEAKRALRLAVA
FT                   SSMVSKVCSIGLQAVSIPLFARVLDTDDFSAMMVYFGVTAWLSLVAIGIWPTVTSIAAD
FT                   DRRRGQLAGVLTVSWVGLSAIFASLIVLVLVLRPVLEQSGINLFSARHYSLFTAALVCY
FT                   AMLTVLSVGEAVNQGQHRQHVNNLITAAGSILNVVFILLVTYFRPPGEEHVDVTLLFVA
FT                   SQAGFILIRVVNMIGVVVRAGWPHAFPGKAFARELARNSWSLLQAQLAVVFLQQGAVLL
FT                   CYETDMPRDAALLALLFRANLLLHSFVYMINQPLWPIIHRNMLAGDWQWVIRIYRKLAT
FT                   CYVAYGLLAIIGAAFVGGAAVSLWTAGEYPISNKLATLCAVYFALLVTSAASTPVLMGA
FT                   KAFVSLGNIGMAEFLAAGVLCTILYFADAVSFPHVVEALIAANAMTALWMMPTQAIVRL
FT                   SRGSLDAQH"
FT   gene            complement(53979..55418)
FT                   /locus_tag="Rmet_5858"
FT   CDS_pept        complement(53979..55418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5858"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5858"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12717"
FT                   /db_xref="GOA:Q1LAV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV9"
FT                   /protein_id="ABF12717.1"
FT                   /translation="MRLQRNFVWDTLLAATLLLIVGYCHAISHMDSPMLLLSTLMLTAM
FT                   VIIHWLLHVRERVPSLANSSVLLFETLFLVVAPSVQRAYYEWHMVNTATLEESLAVSTN
FT                   LLCTLFVMTYVATRYYMQRRDQHRSRTRRPRPPTFVHTLRLNAPRTFVLLGVAAVAAML
FT                   SWQTIDLRAQSEVIEATPQYLLVQKYLCFMPVPMLLMLVNVKGRKLLRQPFWLLVTLFV
FT                   LACVLITQNPLIEKRNAIGPIYLSLLLMLMPWFSRTPRRLVSTLVLLTGVFFPLLSIFT
FT                   HTDLSAWQPSEILDPWLYFSHFLDLHYDAWANIATVIEMVNRDGLSYGHQLAGSLLFFV
FT                   PHTLWETKPLATGIEIGQFLMAYYKLDFDNLSAPLIAEAYIDFFAFGVIAYAIALAFIV
FT                   RLLDKLCRSGGIMALPAGIYFSIFLIFALRGALMIAMAYGSGALMAFLTIGWFVSGKRR
FT                   LHTRRSRNVRPLGPTPVRPAI"
FT   gene            complement(55457..56458)
FT                   /gene="wcaG"
FT                   /locus_tag="Rmet_5859"
FT   CDS_pept        complement(55457..56458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaG"
FT                   /locus_tag="Rmet_5859"
FT                   /product="bifunctional GDP-fucose synthetase:
FT                   GDP-4-dehydro-6-deoxy-D-mannose epimerase and
FT                   GDP-4-dehydro-6-L-deoxygalactose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5859"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12718"
FT                   /db_xref="GOA:Q1LAV8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV8"
FT                   /protein_id="ABF12718.1"
FT                   /translation="MTTMSDARPRVFVAGHRGMVGSAIVRALAARGDVELVLRTHRELD
FT                   LTEQRDVRHFFATERISQVYLAAARVGGIHANNVYPAEFIQQNLTIAANVIHEAWRGGV
FT                   EQLLFLGSSCIYPKFASQPIQESALLTGALEPTNAPYAIAKIAGMMMCDSYNRQYGVDY
FT                   RSVMPTNLYGPGDNYHPENSHVIPALIRRIHEARLADAPEVAVWGSGAPMREFLHADDL
FT                   AHACLHVMDLPQASYRAHTQGAGFLNVGSGEEVSIRQLALLIARVVGYRGNIAFDPTRP
FT                   DGTPRKMLDCGLINATGWQPQVSLESGLRSTYQEALSSGRLSVEPEALATPT"
FT   gene            complement(56442..57647)
FT                   /gene="gmd"
FT                   /locus_tag="Rmet_5860"
FT   CDS_pept        complement(56442..57647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="Rmet_5860"
FT                   /product="GDP-D-mannose dehydratase, NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5860"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12719"
FT                   /db_xref="GOA:Q1LAV7"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV7"
FT                   /protein_id="ABF12719.1"
FT                   /translation="MGVNELDNLFDAADKPGDASTPRGANGRRRALITGITGQDGSYLC
FT                   EYLLDKGYEVHGIKRRSSLFNTERIDHLYEDPQAPDRRLILHHGDMTDTASLVRVVQQS
FT                   RPDEVYNLAAQSHVQVSFEEPEYTANTDAVGTLRLLEAMRILGMEQSTRFYQASTSELY
FT                   GLVQEIPQKETTPFYPRSPYAVAKLYAYWITVNYREAYGMYACNGILFNHESPVRGETF
FT                   VTRKITRAIARIALGLQEVLYLGNLSALRDWGHARDYVEMQWLMLQQETPRDFVIATGE
FT                   QHSVREFVTLSAQKLGLTVTFEGSGVDEVGIISHIDTSRRELSSRCKVGDVIVRVDPRY
FT                   FRPTEVETLLGDPTQAREQLGWSPRITFDELVHEMIEADFVAARRDALVKMAGFRTYDY
FT                   HE"
FT   gene            complement(57827..58756)
FT                   /locus_tag="Rmet_5861"
FT   CDS_pept        complement(57827..58756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5861"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5861"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12720"
FT                   /db_xref="GOA:Q1LAV6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV6"
FT                   /protein_id="ABF12720.1"
FT                   /translation="MNALLIEEHPLLRLGLLQMLETIQEFGHVLALSPADVARTEVPHR
FT                   NAELLVFGMPGDQAYGWAQLEQARERLAPQRILVLADALPLHVPNAEAARGICGCLPKS
FT                   TSLPVIEAAIRLTISSVQGLMLASEVCATPSASRSAMHATQSLASAAPLPLPPAMQEPL
FT                   SPGACASVLRTTVAVRDLTSLRPGQPISSSAAPLSPMVEEEPGYDEAEMLQITPRQYEV
FT                   LVLLARGYPIKTVSRMLNISVATVKSHACTLYQRLKVRNKGEAVYAALQRGATLEWVHG
FT                   DEHSARDGGVRRVIARGPDAQYDSSLPA"
FT   gene            complement(59296..59502)
FT                   /locus_tag="Rmet_6609"
FT   CDS_pept        complement(59296..59502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6609"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45208"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY38"
FT                   /protein_id="ADC45208.1"
FT                   /translation="MALVGAWACDPDQRQICQPIRLAEGGWNPGDGRPTGNLLSPTEVG
FT                   YIPHPFELVRLPFRVNPMSGYMA"
FT   gene            complement(59565..59873)
FT                   /locus_tag="Rmet_5862"
FT   CDS_pept        complement(59565..59873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5862"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5862"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12721"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV5"
FT                   /protein_id="ABF12721.1"
FT                   /translation="MKRQLLLAAAVLATGSVFGLISPGAQAHDNYYRSPPPPPRHEVRP
FT                   APRPGHVWVPGHYDHARDNYAWRGGYWQSARPGYRYVPERWERGPHGWYKRPGYWGR"
FT   gene            complement(59936..60067)
FT                   /locus_tag="Rmet_6610"
FT   CDS_pept        complement(59936..60067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6610"
FT                   /product="conserved hypothetical protein; putative
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6610"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45209"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY39"
FT                   /protein_id="ADC45209.1"
FT                   /translation="MKRALTLALLLVTTSALLSACIVVPPRGPHYHYDHYDRYGGRY"
FT   gene            complement(60292..60825)
FT                   /locus_tag="Rmet_5863"
FT   CDS_pept        complement(60292..60825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5863"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5863"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12722"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV4"
FT                   /protein_id="ABF12722.1"
FT                   /translation="MVSPFVMDECGEDVNTGAPVLAPALARLWLCLWLWHLGAIDDRHG
FT                   IRAIDAAVGTGELRHGKRAQTFKRLQDQHDEHDRHDVLPRDYGELIGANFMPPGQRHPR
FT                   PAFDASWGNPGTGRRHGHALRTMSGHPPIPAQPAKAYPFLRPTWGTSPAMTGVLRYRNR
FT                   APRIGKSLHDSFPM"
FT   gene            60866..61267
FT                   /gene="cynS"
FT                   /locus_tag="Rmet_5864"
FT   CDS_pept        60866..61267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="Rmet_5864"
FT                   /product="cyanate lyase; cyanate aminohydrolase"
FT                   /EC_number="4.2.1.104"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5864"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12723"
FT                   /db_xref="GOA:Q1LAV3"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV3"
FT                   /protein_id="ABF12723.1"
FT                   /translation="MLRGIRWADVAERVGKSKEWTTAACLGQMAFDEAGARAVMEIFGL
FT                   PAEAEPWLRAVPYKGSLPTQVPTDPLIYRFYELISVYGTTFKALIHEEFGDGIMSAIDF
FT                   RMDLQREPDPNGDRVRIEMSGKFLPYKTY"
FT   gene            complement(61346..61510)
FT                   /locus_tag="Rmet_5865"
FT   CDS_pept        complement(61346..61510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5865"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12724"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV2"
FT                   /protein_id="ABF12724.1"
FT                   /translation="MNPQQISRTNDEAKQPEADLDIPFGSLDAAAMAELPYTFRQTGTC
FT                   TRYYQEFFG"
FT   gene            61850..62632
FT                   /locus_tag="Rmet_5866"
FT   CDS_pept        61850..62632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5866"
FT                   /product="phosphoribosyltransferase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5866"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12725"
FT                   /db_xref="GOA:Q1LAV1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV1"
FT                   /protein_id="ABF12725.1"
FT                   /translation="MSLPPCFANRREAGQYLGRHLAALGYSRSHDGDPALVLALPRGGV
FT                   PVAYEVARMLDATLDVLLVRKIGAPGYPELALGAVVEGDAGGSGPHTVVNDDPWARRAL
FT                   ESGAFDAERGRQLGEICRRQQRYRQGHPVTAMAGRRVIVVDDGVATGATMRAALDAVRM
FT                   AGAAEVVAAVPVGSVDGLDTLRAVADRVVCLNIPENFGAVGAFYLDFTQTSDDEALSLL
FT                   REAAAVAPPLATHGAWSRNGGVSGGGESGHLSNGPAAH"
FT   gene            complement(62643..63155)
FT                   /gene="leuD"
FT                   /locus_tag="Rmet_5867"
FT   CDS_pept        complement(62643..63155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="Rmet_5867"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5867"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12726"
FT                   /db_xref="GOA:Q1LAV0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAV0"
FT                   /protein_id="ABF12726.1"
FT                   /translation="MTPAPDFHPPPSGRIWRFGENVDTDAMAPGRFMKDGLDVLASHCL
FT                   ENLRPEFPGAVKPGDVIVAGSNFGMGSSREQAAQALKHLGVAAVLASSFAGLFYRNAIN
FT                   IGLPVLVCADTAALADGARATFFLDAAEIRLCDGRRVSCEPVPDFLRALLHAGGLVPHL
FT                   KARLNKV"
FT   gene            complement(63152..64474)
FT                   /gene="leuC"
FT                   /locus_tag="Rmet_5868"
FT   CDS_pept        complement(63152..64474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="Rmet_5868"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5868"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12727"
FT                   /db_xref="GOA:Q1LAU9"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU9"
FT                   /protein_id="ABF12727.1"
FT                   /translation="MTLPHGKTAVDPSQLPATLAQKLVARAAGVSHVTPGSVVMCKVDL
FT                   AMSHDSSGPRRVAPLLRELGAKVWDPSRFVVVTDHYVPAADPEAESILRFTRDWVREAG
FT                   IQNFIDNEGICHVVLPERGHILPGRFIVGGDSHSPTGGAFGAYMFGIGATEMAGVLATG
FT                   EIWLRVPNTIRVEWQGTLSDGVCAKDIMLFLCATLGMAGGRYEVIEYTGSTVKTLSMQE
FT                   RMTLTNMSTELGAQTALIAPDATTMAWLADAGVDAATLAAIEPRQWRSDADAPVLATHR
FT                   FDAGTLVPQVAAPHSPANSGPVDQAAGAPIEIAYLGACTGAKLEDLRMAARVLRGRKVA
FT                   PGVSLKVAPASLRDQQQAATEGTLGVLMDAGAELLPNACNACAGYGATRFPAGSRAIAS
FT                   TARNFPGRMGDAGSAVWLASPMTVAASAATGCITDPRTLLA"
FT   gene            complement(64471..65511)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5869"
FT   CDS_pept        complement(64471..65511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5869"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5869"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12728"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU8"
FT                   /protein_id="ABF12728.1"
FT                   /translation="MPVVRPGEHQPACKSALQSASSQRRASCAALLALAAWCIAPSAQA
FT                   AQAAIAGGKPIRILVGAPAGGTTDTLARTIAQEMSQTLDQPVVVENRPGAGGNIAADMV
FT                   AKSPADGTTLLMSFTSHTINATLYKKLPFDPIQDFTPITLVATVPSVLVARPNLPANNI
FT                   PELIRLAKSEPGKLNFGIGAVGSSVHLAGDMFKMMTGTYIVNIPYKGTTPAITDLLAGQ
FT                   VDLMFASTINVAQHVKAGKLKVLGVTSPTPLPQFPGAQPIGATVKGFESSAWFGLFGPA
FT                   NLPPEITQALYQAARHGLEQPAVRKRLETDGAQPSAMPPEAFANFVKQDVKRWATVVKY
FT                   SGAKPE"
FT   gene            complement(65612..66394)
FT                   /locus_tag="Rmet_5870"
FT   CDS_pept        complement(65612..66394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5870"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5870"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12729"
FT                   /db_xref="GOA:Q1LAU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU7"
FT                   /protein_id="ABF12729.1"
FT                   /translation="MSEAVVPLYHQIYVVLRQQIVEGRFGQGPLPGEIDLAKQFHASRV
FT                   TMRRVFDRLVQEGLVRRHRGLGTFVNPHPVRPQVTEERATSLLGAIIDMGEKTAVKVIS
FT                   IDEVHATPEVAEALQIQVGDPVVKIVRVRHYRNRPLSHITVYLPIDLGRSLTRKDLENT
FT                   PMLRLLEAAGVELGRASQVLTARLADVVVAPLLDVPVGGALLAVRRVVLDKNGRPVQLL
FT                   MGQYRPDRYEYRMELSPMGGGDSANVWVENETRTGLRD"
FT   gene            67094..68575
FT                   /locus_tag="Rmet_5871"
FT   CDS_pept        67094..68575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5871"
FT                   /product="conserved hypothetical protein (GRP)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5871"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12730"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU6"
FT                   /protein_id="ABF12730.1"
FT                   /translation="MNKTLLASAIALAFGIGGQALANPTNNNEKTGTTNTQNATATSTQ
FT                   SGAGASANENSTALQANGNSSSSTTNKTKNTTNTNTNSKNHTDQDMHGYGNAAAANGST
FT                   ATANFTNSFNSSKALAISKLEGYVTGNYIHNIGNVATNNGTANGGAGGKGGAGYGGDGK
FT                   GGSGGSGGASGAGGGGGSGGSAINGSAKAGYASNGSATAGDGAAGGKAVGWAGDGGNAK
FT                   SNGGGALTASLGVGGFGGSGKGSGGAAGAGALGGFGGDGGNAKGSGGGALGASGGLGGD
FT                   SAAGSALGKVHGNAGNSSATSGAGGNGTGGTASGTGGAGSGTGGAGGAGGAATAAAAGG
FT                   AGTGSGGAGGANTSTAGAATGGAATSTGGAGGAQNSVAGNGGAGGAATNGSASSMASNG
FT                   SATAGNGAVGASSGAGGAGGVGMGGTGGTGNGAVGGAGGNGGTNYVDAGTFNMSNMMSS
FT                   VGQSAAGIMMANQNSGMSSLVQQSVNVQANLAVGK"
FT   gene            68768..69229
FT                   /locus_tag="Rmet_5872"
FT   CDS_pept        68768..69229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5872"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5872"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU5"
FT                   /protein_id="ABF12731.1"
FT                   /translation="MRLHRRAVLAMSTAILAWPFAQAIAGPPVAEASATAVAVASSDTG
FT                   AATVVAGAAASVTAVTPDAAPKLNIFGTTANAVASSKLDDVRGGAELVVNDMRLNGTVG
FT                   GNAAINTLSGSNYVSDGSFANAAGLPTVIQNSGNNVLIQNATILNVQFK"
FT   gene            69226..69924
FT                   /locus_tag="Rmet_5873"
FT   CDS_pept        69226..69924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5873"
FT                   /product="peptidase (C39-family, bacteriocin processing)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5873"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12732"
FT                   /db_xref="GOA:Q1LAU4"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU4"
FT                   /protein_id="ABF12732.1"
FT                   /translation="MIMRSLLLAAATLAVALGGIAEARADTIRIPGDQGNSYTVPVTSL
FT                   REARFRTTIRQQYDFSCGSAAVATLLTFQYGFPVNEETVFANMYVNGDQAKIRSEGFSL
FT                   LDMKRFLESRGFLADGYELPLSKLEEAQIPAIVLIVENGYHHFVVIKGIKGDRVLIGDP
FT                   ARGTRSIERDHFEKIWDSQLLFVIHNRTDRARFNLAADWRVAPSGPYWMGVPRDSLFFT
FT                   VMPKHGPADF"
FT   gene            69938..71077
FT                   /locus_tag="Rmet_5874"
FT   CDS_pept        69938..71077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5874"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5874"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU3"
FT                   /protein_id="ABF12733.1"
FT                   /translation="MVQTTISPAPRCTARSTTAAVLLGAGLACAGNAHAGVETLAPESA
FT                   DTAGVATPVAIDLPAMPTPTQLSALSEDPITAAARAADPIVADNVAENVSGKAVESIAE
FT                   APARGVEPVDKASVARHHPIGDTLVAAMTMATREPAAQVAEARDGMARWKPVAQARLEE
FT                   SRGGFDVAGLQVGFGIDRAVFVNGALAVATSITIPNISSITSAQAAQLAQALAPVTVAV
FT                   TGANSIASAAIAAAQAATGQAGQAGQSATTAANGAAASAQGAAGVAASTSTAAASGGIA
FT                   QATGAAGVAQQQAATAVAAAGTVVTNGLLTVIQNGAANTANVGSVANMPATVIQNTLNN
FT                   QNIQSLMTINASVNTLAAFRAQMANTALNSVIPTMAGMK"
FT   gene            71186..72658
FT                   /locus_tag="Rmet_5875"
FT   CDS_pept        71186..72658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5875"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5875"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU2"
FT                   /protein_id="ABF12734.1"
FT                   /translation="MKKRSLQGIGLASCSTMCLLGGMAHAQTPPDDGPPAAAKLETLQK
FT                   ELTEQAKQLEAMKRALAEQEATIRELRSTVDSESLARKRGGQAGVGTGVTPSNMATNAA
FT                   AAAAGASATQINSTAQQGVQAQQAPSDAPPQAVAPQNVQQGQAAQGDQQGESAAGPEQP
FT                   VGRPPERDTRPPEIAPIFDQPGVLTPQGKIVIEPSFQYGYSSSDRAVLVGYTVIPALLI
FT                   GLIDVREIKTSTYITSMAFRYGITKRLEIEAKVPYVHSSSDTVSREIFTGTAVDNAFNA
FT                   SGSGLGDVEATLRYQLNYGNEKMPYFIGWLRYKSNTGKDPFEVVTDCVTRCVSNTTGTG
FT                   LPLGMPTGTGFQAIQPGVTWLLPTDPAVFFGTFSYLHNFARDNIYRTVLNGQQEFLGKI
FT                   APGDIFEFNFGMGLSLNEHASFSIGYDQSIIWPTKQNGQTVPGSVRITQGTLLVGYSYR
FT                   FNNRYTLNLSVGAGLTRDTPDLTVTVRLPITF"
FT   gene            72827..73339
FT                   /locus_tag="Rmet_5876"
FT   CDS_pept        72827..73339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5876"
FT                   /product="conserved hypothetical protein; putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5876"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12735"
FT                   /db_xref="GOA:Q1LAU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU1"
FT                   /protein_id="ABF12735.1"
FT                   /translation="MRKRIFWLLPDLASARRTMDDLLLARIENSHIHFVGRDGADMTGL
FT                   HEANLFQTSDIVHAAEMGLMVGGGVGIVAGVVVAMFPIVSDSPQWGLVGVLAVLGAVFG
FT                   AWAASMIGSSAPNSRLRSFEKDIEAGKLLLMVDVPRGRVEEVEALLQKAHPEASFAGLD
FT                   PAVPAFP"
FT   gene            73623..74762
FT                   /locus_tag="Rmet_5877"
FT   CDS_pept        73623..74762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5877"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5877"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12736"
FT                   /db_xref="GOA:Q1LAU0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAU0"
FT                   /protein_id="ABF12736.1"
FT                   /translation="MNARQFACGIFAATLGFVAPIAAHAEPGITKNTIRIGQSAGVTGP
FT                   VAGSVKEQIAGAQVYLNAVNASGGVAGRRIELLTYDDGFDAKRTPGNVRKLIADDKVFA
FT                   LFMVRGTPQNESILPIIGAEKVPLVAPLTGAITLHRPVNRYVFNVRAKYQDEVARAINH
FT                   LATSGMNRIAIFYANDGFGQDVFEGFNTALQARGVQPAGAASFNRPMGDISQGVASVNK
FT                   ADPQAVMVIGSGSEAARIIHEMKKAGSQAQFVTLSNNAADSFIKELGDDARGLIITQVV
FT                   PGMNSSQMSVASEYRGLAKAQKVEPSNAGMEGFMSAKVLVEGLRRAGPEPTREKLVAAL
FT                   EGLRDYDLGGILISYSPTRHTGSSFVEMSIVSSTGKLIR"
FT   gene            74793..75572
FT                   /locus_tag="Rmet_5878"
FT   CDS_pept        74793..75572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5878"
FT                   /product="gluconate 5-dehydrogenase (5-keto-D-gluconate
FT                   5-reductase)"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5878"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12737"
FT                   /db_xref="GOA:Q1LAT9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT9"
FT                   /protein_id="ABF12737.1"
FT                   /translation="MENASTAHPFSLTGRVALVTGGAQGLGQAIAAGLAAAGAHVLICA
FT                   RNAARVDEAVAQLRANGLGAEALVLDITDEAAVAAAFDDIVACHGRLDILVNNAGARNR
FT                   NSMAHLDAADLRQMLETNLVAPYALCRHAAQWMQRGGYGRIVNVTSIAGQVARANDVLY
FT                   PATKGGLDALTRAMAADLGRQGITVNAIAPGYFATEPNQTMVADKTVAEWLRNRTSLGR
FT                   WGQPEEVAGAVVFLASPAASYVTGQVLAVDGGYLGHF"
FT   gene            complement(75595..76494)
FT                   /locus_tag="Rmet_5879"
FT   CDS_pept        complement(75595..76494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5879"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5879"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12738"
FT                   /db_xref="GOA:Q1LAT8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT8"
FT                   /protein_id="ABF12738.1"
FT                   /translation="MLSNLSVKHLRAFVALATHRNFTRAAQACHLSQSAFSALIQTLEE
FT                   QAGCRLFERTTRHVDLSTDGRRFEEMARRLLGDFEAAFDDLRDHAERRKGRVAIAALPS
FT                   LAGGDLPPLLASFHQQYPGIALELHDQLADGCIEFVRRGQADFALAPAPAQDADLRVEA
FT                   LVRDSFHLVCPADHPLAGKRRVTPQALAGLPFIQLSRTSSVRQHLDAALHPLKLNGVME
FT                   VEHLATVAALVEAGLGVSVVPALALFQFRREGLAIRPMQMPTLVRDICVVRLKDRGDSA
FT                   AATAMLDCLRAHYRSGRR"
FT   gene            76579..77979
FT                   /locus_tag="Rmet_5880"
FT   CDS_pept        76579..77979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5880"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12739"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT7"
FT                   /protein_id="ABF12739.1"
FT                   /translation="MGSPSFSSSFGNAMTVPLLIGSGAGFSGDRTDAALPVVRTLIAAG
FT                   GPAALIFETLAERTLALAQLARRDDPEHGYEPLLDQLLTPVLGLCLVNDIPIVGNFGAA
FT                   NPRAAARRIGELAVELGLPVPRVAVVEGDDLSHDEGRALLRGIVGDTFPEARFVCANAY
FT                   IGAQGIADALRDGAQVVVCGRVADPALAVGPAMAHFGWAWDDWNRLAAATMAGHLLECG
FT                   AQVSGGYFADPGMKDVPDVHAVGFPIARLDADGGIEIFKAAGTGGCVDLRTVKEQLLYE
FT                   VHDPCAYLTPDVVADIGEVTVAQVGPDRVAVRNIRGHARPDTLKVNLFYQGGWIAEGEI
FT                   SYAGPNAAARARLAADILGKRMKGLGFDVPIRFDLIGVLSVFADDAGEMLARPQPHEAE
FT                   ARDVRLRAALAHEDKAVAQALLREVNALYTCGPAGGGGVRTALRARLNAMSCLAPRSAV
FT                   APRHTLLS"
FT   gene            77992..78336
FT                   /locus_tag="Rmet_5881"
FT   CDS_pept        77992..78336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5881"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5881"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT6"
FT                   /protein_id="ABF12740.1"
FT                   /translation="MTVTTKLYRFAHGRTGDKGDRSNISVIAYDARDFDHLVAHVTEDA
FT                   VRALFAHRHPGAVKRYLVPSIHAMNFVIDGALDGGVNDALNLDTHGKALAFLLLDMPIP
FT                   LPPRFAGGAS"
FT   gene            78379..79365
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5882"
FT   CDS_pept        78379..79365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5882"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5882"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12741"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT5"
FT                   /protein_id="ABF12741.1"
FT                   /translation="MSAFRRPQAPAALLAFATFTCLALPAGSAWAEFPDKPIRFVVPFA
FT                   AGSATDQLARAVGQAVTQEAKVTVVVDNKPGANGFIAAGDVAKAAPDGYTVLITTNTTH
FT                   AANEHLFKKLPYDPVKDYAPLTALGRGGQIMVVNPQVPAKTVGEFIALAKKEPGKLSFG
FT                   SGSSSSRIAGELFQQMAHVELLHVPYKSNPLAITDLLGNQIQMMITDTATGLPQVKSGK
FT                   LRALGVSGKARSPLAPDVPTIDEAGVKGYEMSYWFAAYAPAGTPPAVVGKLNQMLVKAA
FT                   RSETAATFYQSTGTDVFTSSPAELAKFQAQESAKWGRIIKAANIQPE"
FT   gene            79485..80234
FT                   /locus_tag="Rmet_5883"
FT   CDS_pept        79485..80234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5883"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5883"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12742"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT4"
FT                   /protein_id="ABF12742.1"
FT                   /translation="MSQTGKGFRSERRGFLIGVASAALGTVALPASAQSLRGKPRSKIG
FT                   VIGAGHIGGTIGGIWVGVGHPVMFSSRHPEELKPLVEKLGSLAQAGTVDQALAFSNVVL
FT                   LAVPYGALPELGSQHDWKGKIVLDATNAVAPRDGAIVEEVKANGIGVTTAKYLPGARVV
FT                   RVFNFTSAGSFARESNRKGPLMAVPMAGNDAGALIIAGRLVRDAGFQPVVVGGLSSADR
FT                   FAPGGKLFHMEGTEAEFRRAMAQNSAP"
FT   gene            complement(80295..80684)
FT                   /locus_tag="Rmet_5884"
FT   CDS_pept        complement(80295..80684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5884"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5884"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12743"
FT                   /db_xref="GOA:Q1LAT3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT3"
FT                   /protein_id="ABF12743.1"
FT                   /translation="MEIRNPLPADIEAARRLLAANGWEQQVSNPERFAQLIANSQRVAV
FT                   AVEGGEVIGFARALCDDIANGYISMVAVAPQHRRRGVGRALLRHVMGNDPDITWVLRAA
FT                   RSSEAAFFGQLGFTPSMVAMEWRRR"
FT   gene            80911..82401
FT                   /gene="amn"
FT                   /locus_tag="Rmet_5885"
FT   CDS_pept        80911..82401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="Rmet_5885"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5885"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12744"
FT                   /db_xref="GOA:Q1LAT2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT2"
FT                   /protein_id="ABF12744.1"
FT                   /translation="MMPAMNATIFSSAHPADQLAEFNDADSALARIREIYDSSVAAVRA
FT                   RFDAFAQGKPLPSAAHACYPYLGISVNLETMVTDSRPSWGTVAYPGVYGTTVTRPDLLC
FT                   DYYRDQIERLMRYHRVPVVVGLSRRPIPLPFVIEASTTDISYTQARELEASFVLPELSR
FT                   IDDSIANGTYEPTPGEAWPLSLFSAERVDLALQRLYHYTGTAPQHFQRFVLFTNYQRYV
FT                   DEFVTLGRSLMAGDGGDGYVRFVEPGDVIQQLGEQEPDDATRPRALPQMPAYHLVREDG
FT                   LGVTLVNIGVGPSNAKTMTDHLAVLRPHCWLMVGHCGGLRRSQQLGDYVLAHAYVRDDH
FT                   VLDHDLPPWVPVPPIAEIQVALQEAVARVTGLSGTEMKTRMRTGTVVSTDDRNWELKSK
FT                   SLYARFNQSRAIAIDMESAAVAANGFRLRVPYGTLLCVSDKPLHGELKLRGMANAFYRQ
FT                   RVSQHMTIGLEAIRILRENGVEQLHSRKLRSFDEPAFR"
FT   gene            complement(82528..83265)
FT                   /locus_tag="Rmet_5886"
FT   CDS_pept        complement(82528..83265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5886"
FT                   /product="outer membrane protein, OmpW family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5886"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12745"
FT                   /db_xref="GOA:Q1LAT1"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT1"
FT                   /protein_id="ABF12745.1"
FT                   /translation="MLCQGLQGNQGTHWAHIFNVQCFQTMTTTLSPRRKTLVSSICMAL
FT                   TAATIGALSAPAVAADEQQSNWMIRLRGTFLNMDNKSDPVGGVGASDRISVNNKWIPEL
FT                   DVTYFIVPNIAAELVLTIPQKQDVRLDGAKIGTFSHLPPSLLLQYHFIPNGTFRPYVGA
FT                   GVNVTRIWGADIAGNTLGLDRWSVGPALQVGMDYKVTKNWFLNVDVKKIWISSNVYANG
FT                   TGQKVSNVQLNPWLFSAGVGYRF"
FT   gene            complement(83541..85244)
FT                   /gene="leuA1"
FT                   /locus_tag="Rmet_5887"
FT   CDS_pept        complement(83541..85244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA1"
FT                   /locus_tag="Rmet_5887"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5887"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12746"
FT                   /db_xref="GOA:Q1LAT0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAT0"
FT                   /protein_id="ABF12746.1"
FT                   /translation="MPMLQDPSTKYRPATTVDLHDRTWPSRQITRAPRWMSTDLRDGNQ
FT                   ALIEPMNSARKLRFFEQLVKIGLKEIEVAFPSASQTDFDFVRMLIEEDRIPEDVNIVVL
FT                   TQARDDLIRRTVESVRGARRATVHLYNPIAPAWRRIVFNASREEIKEVAVSGTRLIREL
FT                   TDAMPDTAWTYEYSPETFSLAELDFSLEVSDAVSAVWEPDANRPMVLNLPTTVECSTTN
FT                   VFADQVEWMHRRLARREHIVLSVHPHNDRGTAVAAAELAVMAGADRVEGCLFGNGERTG
FT                   NVDLVTLALNLYTQGVDPQLDFSDIDEVRQCVEHCNQLPVHPRHPYVGDLVFTAFSGSH
FT                   QDAIRKGFAQQKDDAIWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGMAYLLEQMHGIY
FT                   MPRRLQIEFSRAVQAMTDETGLEASAADLYALFRREYLDVEAPLRYVSHRMVSASDAAA
FT                   EVEIDIVRDGRPMRMRGTGNGPIDAAVDAFTRGLGVAVRVMDYHEHAMTTGADANAACY
FT                   VEVRVAGSITGFGAGVDPSIVTASLKAVVSGINRHLQTRDMSEAVEARAA"
FT   gene            complement(85347..85496)
FT                   /locus_tag="Rmet_6611"
FT   CDS_pept        complement(85347..85496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6611"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45210"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY40"
FT                   /protein_id="ADC45210.1"
FT                   /translation="MTATALNLRHAADASRIDAAVRACVAGLLSCRALGASSLLLSLPI
FT                   GCRA"
FT   gene            85769..87154
FT                   /locus_tag="Rmet_5888"
FT   CDS_pept        85769..87154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5888"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5888"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12747"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS9"
FT                   /protein_id="ABF12747.1"
FT                   /translation="MRTRTWTTWLACAAIAMLMVACGGGGGSSGSGSAPSGGAGSGGSA
FT                   GSGGSGAVATSYTLVLNQTSGKVAVGDTMPLTASVVDNLGNDVTGSTTFAWSTINSSIA
FT                   VVANASVPGGAVVTGVGLGIANISVVATVTGANNATTVLPQASTTITVVAPGSRTYSLA
FT                   LPYPSLSMTDGQTLRVTASLIDSDGADRSASATGWTWRSTTSAVQAAGVANVGVLLGVN
FT                   GGSTVALSVVSVQVTAPDGSTLTGAFPVSVFPTGVSSFRLVLSQNGSQINALNVLNGFP
FT                   QTYLSQVVRSDGNDSTPDFTGLWTFTTTSPSLLVLPDSSTRLTTVSTGRPNGASPLQSI
FT                   LSEMASSLTLSAKPRATLFVTEQPTWALVYNGPQPLVVNRLAGATVAVQLMHRGVDEGI
FT                   TGCGTSWAWSTTSSNIVVAQSVLAPNSASILPTAAGPFSVTATCTAGVEAMPLSITIPG
FT                   TAQ"
FT   gene            complement(87129..87431)
FT                   /locus_tag="Rmet_6612"
FT   CDS_pept        complement(87129..87431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6612"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45211"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY41"
FT                   /protein_id="ADC45211.1"
FT                   /translation="MMPDDGDLKGSPFSFAGTRVTLAEMGTLWSVRTPLPRRRRGVGGV
FT                   GVQALPAALSQFEALFPLTRPLSRKRERGANQGGKRTQKRVRTSQECVTVPCPES"
FT   gene            complement(87447..87767)
FT                   /locus_tag="Rmet_5889"
FT   CDS_pept        complement(87447..87767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5889"
FT                   /product="conserved hypothetical protein; putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5889"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12748"
FT                   /db_xref="GOA:Q1LAS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS8"
FT                   /protein_id="ABF12748.1"
FT                   /translation="MTFYQAFETLVVPLIVLACAVHVVGRYMPRTRERVKASLAAGLGG
FT                   ASASGWRGWVARRLAPREAAGCATGCDTNSGCSTCGSNTSTKSTESGGASNEHIVRFVR
FT                   KS"
FT   gene            complement(87783..89645)
FT                   /gene="feoB"
FT                   /locus_tag="Rmet_5890"
FT   CDS_pept        complement(87783..89645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="Rmet_5890"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5890"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12749"
FT                   /db_xref="GOA:Q1LAS7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS7"
FT                   /protein_id="ABF12749.1"
FT                   /translation="MSVAQNPTAALRIALVGNPNCGKTALFNRLTGSRQKVANYAGVTV
FT                   ERKEGQFVSPGGRTVRILDLPGAYSLDSASLDEAITREVCLGQRPGETRPDLIVSVVAA
FT                   TNLRLHLRFVLELRRLGVPMVVVLNMSDAAERRGIKIDREALSRELGVPVVQTVAVKHD
FT                   GAASLIKLFDDTLPPAPQAQPLDSVSELDTHAEVKRLLDVAVNMPTRTAQFEDKLDVVV
FT                   LHPVFGLAILAVLLFFMFQAVFSWATPLMDGIEAGVHWFGELVGTTMPDGMLKSLIVDG
FT                   IIAGVGSVIVFLPQILFLFLFILTLEESGYLPRAAFLLDRLMMSAGLSGRSFIPLLSSF
FT                   ACAIPGIMATRTIQDPRDRLTTILVAPLMTCSARLPVYALLIAAFIPERTVAGLFNLQG
FT                   LVLFVLYVAGIVSALLVAYVLKWFRRDHTEHPLLMELPAYRVPNPRDIAIGLWERARIF
FT                   LSRVGRVILTMTVLLWFLATFPSPPEGATMPAIDYSFAGMIGRALEHVFAPIGFNWQIC
FT                   IALVPGMAAREVAVGALGTVYALSGSDDAVATQLAPMIAAQWPLATALSLLAWYVFAPQ
FT                   CISTLAVIRRETNSWKVMAASVAYLGGLAYLASFITYRVALMFS"
FT   gene            complement(89669..89971)
FT                   /gene="feoA"
FT                   /locus_tag="Rmet_5891"
FT   CDS_pept        complement(89669..89971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="Rmet_5891"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5891"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12750"
FT                   /db_xref="GOA:Q1LAS6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS6"
FT                   /protein_id="ABF12750.1"
FT                   /translation="MRLSELPRRTAAVVKSVDDEFTHDPIARRLRDLGFVPGETVQIIA
FT                   FGPFGKDPLVAQVGYSRFALRRSEAARITVEVASATVTSIAPAGETEAPPSQRIA"
FT   gene            complement(90310..91203)
FT                   /locus_tag="Rmet_5892"
FT   CDS_pept        complement(90310..91203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5892"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5892"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12751"
FT                   /db_xref="GOA:Q1LAS5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS5"
FT                   /protein_id="ABF12751.1"
FT                   /translation="MEFRHLRYFLVLAEELHFGRAARRLSISQPPLSLNIQQLEASVGA
FT                   RLFERDSRGVRLTAAGRAFRESAMALLAQAEEARLLAREIEAGAVGRLRVGFVGSMLYR
FT                   GLPQRLKEFQARYPGIHVALTELNSQEQIDALLHGELDAGFVHTSRVPDELATTLAHRE
FT                   PFVCCMPAKHPLGQQNTVALTDLRGEPFVLFSRKASPDYYSRIFDMCAAHGFYPQIRHE
FT                   VRHWLSVVSLVSQGMGIAVVPAAMARSGMAGAAFRPLADATVPSEVYCVWKQAPDHPAR
FT                   DHFVEMVRLAASVADI"
FT   gene            91347..93143
FT                   /locus_tag="Rmet_5893"
FT   CDS_pept        91347..93143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5893"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5893"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12752"
FT                   /db_xref="GOA:Q1LAS4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS4"
FT                   /protein_id="ABF12752.1"
FT                   /translation="MPTSAARPAASTTAYPEVAAHPVPDRHGASLFTADPDLRALLPLY
FT                   LPADLFNHLLPHLERMGALAGGVLDELANEADHAPPTLSHRIRTGLDAQRIHKHPSYVE
FT                   LERVAFSEFGLAAASHRGGVLGWDKPMPPAAKYALTYLFVQAEFGLCCPLSMTDSLTRT
FT                   LRKFGDPALVDRFLPNLTTQVFDDLYQGAMFMTEQGAGSDVAATTTRAIRDGNAEGGWR
FT                   LVGDKWFCSNPDAALAMVLARVEEADGSAVAGIKGVSLFLLPRTLADGSANHFRIIRLK
FT                   DKLGTRSMASGEIRLEGAHAYMVGELGRGFVQMADMINNSRLSNGVRAAGLMRRALTEG
FT                   QFIARERRAFGKRLADMPLMRRQLLKLTLPTEQARTMVFQTAEALRRADAGDADAYPLM
FT                   RILTPLIKFRACRDARKVTGDAMEIRGGCGYIEEWSDPRLVRDAHLGSIWEGTSNIVAL
FT                   DVLRAIRREGSLPVLQAHLQALLGDTPMHATARATFDLALANTVALATRAAEAGADGDV
FT                   LARQAASALYHVTSAVAMAWEAGQIGSVRRMRLAQLVLVHRVLPQDPLGGGVEPEWLAE
FT                   TVEPPADGVVRAAGPVDQINVF"
FT   gene            93175..94251
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5894"
FT   CDS_pept        93175..94251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_5894"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5894"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12753"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS3"
FT                   /protein_id="ABF12753.1"
FT                   /translation="MRPQRRTSRARGAHSKHKKLYRRQHIMPQWHRRAALAALTSLVAC
FT                   TFTLTTTPAFAQKEFPSKPIMLVVTYPPGGPTDAMARTLAAALKNSLGQPVVVENRAGA
FT                   GGNIGAEVVARAEPDGYTLMFGTSAPLAINVSLYRKINYDPVKSFAPVIQIGQLPNALV
FT                   VNPSVPAKNVQELIAYSKAHPGKLSYASSGNGASSHLAGVLFNNLAGTDFQHVPYKGTG
FT                   PALNDLLGGQVSMTFTDVLTALPFIKSGKVRALGVTTKGRSQALPDVPTVAEQGVAGFD
FT                   VSVFFGVVAPAGTPPEVIRKLNHAFADALAQPDVRKTLLAQGLEFAPATTPEQLGGFVK
FT                   SEVGKWRSVVQKSGAQLD"
FT   gene            94275..95414
FT                   /locus_tag="Rmet_5895"
FT   CDS_pept        94275..95414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5895"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5895"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12754"
FT                   /db_xref="GOA:Q1LAS2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS2"
FT                   /protein_id="ABF12754.1"
FT                   /translation="MTPLTPGALAGIRVVDLSRILGGPLCGQILGDHGADVLKIEPPQG
FT                   DDTRTWGPPFRDGVASYYFGLNRNKRIMKLDLTADTDREVLLTLLADADVLIENFKTGT
FT                   LEKWGLGFDVLSQRFPRLVHCRVSGFGADGPLGGLPGYDAAIQAMAGIMSINGEADREP
FT                   LRVGLPVVDMVTGLNAALGVLLALQERERSGRGQFVESALYDSGLSLLHPHAANWFMSG
FT                   KTPGRTGNAHPNIYPYDTVATATDPIFLAVGNDRQFRILCEYLGVAELADDERFATAGA
FT                   RSVNRAQLKGTLESKLATWDGKALADELSAAGVPCAPVLSVPDALTHPHTAHREMVVEM
FT                   PGGYKGLGAPVKLSRTPATYRYAPLTEGNQFLPREAAND"
FT   gene            complement(95489..97189)
FT                   /locus_tag="Rmet_5896"
FT   CDS_pept        complement(95489..97189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5896"
FT                   /product="glycolate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5896"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12755"
FT                   /db_xref="GOA:Q1LAS1"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS1"
FT                   /protein_id="ABF12755.1"
FT                   /translation="MQPWTQIYTPLGSLWLSALAAAIPILFFFVALAVLRMKGHVAAAV
FT                   TLALALAVAIFAYGMPAQQAFAAAGFGFAYGLWPIAWIIVTAVFLYKIVVKTGQFDVIR
FT                   ASVLSITDDQRLQMLLIGFAFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIA
FT                   NTAPVAFGAMGIPIIVAGQVTGIDPMHIGAMAGRQLPLLSLAVPFWLVFMMDGAKGVRE
FT                   TWPAALVVGGSFAVTQYFTSNHIGPELPDITSALVSLISLAAFLRVWQPRSASQAAGGT
FT                   VAAGGTVAMAGFGGGMGAPASRKASPYTFGQTVRAWAPFGILTAIVTVWSLAPFKALFA
FT                   GNGALAGTVLKFKVPMLDQLVIKSAPIVASPKPYEAVLKLDLLSAVGTAILLTAIISAV
FT                   LLRMKPSDAITTFKETLLELRRPIASIGLVLAFAFVANYSGMSSTLALLLAGTGAAFPF
FT                   FSPLLGWLGVFLTGSDTSSNALFCSLQHTTAHQIGVSDTLLVAANTTGGVTGKMISPQS
FT                   IAVACAATGLVGKESELFRFTVKHSLLFAAIVGVITMIQAYWLTGMIPG"
FT   gene            complement(97248..98693)
FT                   /locus_tag="Rmet_5897"
FT   CDS_pept        complement(97248..98693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5897"
FT                   /product="Iron-sulfur cluster binding protein; putative
FT                   oxidoreductase subunit with NAD(P)-binding domain and
FT                   ferridoxin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5897"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12756"
FT                   /db_xref="GOA:Q1LAS0"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAS0"
FT                   /protein_id="ABF12756.1"
FT                   /translation="MSQQPLHFVPTEDFRARARAALDDPKLRKSFRGAMDFLQQKRAVQ
FT                   FPDGDELEHLRDLGEAIRQHALANLPDLLVELEGNLTAAGVQVHWAETADEANAIILRI
FT                   AQGHAARRVIKGKSMASEEMELNHYLAERGIDCIESDMGEYIVQLAGEKPSHIVMPAIH
FT                   KTKADIATLFEQHIPDTPYTEDVDALIQTGRRALRQAFVEADIGLSGVNFAAADTGTLW
FT                   LVENEGNGRLSTTVPDVHIAVMGMEKVVAKLSHIVPLSSLLTRSATGQPITTYFNLISS
FT                   PRKPHEQDGPREVHLVLLDNGRSQAYADEQLRATLQCIRCGACMNHCPVYTRIGGHAYG
FT                   TTYPGPIGKIISPHLLGLDATADLATASSLCGACGEVCPVRIPIPQLLVRLRTEANRNP
FT                   DEAVPHPLKGQGAKFSRREHLVWRFWSGAFAHPTTYRLFRWAATRLRALTPSRQMGWTQ
FT                   HRKPLTPAPKSLSDLLDARNQPE"
FT   gene            complement(98690..99400)
FT                   /locus_tag="Rmet_5898"
FT   CDS_pept        complement(98690..99400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5898"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5898"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12757"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR9"
FT                   /protein_id="ABF12757.1"
FT                   /translation="MTTMSARERMIGRLRAAAPASGATLSGDTQKLDRRIDDHFDSRRG
FT                   QAPSIDAMVASMQAALTASHADVICTDAASWPAWVARRLADEGVRRLLLDRDRPEGAAL
FT                   ARALPSSIDTVTFDRPLEAWKAELFDTVDAGFTVARSGLAATGTLVLAPDAGSPRTMSL
FT                   VPPTHIALVYASALHPDLHAAARAERWLDGMPTNLVMVSGPSKTSDIQQTLAYGAHGPR
FT                   RLWVVIVTDGEAAR"
FT   gene            complement(99397..100182)
FT                   /locus_tag="Rmet_5899"
FT   CDS_pept        complement(99397..100182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5899"
FT                   /product="conserved hypothetical protein; cysteine-rich
FT                   region; putative hydroxyacid oxidoreductase (Fe-S centre)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5899"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12758"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR8"
FT                   /protein_id="ABF12758.1"
FT                   /translation="MESRQYPTTAPQQVYLFGTCLVDLFVPQAGLDAVRLLEREGLTVH
FT                   FPRGQSCCGQPAYSSGNPEQARKVARAQLDLFREPWPIIVPSGSCAGMMRHHWPTLFAD
FT                   DPSDPDAAALARDIASRVYELAEFLLNVLHVRFDATPADAPHERVVLHTSCAARREMGT
FT                   RAHGVALLDALPGVTRVEHEHESECCGFGGTFSLKHADISGAMVRDKVASACATGCDRL
FT                   VSADCGCLLNIGHAAAHTGAPLPVEHLASFLWRRTGGAE"
FT   gene            100320..101018
FT                   /locus_tag="Rmet_5900"
FT   CDS_pept        100320..101018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5900"
FT                   /product="transcriptional regulator, GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5900"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12759"
FT                   /db_xref="GOA:Q1LAR7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR7"
FT                   /protein_id="ABF12759.1"
FT                   /translation="MGAGNARNRVEDIMRRMETALLDGTWPVGTRLPAERVLAEQFGVA
FT                   RNTIREAIQRLAARNLLQSRRGAGVYVTDQLRTGIASPWGQLVADHPALRDDILEFRRV
FT                   LEGATAYFAALRADAADLKRIRALLKELERSRMTDDKRAEADADAKLHDAIAQASHNTM
FT                   FLHLHTSVIGMLREHITINGTGLREADDESSDLLLRQHRTLCEAILARRPEEARTAMQT
FT                   HIDFVRSKVD"
FT   gene            complement(101090..102184)
FT                   /locus_tag="Rmet_5901"
FT   CDS_pept        complement(101090..102184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5901"
FT                   /product="conserved hypothetical protein; putative
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5901"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12760"
FT                   /db_xref="GOA:Q1LAR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR6"
FT                   /protein_id="ABF12760.1"
FT                   /translation="MPQLDNELDTEQTEDRAGTGSTEQPDQTRPLTPAAWFSVKTVSYV
FT                   LTAGALLLVMHANLVSALLAGLLLYSLVDVLAPRLMRLHSRRDAIAVAILSTIILLVLT
FT                   GSIWALIRFISGDGNTLDRLLDHSADIIDRSRAQLPAWLSDYLPNGVDELATTLISALR
FT                   EHAQMAQRLGADILRTLVHILVGLIIGAMIALYRAISRPNRRPLALALVDRARTLQTAF
FT                   SQFIFAQIQISLVNTILTAIYLLVLLPLFHQHLPLSKTLVAITFIAGLLPVLGNLISNT
FT                   AIVIASLSVSLPIAVVSLLFLVLIHKLEYFLNARIIGARIHAAAWELLTVMLVMETLYG
FT                   IPGVIAGPIFYAYVKRELSTAGLV"
FT   gene            102387..103769
FT                   /gene="eutB"
FT                   /locus_tag="Rmet_5902"
FT   CDS_pept        102387..103769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="Rmet_5902"
FT                   /product="ethanolamine ammonia-lyase, large subunit, heavy
FT                   chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5902"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12761"
FT                   /db_xref="GOA:Q1LAR5"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR5"
FT                   /protein_id="ABF12761.1"
FT                   /translation="MAFTHTVGVRRHVFDDLRTLLAKASPARSGDALAGIAAASEEERM
FT                   AARMALADMPLAHCLAEPLVPYEADEVTRLIVDSHDAQAFAALASLTVGEFRDWLLRHD
FT                   TDTATLARVAPGVTPEMAAAVSKLMRNQDLVAVARKCAVVTAFRNTIGLPGRLSVRLQP
FT                   NHPTDDPRGIAASIIDGLLFGCGDATIGINPASDNLGAITTLLKLLDDIRIRYEIPTQS
FT                   CVLTHVTNTLRVMELGAPVDLVFQSVAGSQAANAAFGISLALLEEARQAALSLRRGTVG
FT                   HNVMYFETGQGSALSANAHHGVDQQTMEARAYAVARRFEPLLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDVCYTNHAEADQDDMDNLLTLFGVAGINFIMGVPGAD
FT                   DIMLNYQSTSFHDALYLREVLGLRPAPEFEAWLRKMGIVDAGGRLLEPGTRQALLTMAD
FT                   TL"
FT   gene            103787..104557
FT                   /gene="eutC"
FT                   /locus_tag="Rmet_5903"
FT   CDS_pept        103787..104557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="Rmet_5903"
FT                   /product="ethanolamine ammonia-lyase, small subunit (light
FT                   chain)"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5903"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12762"
FT                   /db_xref="GOA:Q1LAR4"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR4"
FT                   /protein_id="ABF12762.1"
FT                   /translation="MSTPANPEDPWARLRQFTRARIAIGRTGHAQKTASILAFGLAHAQ
FT                   ARDAVHLALDVAALETALRDAGLDALHVLHAHGAAADRDQYLRRPDLGRSLDAESRARL
FT                   VPSAQPYDVVFVIADGLSALAAQRHAVPLLQAVLARLHDWRVGPVVVARQSRVALGDEI
FT                   GERLGARQVVMLIGERPGLSSPDSLGIYLTFDPRVGRTDAQRNCISNVRPEGLSYAQAA
FT                   DRLVFLMQGAVALGRSGVDLKDDSAAVSAALSPP"
FT   gene            complement(104576..105049)
FT                   /locus_tag="Rmet_5904"
FT   CDS_pept        complement(104576..105049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5904"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5904"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12763"
FT                   /db_xref="GOA:Q1LAR3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR3"
FT                   /protein_id="ABF12763.1"
FT                   /translation="MAMAGTLAGRLSRMNSQFDIIRHPYSLSSMATAQAAHVPGNRLAK
FT                   TLLLEDEGGYVAVVIPSSHHLQMSTICEMTGRKLVLAHEDEIREVFKDCDLGAIPPCAM
FT                   SYGMQTYVDESLFDEPEVWFEAGDHMELVHMQRDQFMTLMSDAESGKFSHRMM"
FT   gene            complement(105084..106037)
FT                   /locus_tag="Rmet_5905"
FT   CDS_pept        complement(105084..106037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5905"
FT                   /product="transcriptional regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5905"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12764"
FT                   /db_xref="GOA:Q1LAR2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR2"
FT                   /protein_id="ABF12764.1"
FT                   /translation="MDLNALRLFVDIVDAGNLSAAARKLKMTRANVSYHLKALEEELGV
FT                   QLLRRTTRHVEPTPVGAGLYEHGKNILGEVAAANALISSMGKSLQGHVRLSVPTGLGHT
FT                   MISPLLVRFKQRYPDITLDVVFDNRIHNLVSEDVEVALRIISTPPDSVVATEIGGVDWL
FT                   LCAAPSYLAGRTPPAHLADLTTHAIVCASPIGQKLKVSGTRDGTADREQVVLEPTLSSE
FT                   NFAFLKEAVVGGLGIGIFPLYAVDKELASGALESLLGDYQISAFGSKLYMLTMPNRYQT
FT                   MATRYLLTFLRTELQAIWPRIRAGGADSAYSENTQD"
FT   gene            complement(106122..107435)
FT                   /gene="kgtP"
FT                   /locus_tag="Rmet_5906"
FT   CDS_pept        complement(106122..107435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgtP"
FT                   /locus_tag="Rmet_5906"
FT                   /product="alpha-ketoglutarate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5906"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12765"
FT                   /db_xref="GOA:Q1LAR1"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR1"
FT                   /protein_id="ABF12765.1"
FT                   /translation="MTDTASSVTTGTAPSPEEVKKRIFAIVAASSGNLVEWFDFYVYAF
FT                   SAIYFASSFFPKADPTAQLLNTAGVFAAGFLMRPIGGWLFGRIADRTGRKHSMVISVTM
FT                   MCFGSLMIACLPTYAAIGNLAPALLLLARLLQGLSVGGEYGTTATYMSEVALKGRRGFF
FT                   SSFQYVTLIGGQLLAVLVIVILEQLLTEAELKAWGWRIPFVVGAVTAVVALLLRRTLHE
FT                   TTTAQSRNSKGAGTVGELFRHHKAAFFTVLGYTAGGSLIFYTFTTYMQKYLVNTAGMPI
FT                   KTASYVMTGCLFLYMCMQPLFGMLSDRIGRRNNMLMFGALGAVATVPILTALKTVSSPE
FT                   MALLLICVALAIVSFYTSISGIVKAEMFPPEVRALGVGLAYAVANAIFGGSAEYVALGL
FT                   KSIGHESAFYWYVTAMMVVAFLVSLRLPRQAKYLHHEH"
FT   gene            107833..108156
FT                   /locus_tag="Rmet_5907"
FT   CDS_pept        107833..108156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5907"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5907"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12766"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAR0"
FT                   /protein_id="ABF12766.1"
FT                   /translation="MPVLRYLLILLPQLLLMPLIAQAEPDLVQCQRVDQSQLRSASEET
FT                   LLFLRCRAREISYEAPRLKGVTQKFKDDLVFSCLDQADAVEHQLRVGYGYTRETLAKKK
FT                   CDR"
FT   gene            108283..109440
FT                   /locus_tag="Rmet_5908"
FT   CDS_pept        108283..109440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5908"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5908"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12767"
FT                   /db_xref="GOA:Q1LAQ9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ9"
FT                   /protein_id="ABF12767.1"
FT                   /translation="MALDAESFSLLRASVQRFIDDRLKPAEDTLEEIDDVPADIVADMK
FT                   EMGLFGISIPESYGGIGLSMSQECDVVYDLGHTAFAFRSVFGTNVGIGSQGILMDGTEE
FT                   QKQTYLPKIASGELIISFALTEPNAGSDAASLQTRADLDGDHYVINGTKRFITNAPRAG
FT                   AFTLMARTGGQGASGISSFIVPADTPGISLGKPDKKMGQRGTKTCDVVLENVRVPAANI
FT                   IGGVPGVGFKTAMKVLDRGRLHISALACGMAHRLITDAVAYAKERKQFGKPIGDFQLIQ
FT                   GMLADSQAELYAGLSMVRDCAQRYDAKPAGKSDPEVSMLASCTKMFCTEMVGRVADRAV
FT                   QIHGGAGYIAEYKAERFYRDVRLLRLYEGTTQIQQLIIAKQLLRD"
FT   gene            109501..110076
FT                   /locus_tag="Rmet_5909"
FT   CDS_pept        109501..110076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5909"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5909"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12768"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ8"
FT                   /protein_id="ABF12768.1"
FT                   /translation="MSRFQVTASQGPVTAGQQSKVSQDDLHAVHRLRAVVATYRTTLQA
FT                   YTLVVSPDELMSLSRGPEPSHSARDYRAQAHLDRLLNSVRDSGLALPSAIVVAVSGGRM
FT                   QCECDHLYTLEMHPRDGDHLIVLDGYDRLAALASTGRGNIKTLVTGVLCCTAIDGAAVE
FT                   SQSANEADRAMMHTSAAARWAGAMRVWQ"
FT   gene            109956..110264
FT                   /locus_tag="Rmet_6613"
FT   CDS_pept        109956..110264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6613"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45212"
FT                   /db_xref="GOA:D3DY42"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY42"
FT                   /protein_id="ADC45212.1"
FT                   /translation="MLHGHRRRGSRVPVGQRSGSRDDAHLRSRPLGRRDARLAITPAVV
FT                   IAVATAFAIALSDAATVHDAAILVVTGEIAGNAIATITTTTAGAGLNLSRPHAVHIA"
FT   gene            complement(110235..110606)
FT                   /locus_tag="Rmet_5910"
FT   CDS_pept        complement(110235..110606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5910"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12769"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ7"
FT                   /protein_id="ABF12769.1"
FT                   /translation="MSIVRAGSKAEALRLLASERMLALELDYETGWQDAVELGRLGEKR
FT                   GIKVQYRGQESIAVRSHDALIEGLGKPKTTFRQRNLYCQFDLGTMAGQHLLELEAKASR
FT                   LGDYILAGHLLRDVDGVWA"
FT   gene            110566..110649
FT                   /locus_tag="Rmet_6614"
FT   CDS_pept        110566..110649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6614"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45213"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY43"
FT                   /protein_id="ADC45213.1"
FT                   /translation="MSASALLPARTIDIHTSSLNNHCINIQ"
FT   gene            complement(110712..113585)
FT                   /locus_tag="Rmet_5911"
FT   CDS_pept        complement(110712..113585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5911"
FT                   /product="peptidase M16-like protein, possible
FT                   Zn-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5911"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12770"
FT                   /db_xref="GOA:Q1LAQ6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ6"
FT                   /protein_id="ABF12770.1"
FT                   /translation="MRRLVTSFAASFVTGAACFILAGLSALPVPAFAARPSSVAPPPPA
FT                   APVIRAERVAAVEGITEYRLPNGLRILLAPDDAQPTTTVNMTYLVGSRHENYGETGMAH
FT                   LLEHLMFKGTPSLPGRTIPTEFARRGMQFNGTTAQDRTNYFETFAASDDNLDWALRMEA
FT                   DRMVNSFISRADLDKEMTVVRNEMEIGENNPMRMLQQQMYAAAYRWHNYAKAPIGARSD
FT                   VERVGIQNLQAFYRRYYQPDNAVLVVAGQFDPVRALSRIEQAFGPIPRPTRVLPTEHTV
FT                   EPPQEGARELTLTRPGDSSIVAAMYHVAPGAHPDTTALALLTVILADTPGGRLEHALVD
FT                   TRKAAWQMSMFDAMKDPGVILFAAGTGKDRPIEPVRAALLAEIEGLAAKPVTQDELDRA
FT                   RVRMRNAYEKILNDPARYGVALSESIAKGDWRLLFIARDRVETTTLEDVQRVAENYLRQ
FT                   TNRTVGEFLPGDKPQLATIPQSPDVAALVRDYAGKAVAQAVPTFDPSPANIDAHTVRQT
FT                   LPNGMELALLSKPTRGEAVNGTLVLHLGNTQSLQGKTAIGSLTAGMLDRGAGVFSRQQI
FT                   ADRFEALKANVSISGSSERLTVRFETHRAYLPDLLDLLRTVLRMPTFPSAELETLRASS
FT                   IAGVDSQRRQPNALAPNALGRHGNPYPAEDPRYTPTFDESVASLRGVTQADLREFHAQF
FT                   YGADHAQLAIVGDFDAADAAKQIQFLFGDWRAQVPFERVDRPFIAIPAASFTLDTPGKA
FT                   NAVYLASQPVDLLNDSPDYPLMLIAARVLGGTGMRSRLADRLRQQEGISYGVSSSLSIG
FT                   ALDRAGRFALWAVYAPQNQTRLRDAVGQEMQRFVRDGITSVELSEAVSGLLQQGLISRT
FT                   RDGLLAGALANQLYLGRTMAHTAEVEARISKATPEAVNDAIRRYLSPDTLTQAFAGDFG
FT                   SGAGTPAATAAEPATAPAAAPAEPARP"
FT   gene            113774..115276
FT                   /locus_tag="Rmet_5912"
FT   CDS_pept        113774..115276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5912"
FT                   /product="Transcriptional regulator Ada /
FT                   DNA-3-methyladenine glycosylase II /
FT                   DNA-O6-methylguanine--protein-cysteine S-methyltransferase"
FT                   /EC_number="3.2.2.21"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5912"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12771"
FT                   /db_xref="GOA:Q1LAQ5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ5"
FT                   /protein_id="ABF12771.1"
FT                   /translation="MELDPDTCYKAVASHDRRFDGRFFVGVSSTGVYCRPICAVRTPKR
FT                   ENCTFYETAAAAEKHGFRPCLRCRPELAPGHGLADISGRLAQAAATLIDEGFMAGAGVA
FT                   QLAARIGVTERHLRRLFDAEFGVSVHEYAQTQKLLLAKRLLTDTALPVTEVALAAGFGS
FT                   VRRFNDVLKERYGLTPLAMRKRAADGMADRLVFELGYRPPMAWGALLGFLAVRAVDGIE
FT                   QCDGEVYSRTLSIEAGGRCHAGCVRLEHVARRAVLRITLSGALAPVIPQALGKVRRLCD
FT                   LGCRPDIVDAHLGELAARTPGMRLPGAFDGFEIGVRAIVGQVIPVVQARRILARLAQVA
FT                   GEPLPEAAQAGLTTPAGQAPLTHAFPTAQALAALPDEAYRAAGVTAAKTRTIRALARSV
FT                   AAHEIDLDPHAPPEVTVAQLRAIDGIGDWTAQYVAMRALGWPDAFPGTDYALRKVLGVD
FT                   TVRGMQAKTAGWAPWRAYAAIHLWHRYEALKLQGSDIEEQAA"
FT   gene            115273..115821
FT                   /gene="ogt3"
FT                   /locus_tag="Rmet_5913"
FT   CDS_pept        115273..115821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt3"
FT                   /locus_tag="Rmet_5913"
FT                   /product="Methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5913"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12772"
FT                   /db_xref="GOA:Q1LAQ4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ4"
FT                   /protein_id="ABF12772.1"
FT                   /translation="MSSHHIIDSPLGDMLLRADGGALTGVFFAGQKYYPGLARPTPVSA
FT                   MPAADARVLEQAAMELGAYFDGALHGFSVPFRLVGSAFQQRIWQALCDIEFGETSTYGQ
FT                   LGAGLGLPPSHSRAVGGAVGRNPLSIIVPCHRVLGASGDLTGYAGGVDRKRALLTLEGV
FT                   LYPGQLQATALGQAALALD"
FT   gene            115839..116405
FT                   /gene="ligT"
FT                   /locus_tag="Rmet_5914"
FT   CDS_pept        115839..116405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="Rmet_5914"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5914"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12773"
FT                   /db_xref="GOA:Q1LAQ3"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ3"
FT                   /protein_id="ABF12773.1"
FT                   /translation="MARLFVAIQPPAALVADLLRIVPAQHGIRPTMAAQLHLTLRFLGE
FT                   QDDPTAVRIERVLSEVAAPSVVLQVKGVGRFRGRQGAILWAGLEASAPMQALVDAITAA
FT                   LEREGIPPERRRFWPHLTLARCRPEVPEHVLRDWLAARRALSLPACTIDRFVLFESVLD
FT                   RQGARHVARAVYPLVANGPDRCPQR"
FT   gene            complement(116538..117152)
FT                   /locus_tag="Rmet_5915"
FT   CDS_pept        complement(116538..117152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5915"
FT                   /product="transporter, LysE-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5915"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12774"
FT                   /db_xref="GOA:Q1LAQ2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ2"
FT                   /protein_id="ABF12774.1"
FT                   /translation="MTPLAELLAVAAITLLAVISPGPDFAMVTRNSYLFGRRTGLLCAL
FT                   GIALGVQVHVAYTMFGVSLLVRHAHGLLSIIKLAGAAYLIWIGIQTLRNRKALDVDADG
FT                   APAVSGLVAFRMGFLTNALNPKTTLFVVSTYSQVVNAHTPAAVQFGYGLFMSATHWVWF
FT                   SIVAWCFGSKSLRATMLRYQRQLDVIIGTALFGLGVALGVR"
FT   gene            117300..118160
FT                   /locus_tag="Rmet_5916"
FT   CDS_pept        117300..118160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5916"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5916"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12775"
FT                   /db_xref="GOA:Q1LAQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ1"
FT                   /protein_id="ABF12775.1"
FT                   /translation="MHWLGWIRFFEAAARHQNFARAADELHLTHGAISRQIRQLEAELG
FT                   VSLFERRNRAVFLTEAGRTLQSAATQSMDLLAAAVERIRKPAANTALVLSCEPTIAMRW
FT                   LIPRLARFSARHPDIPLHLMAAGGAIDFARSGVDVALRRNDFPFDTRWHTREVTPERVG
FT                   PVCRPDLADHGLDAMPWLHTRTRPDAWQRWARSAGYVLTGSTDVWYEHFYLSLQAASAG
FT                   LGWAIASELMAYDELSDGRMAAPRGFVADGSAYHLLSPVPFEHDSRRLALFDWLHAEAN
FT                   ASSQA"
FT   gene            118407..119201
FT                   /locus_tag="Rmet_5917"
FT   CDS_pept        118407..119201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5917"
FT                   /product="putative YcgR-like protein; putative protein
FT                   involved in flagellar function"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5917"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12776"
FT                   /db_xref="GOA:Q1LAQ0"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAQ0"
FT                   /protein_id="ABF12776.1"
FT                   /translation="MSLQEPIGSKLAQSQSQVDGEADERDAAAQSDERYRLTHSSQIGT
FT                   VLRDMAWQKCLLNVRSKGGSEIVTSILHVDPANKTFIFDWCRADGERQALMSSEQNAFS
FT                   GLLRGVPVNFIVGTPGATRFEGGPAFIADFPEKLYHFQRRRHFRARTLLTKGYRCELRI
FT                   PETEKQALQLDIADLSLSGVGLRSRAVGADQLPVGTVIKRCLLDFAELGRLELDMQVVG
FT                   HWLVGFDDNTVHHYGCAFLNPDGRMENFLQRLVFQLELAHRG"
FT   gene            complement(119260..120156)
FT                   /locus_tag="Rmet_5918"
FT   CDS_pept        complement(119260..120156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5918"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5918"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12777"
FT                   /db_xref="GOA:Q1LAP9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP9"
FT                   /protein_id="ABF12777.1"
FT                   /translation="MRDYRTLPRTVLSAMDAPSPSPISLKPAQADTVRAAKPPADILGS
FT                   FAGDPNFMLSLARGLTVLEAFSERKRPLTISQVAQRTQLSRASVRRCLYTLEQLGYVSQ
FT                   QDGHFALRPRVLHLGHAFFSSSAIVSLAQPVLDSLSARVHETSALAILDGTDILYLVRS
FT                   EVQRVLTHSLGMGSRLPAYCTSTGRLLLAHQPQPILEAFFDHAELRPRTLLTKISRPEL
FT                   EAAFQRARDMDYVLIDEELEPGLRAIAVPVRSQAGVVLAAISVSVKANKVSEGEMIARL
FT                   LGPMREAAAAIGKMIGN"
FT   gene            complement(120410..122662)
FT                   /locus_tag="Rmet_5919"
FT   CDS_pept        complement(120410..122662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5919"
FT                   /product="conserved hypothetical protein; putative esterase
FT                   of the alpha-beta hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5919"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12778"
FT                   /db_xref="GOA:Q1LAP8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP8"
FT                   /protein_id="ABF12778.1"
FT                   /translation="MSSAMRHASALLRCAAWLAVLCSGAIAGPSALAAEPAAASAPQGR
FT                   PKICLVLSGGGARGAAHIGVLKVLEELRVPIDCIAGTSMGSIVGGAYATGMSTSDMEKL
FT                   VGGLTTGTIFNERPPRQDLAIRRKIDDHTNLFTPEIGVRSDGLLLPKGAVSGVQLETVL
FT                   RQLANAPGYRNFDTLPIPYRAVATDLVAGTPVVFSQGELANVMRASMSVPGAVAPTEYE
FT                   GKLLVDGGLTDNLPVDVARAMGADIIIAVNLGTPLMKREELTSIIGVTGQMLNILTEQN
FT                   VRTSLASLRPTDILIKPELGDFSAGDFDHLPKTIPIGEAAARKEASRLSELSIPPAQYA
FT                   QLRARQVALPPPDVRPVDEIRFAPMERVNPEFAAATMETKPGEPITQATLDRDMRRLFG
FT                   TGDFEHVNYRFLEEPGKRVLSVDAIEKSYGPDYLRFGLGLSTDFRGDAYFNLLASYRRT
FT                   WLNSLGAEWRTDAQVGQTSSLISEFYQPLDTRQLFFVAPRIELERRPVNVFSGSTRLAQ
FT                   YDLRRTDFAFDIGSQITKYGEARLGVVVGEQNASLSTGPAYLSPGPGRVNRRAIEGRLV
FT                   ADQLDNLNFPRFGYGGTLNVYASQGGMGATDTYTKGDISGAWAYSIGNNTLSLAFKAGS
FT                   NIGGPALPKYDLFQWGGFLQQSGYSTGQLIGGNLQFARMVYYNKLIHQTFFDGVYAGFS
FT                   LEAGRVGAPLVPGSPTGLLKSMAAFLGIDSPVGPLYLGYGRATGGSYAFYLFLGKP"
FT   gene            122737..123123
FT                   /locus_tag="Rmet_5920"
FT   CDS_pept        122737..123123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5920"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12779"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="InterPro:IPR039251"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP7"
FT                   /protein_id="ABF12779.1"
FT                   /translation="MRQDQNNSSRAPEPFRSAATHVGFCPLRRGIADAAYTGAVPDSIV
FT                   SSVSSVSSVSSVSSAEHFHAPPDDPKPAPPERPGDNECCGSGCDPCVFDFYNDEMERYR
FT                   QELRAWEARQAARQAARDNAATHS"
FT   gene            123120..123953
FT                   /locus_tag="Rmet_5921"
FT   CDS_pept        123120..123953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5921"
FT                   /product="Silent information regulator protein Sir2;
FT                   NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5921"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12780"
FT                   /db_xref="GOA:Q1LAP6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP6"
FT                   /protein_id="ABF12780.1"
FT                   /translation="MNHSAALQDFVERHRRLFVLTGAGISTDSGIPGYRDEQGRWQRSA
FT                   PMTISAFMSGHAARQRYWARSMVGWPVAAGAHPNVSHRVVARLGDAGRVSALVTQNVDG
FT                   LHQQAGSRDVVELHGSIRQVVCLSCATRYPRAELQHWLWQHNPDFRDMTALPAADGDAH
FT                   LESPLFDNFAVPVCERCEGVLKPDVVFFGESVPRERVDTGRAALASSDAVLVVGSSLTV
FT                   FSGYRFCLWANELGLPIAALNLGTTRADPLLTLKVSAPIGPTLSALASGIGLAGD"
FT   gene            124197..125093
FT                   /locus_tag="Rmet_5922"
FT   CDS_pept        124197..125093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5922"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5922"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12781"
FT                   /db_xref="GOA:Q1LAP5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP5"
FT                   /protein_id="ABF12781.1"
FT                   /translation="MNSEKDVMADASAMRTSMHALAVYGATPLFVLLWSGGAIFSRVGL
FT                   SHASPFAFLTLRFVIALPLLAAIGVARRCMLPAPGTRVRVAVTGALMIGGYSISYLLAL
FT                   DFGMTPGVLATVLGVQPILTLLWMERRVSVARLAGLTLALAGLVTIVADSLMAARFSMA
FT                   GWGAALAALACMTVGAIGQKGIRQAAVEILPLQYTVALAMCLLCVPFQPFRFEHVPGFF
FT                   FPLLWMGIVISVVATLLFYRLIQAGNLVNVTSLFYLVPPVTVLLDFVALSNRPAPLALV
FT                   GMIAIPVGLALAFRAGR"
FT   gene            complement(125090..125671)
FT                   /locus_tag="Rmet_5923"
FT   CDS_pept        complement(125090..125671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5923"
FT                   /product="conserved hypothetical protein; putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5923"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12782"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP4"
FT                   /protein_id="ABF12782.1"
FT                   /translation="MSRTLINRLSHARRPLLALAIVAAALGTAHAGYNVWTGEYTFTKD
FT                   ELQSAVDKRFPATLRYGELVSVRLSNPRLVLDEAGNRITTRVDAALSNTVIPSPPVNGS
FT                   LALNSGVRYDATRRAVLLDNPTVQDVEVQGMSQYREQLNAIGAVVAQQLLKDYPLYTFK
FT                   PEELRFNGKDVEPGAITVAPDGIRVQVNLR"
FT   gene            complement(125763..125966)
FT                   /locus_tag="Rmet_5924"
FT   CDS_pept        complement(125763..125966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5924"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5924"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12783"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP3"
FT                   /protein_id="ABF12783.1"
FT                   /translation="MESRLTDLEIKVAFQEDLIETLNLAVARQQQQIDLLQAQFRALYQ
FT                   QVRASAPMAAESDPQHEIPPHY"
FT   gene            complement(126058..126486)
FT                   /locus_tag="Rmet_5925"
FT   CDS_pept        complement(126058..126486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5925"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5925"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12784"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP2"
FT                   /protein_id="ABF12784.1"
FT                   /translation="MSSKVQPYLFFDGRAEEAAEFYKTALGAQVGAMLRYRDGPKDAGP
FT                   GCGPAVINQDKIMHMALQIGDAVIMGSDGEAKGKTEFKGFGLSLNVANAAECDKTMEKL
FT                   AEGGQINMPPSQTFFSERFGMVTDKFGVMWMVIAGPKE"
FT   gene            126776..128101
FT                   /gene="argG"
FT                   /locus_tag="Rmet_5926"
FT   CDS_pept        126776..128101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="Rmet_5926"
FT                   /product="argininosuccinate synthetase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5926"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12785"
FT                   /db_xref="GOA:Q1LAP1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP1"
FT                   /protein_id="ABF12785.1"
FT                   /translation="MTTILQHIPSGQRVGIAFSGGLDTSAALLWMRQKGAIPYAYTANL
FT                   GQPDEPDYDDIPRRAMAYGAEAARLVDCRTQLVAEGIAALQCGAFHISTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTFKGNDIERFYRYGLLTNPGLQIYKPWLDQQFI
FT                   DELGGRAEMSEFMRQHGHAYKMSAEKAYSTDSNMLGATHEAKDLEHLDSGIRIVQPIMG
FT                   VQFWRDDVEVKREEVTVRFEEGQPVALNGKTFANAVDLLMEANVIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLFIAYERLITGIHNEDTIEQYRDNGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVAGAVTGEVTIELRRGNDYSILNTTSPNLTYKPERLTMEKGESMFTPL
FT                   DRIGQLTMRTLDIVDTREKLQTYAKSGLLSNQTSAALPKLED"
FT   gene            128254..129279
FT                   /gene="mocA"
FT                   /locus_tag="Rmet_5927"
FT   CDS_pept        128254..129279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mocA"
FT                   /locus_tag="Rmet_5927"
FT                   /product="aldo/keto oxidoreductase, NADP-binding"
FT                   /EC_number="1.1.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5927"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12786"
FT                   /db_xref="GOA:Q1LAP0"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAP0"
FT                   /protein_id="ABF12786.1"
FT                   /translation="MPDFAMQYRRLGASNLNVSTLCLGTMMFADQTDEAEAARIVASAR
FT                   EHGVNFIDTADVYSKGASEQMVGRLLAGSRHDWVLATKLGNAMGSGPNQSNYSRTWIMR
FT                   SVEDSLTRLATDYIDILYLHRDFAGANLEEPVRAMGDLIRAGKIRYWAVSNFRGWRIAE
FT                   IAALCDRLGVPRPVACQPYYNLLNRVPEVEILPACQHFGLGVVPYSPIARGVLTGKYLP
FT                   GQAPGAETRAGRADRRIMETEFREESLVIAQTLKSHAEGRGLTPGQFATAWVLANPIIS
FT                   SVIAGPRTLAQFEDYFGAVAAAITPAEEAMVDGLVPRGHASTHGYNDPGYPFGGRPVAA
FT                   A"
FT   gene            129506..132574
FT                   /locus_tag="Rmet_5928"
FT   CDS_pept        129506..132574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5928"
FT                   /product="putative membrane carboxypeptidase
FT                   (Penicillin-binding) transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5928"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12787"
FT                   /db_xref="GOA:Q1LAN9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN9"
FT                   /protein_id="ABF12787.1"
FT                   /translation="MRNVSRRGWILVGMTVAACGGTYIVVSLVANEVRTSQWQARYMSR
FT                   LGQSLTYSIEPGPSDSIRYPHSGPYDERLGYERLGEFGERLLKQGYVTSSQARMSPDMV
FT                   RLMDNGIFPPYREKNQAGLLVRDCNALTLAFARYPQRQYDNFESIPKVLISSLLYVENQ
FT                   NLLNPEYPMMNPALDWRRLSRAVLDQGIKFADRHHDTPGGSTLATQIEKYRHSPKGKTQ
FT                   SVSEKFRQMASASLRAYHDGPDTQRVRENVVLDYLNTVPLSARVGHGEINGIGDALYVW
FT                   YGEDFSEFNAALQQMNPRDPTPREAQAYKRALSLIISQRRPSYHLRRDDTNLDALTGSY
FT                   LRLLAANNVITPELRDAALEQSLDKAPPPPRPDAEPWVTRKAVNQVSNDVSHMIGINSR
FT                   YDLDRLDLTVDSTINREAQRLVTDTLLRMRDKGVAHEMGLYGKNLLREGDDPSRLVASF
FT                   TLFERVGNASVVRVQTDNVDQPFDINAGARLNLGSTAKLRTLVTYLEIISELHDRYVDI
FT                   SRAELTALQVPRQDVLTRWAVDYLIAAKSPADRRLATMLDAAMERKYSGSAGEAFFTGG
FT                   GMQSFSNFEKWEGEHQMTVRVGFQHSVNLVFVRMMRDIVRYEVYQAHPDARDLLEDRYA
FT                   PGRRAYLEQFADEEGTAFMTAFYQRYRGKDNDERLKVLLGRVKQPTPHLAAVRLSVTLL
FT                   SARPNTDFETYARTLRQWMPKQKETLSDEDLQALYVKYGHDKFNLNDRGYLSRIHPLEL
FT                   WMVEYLGTHPDATLKEILKASAPDRQTVYAWLFKTRSKLGQDGRIRTLLEREAFGKIAT
FT                   RWQRLGYPFDSLTPSYGTAIGASGDRPAALAELAGIILANGVDAQPSAVRALAFASDTP
FT                   YASAYRLQPAPGKPLIVPEIAMLVRRSMLDVVQNGTAKSISGAFVPLNRKGQAVGAPLI
FT                   IAGKTGTGDQRFQTYGPGGRVISSRSVSRSATFVFLLGDRYFGTVTIHVREPYAARYSF
FT                   TSALSLRVLRSLAPQITAMVAPGSDATLLRCEN"
FT   gene            complement(132628..132879)
FT                   /locus_tag="Rmet_5929"
FT   CDS_pept        complement(132628..132879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5929"
FT                   /product="conserved hypothetical protein (membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5929"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12788"
FT                   /db_xref="GOA:Q1LAN8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN8"
FT                   /protein_id="ABF12788.1"
FT                   /translation="MMAFLGTVFVGLIVGLIARAIKPGDDKMGWIMTIVLGILGSVAAG
FT                   YVGRALGMYQPGQPAGWIASVIGAIVLLAIYDMVRRKA"
FT   gene            complement(132981..135089)
FT                   /gene="fusA2"
FT                   /locus_tag="Rmet_5930"
FT   CDS_pept        complement(132981..135089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /locus_tag="Rmet_5930"
FT                   /product="Elongation factor G 2 (EF-G 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5930"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12789"
FT                   /db_xref="GOA:Q1LAN7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LAN7"
FT                   /protein_id="ABF12789.1"
FT                   /translation="MPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKLGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMANNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYDAVGGVQPQSETVWRQANKYSVPRIAFVNKMDRVGADFFRVRTQIADRLK
FT                   GNAVPIQIPVGAEDHFKGVVDLVKMRAIVWDDDSQGVRFEYTDIPPELVATAKEWHDKM
FT                   VEAAAEASEELLERYLSGEPLSEEEIKTGLRKRTVAGEIVPMLCGSAFKNKGVQAMLDA
FT                   VIDYLPSPVDVPAILGHTEDDKEAERHPSDDEPFSALAFKIMTDPFVGQLIFFRVYSGV
FT                   VNSGDTVYNPVKGKRERLGRILQMHANVRNEIKEVRAGDIAAAVGLKEATTGDTLCDPD
FT                   KVIILERMSFPEPVISQAVEPKTKADQEKMGIALNRLAQEDPSFRVATDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEASVGKPQVAYRETIKGKARDVEGKFIKQSGGRGQYGHVV
FT                   LDVEPMPQGGGYEFVDAIKGGVVPREFIPAVDKGIRETLETGVLAGYPVVDVKATLVFG
FT                   SYHDVDSNENAFRMAGSMAFKEGMRRAKPVLLEPMMAVEVETPEEFTGNVMGDLSSRRG
FT                   MVHGMEDIAGGGGKIVRAEVPLATMFGYSTSLRSLTQGRATFTMEFKHYAEAPANVAEA
FT                   VINARKVG"
FT   gene            complement(135193..136092)
FT                   /locus_tag="Rmet_5931"
FT   CDS_pept        complement(135193..136092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5931"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5931"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12790"
FT                   /db_xref="GOA:Q1LAN6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN6"
FT                   /protein_id="ABF12790.1"
FT                   /translation="MRRLTLAAIATVTVIAALVVPPALAEGTVTAADADQPAALTKAPD
FT                   AAQALAPVRFLLTFDDGPDSGPDGSTPVILRQLANNPIAPGIKAVFFVQTAHRRRGGSP
FT                   EGQAQMRDTCAAGHLLAVHSGLPEGHVPHTRLTPEKLADSLRSGEADIVAQCGHVAPVV
FT                   RPPDWAHNDATEAVYHQLGLDMLMADANARDGKIYGWHISLRRRSHMVSELERVGRAMT
FT                   THRLEPVDGVVPVIVAFHDTNDFTASHMTDYLQILVDAARENGLPLADPPFYTDTGAAE
FT                   QAAVARAKAGLYARESWP"
FT   gene            complement(136295..136612)
FT                   /locus_tag="Rmet_5932"
FT   CDS_pept        complement(136295..136612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5932"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5932"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12791"
FT                   /db_xref="GOA:Q1LAN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN5"
FT                   /protein_id="ABF12791.1"
FT                   /translation="MDEDDTSILGACRDRCRRGVENKNAGTGKVGMDLVVGIIGWLCVE
FT                   LVFYGLFYAIGWSFIKMVTLGRHPGPWRGAEGFVDAELVAFAGIVVTLVVVLVAWKYLA
FT                   P"
FT   gene            136637..137380
FT                   /locus_tag="Rmet_5933"
FT   CDS_pept        136637..137380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5933"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5933"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12792"
FT                   /db_xref="InterPro:IPR021409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN4"
FT                   /protein_id="ABF12792.1"
FT                   /translation="MPSILTKARLLGLAACLLPTVLHCVPVRAQTVEPGVVFSTARPGS
FT                   GLPSGWQNRPVLPGKKMTSYVLVADQGTTVLEADASGSASGLVHEGDFDLNKTPVVSWR
FT                   WKVAAPIQNADNRVADREDSPARLVFFFGGQVDSLSIGDRAEMFAAHALGESLPYATLM
FT                   YIWTNSAAPGTVIENPHSSRVQMIVVGNEAGKWQSLRRNVVADFEKVFHEKPGKLTGYG
FT                   ILTDTDNTGGVARAWYGDIRFSPQN"
FT   gene            complement(137387..138127)
FT                   /locus_tag="Rmet_5934"
FT   CDS_pept        complement(137387..138127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5934"
FT                   /product="hypothetical protein"
FT                   /note="Lipoate-protein ligase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5934"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12793"
FT                   /db_xref="GOA:Q1LAN3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN3"
FT                   /protein_id="ABF12793.1"
FT                   /translation="MTFTFVESDPTETDPLQGELALLEHAISTGPVAQLWEAPLSLVIP
FT                   RSYLRQPGIEEARAQFAAQGCPVWLRMSGGGLVPQGPGILNVSLAYAVPRGVATWMEPV
FT                   YLHLCEVIAQGLREVGVETHWQAVEGSFCDGRFNLAWGPGDSARKIAGTAQYWRRAPSA
FT                   VQTPDGQRHLVLAHAILLVDADPVEINARANAFEAAIHSGRHYDPAKVVSVHEASGIDD
FT                   ATGLTETVKTSIRNAIARSTAPGQ"
FT   gene            138284..139846
FT                   /locus_tag="Rmet_5935"
FT   CDS_pept        138284..139846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5935"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5935"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12794"
FT                   /db_xref="GOA:Q1LAN2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN2"
FT                   /protein_id="ABF12794.1"
FT                   /translation="MNRLTLNTKLWAALAVMWLLLLALGTWNAFHARSVMMAERRDALQ
FT                   SLVTTGEGIVKLYAERAAKGVMSKEDAQAAAKDALRAMRFGQNGYLFIVDSKPQVVLNP
FT                   GLPQTEGNMVGDFKDPDGVYVYRAIIEGARRTTGEDAGFSTYRGRLPGTETPKRKLTYG
FT                   RYVADWDWFVATGVFLVDIEDAFRANLINAIASTLLIGALIAAVMGMIMRTVQRSLGGE
FT                   PAYAVESVTRIAGGDLTVPLQVRGDDDRSVLAAMQQMQERLAATLGDIRGAAGAIASAT
FT                   HQISAGNNDLSQRTEQQAAALEQTASSMEELTGIVRQNADNARQASALAVNASEIANRG
FT                   GEVVSEVVSTMGEINQASRKIVDIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   AGEVRSLAQRSANAAKEIKTLIDNSVAQVDTGSTLVAKAGATMQEVVGAVRRVTDIMGE
FT                   ISAASAEQSTGIEQVGQAVTQMDSVTQQNAALVEEAAAAAQSLAEQAQSMMRAVSAFRL
FT                   ATV"
FT   gene            complement(139884..140915)
FT                   /locus_tag="Rmet_5936"
FT   CDS_pept        complement(139884..140915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5936"
FT                   /product="putative monooxygenase with luciferase-like
FT                   ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5936"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12795"
FT                   /db_xref="GOA:Q1LAN1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN1"
FT                   /protein_id="ABF12795.1"
FT                   /translation="MQAFPMTPYSLLDLSPIIEGSDATQAMRNTLSLAQHAERLGYRRF
FT                   WLAEHHNMPGIASAATAVLIGYVANGTSTIRVGSGGIMLPNHSPLVVAEQFGTLASLYP
FT                   GRIDLGLGRAPGTDQATARALRRTLSHDSADSFPQDVEELQAYFDEVRPGQRVRAVPGA
FT                   GLKVPLWLLGSSLFGAQLAAAMGLPFAFASHFAPGFMRQAVDLYRRTFRPSEQLDRPHV
FT                   MLGLNVFAAETDAEARRLFSSLQQQFLALVRGTPGQLKPPVDDIERLWDASEAEHIRRS
FT                   LACSVVGDPATVREGIQRFVDDLRPDELMLTGQIYDHAARLRSFEIAADAMRALQPASS
FT                   QTA"
FT   gene            complement(141045..143852)
FT                   /locus_tag="Rmet_5937"
FT   CDS_pept        complement(141045..143852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5937"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5937"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12796"
FT                   /db_xref="GOA:Q1LAN0"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAN0"
FT                   /protein_id="ABF12796.1"
FT                   /translation="MPGEDHGWEEEAARVAHRRRALDIPEVAGTDGRNRALALSGGGIR
FT                   SATFCLGVMQALAEAPAPDATPNATPEATPEATPEATPEATPNTSSTPADTPGTRSLLA
FT                   QFDYLSTVSGGGYIGSFFTSLFVPGRLRRGTSPLQAAQDAYRTLQYEPPGRIRTGDVYS
FT                   DAPGRAAVAWLRENGRYLTPTGAGDNLYAAAVIVRNWMAMQYVIGSALLVLLAALALGL
FT                   HKATGTWPGLWQGEMDLLHDARQAINDGDLGIWWSSYLWMPVASTVLFVLPPGIAYWLV
FT                   YPTSDNPQQPVRALNGAVLLTMLLGALFLAASLWFQTIEPNMRVAYACFVIGLLAWLGV
FT                   AACLVMLMPAPRTVTNYRVRATRVLRGAMGFTAMLAALGLADTVARTCYLYSFMAAHPW
FT                   AAIGPAGALGGLVWLVRYGATLFDDGKQGATDSVWRSLLSRLPVSLLAGLVAALVALLV
FT                   FVLWSWIVLWVRWDGGEPVDWHVFGKAWTTAALATLTLLALCMAIVVGRFAGFLNLSTL
FT                   QSFYAARLTRAYLGASNGNRFSTPATDRAARQRFSVAEPAPDDALSLNDYYDPRVLAPL
FT                   HLINVTMNQTVDPAEQLVQRDRKGKPLCIGPGPALVQPGNAQQLPADAYVRFTVDGQLC
FT                   CAKSQQPAGAATRSIEMAQARTVGDWIAISGAAISTGLGRATTLGTSLLLGLANLRLGI
FT                   WWPSNMAEGGSCAVPSAMRRPDIEQRLHPALGVITGLFRTQYYLACELAARFHGTRRRW
FT                   QYLSDGGHFENTAIYELLRPERRVGLIVVCDCGCDGDYRFGDLANLIRLARIDFGLEIV
FT                   VDQAAPDDAVLGPVFGTPDDLAANAPPESRDKVAILLNVHIAGQAGAPDSAPITRIVLL
FT                   KPRLTPSAPADVRQYGAMHPAFPQEGTADQFFDEAQWESYRALGVAIGRRIASGAVASR
FT                   LFSHV"
FT   gene            complement(143940..144914)
FT                   /locus_tag="Rmet_5938"
FT   CDS_pept        complement(143940..144914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5938"
FT                   /product="conserved hypothetical protein; putative
FT                   integral-membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5938"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12797"
FT                   /db_xref="GOA:Q1LAM9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAM9"
FT                   /protein_id="ABF12797.1"
FT                   /translation="MGDLQSLLDGHGLMLVFLNVLAEQAGLPIPAYPMLFVAGALSMQP
FT                   NGPSIGTVLFAVIAACLIADTAWYFAGKRLGQPMLRTICRVSISPDTCIRQTQSLYLRV
FT                   GPRSLIFAKLLPGAGALSTSMAGMTATPFLTFIFYDALGALVWAGAALVAGMVFSDFVD
FT                   TILAAFSAFGHIALMVVLGAFALFIAWRFWMRWRLLRRSGLIPRMTVMEFEQRRAAGDK
FT                   PVVVIDVRAHGAAPIERIPGSIVMEIKGPFDTLSGHDASSDFVVYCACPHEMSAAVLAE
FT                   RLRTAGYPNTWALAGGFDEWKRLQGTSGLPTATPDAPQQIIAH"
FT   gene            complement(145042..145458)
FT                   /locus_tag="Rmet_5939"
FT   CDS_pept        complement(145042..145458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5939"
FT                   /product="hypothetical protein"
FT                   /note="Histidine-containing phosphotransfer domain protein,
FT                   HPT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5939"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12798"
FT                   /db_xref="GOA:Q1LAM8"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAM8"
FT                   /protein_id="ABF12798.1"
FT                   /translation="MTSSGTPSVLTTEECQAFGPALASAAREDPTVYQLLLTRLIDANH
FT                   GDLTDLRRAAKLRDWAGVHRSIHRLKGSAALARCPTLVAAGKSIESAAKYRKAAVVNAL
FT                   LPRYVAIVTEFNDRLRDLRSNRRSAPGGGFVQGI"
FT   gene            complement(145455..146117)
FT                   /locus_tag="Rmet_5940"
FT   CDS_pept        complement(145455..146117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5940"
FT                   /product="DNA-binding response regulator, LuxR family
FT                   (two-component response regulator activity)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5940"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12799"
FT                   /db_xref="GOA:Q1LAM7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAM7"
FT                   /protein_id="ABF12799.1"
FT                   /translation="MVGLPPRQQGMASILIVDDHPALRLALRTQLSQLLGVTTLLEADN
FT                   GQGALNLVRQHRPDLVLLDLDIPRMSGLDAVPRIRALHPAVRILVLSAQDPIPFAARAY
FT                   HAGAQGFVSKTQNMDAILRCVESVLGGFTVFPNNNPRDNPRESRVVGDSEGLSKLTDKE
FT                   VEILRMLTRGMSNKAIGKALFISNKTVSSYKTRVMKKLAADSLVDLIDFARRCRLIP"
FT   gene            complement(146403..147080)
FT                   /locus_tag="Rmet_5941"
FT   CDS_pept        complement(146403..147080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_5941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_5941"
FT                   /db_xref="EnsemblGenomes-Tr:ABF12800"
FT                   /db_xref="InterPro:IPR020530"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LAM6"
FT                   /protein_id="ABF12800.1"
FT                   /translation="MIVSTTPGHTHVRLAATVTEELLQTHAPGPQIQRENKRRVELGGR
FT                   MVRPNLIRMLDHFHVPALISQPDATSLWEEAGFDSIQPLALLPHATTRRGLAFDGPLDE
FT                   LLDTPMLRDVFQREFLDRLPQYPRDALYIGLGRTAWSGLEHAVRAGLLRQQQLLGMMPV
FT                   PTRAGSMVRYFLREVREADLSPNDPVRHRIAWLDAAHREMEAGVERLRTESIPSAQPRR
FT                   LTA"
FT   gene            complement(147614..148003)
FT                   /locus_tag="Rmet_3616"
FT   CDS_pept        complement(147614..148003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3616"
FT                   /product="osmotically inducible protein (OsmC-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10488"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH88"
FT                   /protein_id="ABF10488.1"
FT                   /translation="MTIEATWLANSGASLCDLSNGTAHWKADLDAPAGDATLPNPHDLL
FT                   DSALAACTTLTLQIYAKRRNYDLQEVRVTVSHEEAPGTYKLVRRLELQGNLDEKAREDL
FT                   LRVANKCPVHKVLSSQISIDTTLAG"
FT   gene            148293..148493
FT                   /locus_tag="Rmet_6615"
FT   CDS_pept        148293..148493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6615"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45214"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY22"
FT                   /protein_id="ADC45214.1"
FT                   /translation="MNALHNLVSPLQRNDGNVSEAATANRQSRALRFFNNQTTDKCGRL
FT                   MANATVTSVAVMLQKLSVLAQ"
FT   gene            148595..150121
FT                   /locus_tag="Rmet_R0070"
FT   rRNA            148595..150121
FT                   /locus_tag="Rmet_R0070"
FT                   /product="16S ribosomal RNA"
FT   gene            150186..150262
FT                   /gene="tRNA-I"
FT                   /locus_tag="Rmet_R0071"
FT   tRNA            150186..150262
FT                   /gene="tRNA-I"
FT                   /locus_tag="Rmet_R0071"
FT                   /product="tRNA-Ile"
FT   gene            150274..150349
FT                   /gene="tRNA-A"
FT                   /locus_tag="Rmet_R0072"
FT   tRNA            150274..150349
FT                   /gene="tRNA-A"
FT                   /locus_tag="Rmet_R0072"
FT                   /product="tRNA-Ala"
FT   gene            150632..153449
FT                   /locus_tag="Rmet_R0073"
FT   rRNA            150632..153449
FT                   /locus_tag="Rmet_R0073"
FT                   /product="23S ribosomal RNA"
FT   gene            153629..153742
FT                   /locus_tag="Rmet_R0074"
FT   rRNA            153629..153742
FT                   /locus_tag="Rmet_R0074"
FT                   /product="5S ribosomal RNA"
FT   gene            153882..154178
FT                   /locus_tag="Rmet_3617"
FT   CDS_pept        153882..154178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3617"
FT                   /product="putative excinuclease, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10489"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH87"
FT                   /protein_id="ABF10489.1"
FT                   /translation="MTSEIEPAPTEEPTWFLYLLECEGESIYTGITTDVQRRYAQHRAG
FT                   TGAKYTRSRRPLRLLGWLEFSTKSEALKAEIRTKRMSAAQKRDFCSQLRTTYP"
FT   gene            complement(154232..154654)
FT                   /gene="ohrB"
FT                   /locus_tag="Rmet_3618"
FT   CDS_pept        complement(154232..154654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohrB"
FT                   /locus_tag="Rmet_3618"
FT                   /product="Organic hydroperoxide resistance protein OhrB,
FT                   0smC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10490"
FT                   /db_xref="GOA:Q1LH86"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH86"
FT                   /protein_id="ABF10490.1"
FT                   /translation="MKLEKVLYTAHASATGGRDGRAESSDGQLNVKLAVPKEMGGSGNG
FT                   MNPEQLFAAGYSACFLGAIRFVAGQQKIAISPDAKIEGAVGIGQIPQGFGIQAELKISL
FT                   PGLDKEAAQKLVEAAHQVCPYSNATRGNIDVTLIVV"
FT   gene            complement(154716..155204)
FT                   /gene="ohrR"
FT                   /locus_tag="Rmet_3619"
FT   CDS_pept        complement(154716..155204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="Rmet_3619"
FT                   /product="Organic hydroperoxide resistance transcriptional
FT                   regulator, MarR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10491"
FT                   /db_xref="GOA:Q1LH85"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH85"
FT                   /protein_id="ABF10491.1"
FT                   /translation="MFMRDTTTPSRTEASSNDWLLLDQQLCFALYSTSLAMTKIYKPLL
FT                   SELGLTYPQYLVMLVLWESNTLTVSELGTRLTLDSGTLTPLLKRLESAGLVARERDAKD
FT                   ERRVLVNLTDAGRRLRASAADIPEKLLCATQCSISEIQSLTSRLHALRSTLESARTDD"
FT   gene            complement(155208..155309)
FT                   /locus_tag="Rmet_6616"
FT   CDS_pept        complement(155208..155309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6616"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45215"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY45"
FT                   /protein_id="ADC45215.1"
FT                   /translation="MIAFPHQGLCTRVAHLISIGSMQILYCEQFNCV"
FT   gene            155450..156913
FT                   /gene="degP"
FT                   /locus_tag="Rmet_3620"
FT   CDS_pept        155450..156913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="Rmet_3620"
FT                   /product="multifunctional enzyme (serine-type endopeptidase
FT                   / oxidoreductase) (degP / mucD-like)"
FT                   /EC_number="3.4.21.-"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10492"
FT                   /db_xref="GOA:Q1LH84"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH84"
FT                   /protein_id="ABF10492.1"
FT                   /translation="MIRQTLARSAVGVAALAALAGGYAYLQKDAITPGYAAQTPVTASA
FT                   GPIAVATPTDFSSIVDQYGPAVVNISVTARAQRTSAQVPQGVDPDDPLFQFFKRFGPQF
FT                   QGPQNAQPQLVRGLGSGFIVSQDGLILTNAHVVDNATEVTVKLTDRREFKAKVLGSDPQ
FT                   TDIAVIRIDAKNLPTVRLGDPSKTRVGEPVLAIGSPYGFENTVTAGIVSAKSRSLPDDT
FT                   YVPFIQTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAIPINVATKVEEQ
FT                   LVAHGKVTRGRLGISVQEVNQALAQSFNLPKPAGALVNSVEPDSPAAKGGVKAGDVIVQ
FT                   LGDDVIDHSGDLPEHVADLKPGTETKLKVIRKGQPMTLTVQVGAVKEDALAQKGNGGQD
FT                   GGRLGLAVRQLTPAEKRDSGIDGGLVVEDVTGPAARVGIQPGDVILSLNGTPISSAEQL
FT                   RTLVSKSGKQVALLVQRDDARIFIPLDLG"
FT   gene            157139..157462
FT                   /locus_tag="Rmet_3621"
FT   CDS_pept        157139..157462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH83"
FT                   /protein_id="ABF10493.1"
FT                   /translation="MQLDFARAPTSPATDLARRLAPAVTKPTPRRRKKEAPPHWERGYR
FT                   SHYYRNERGDKLGEVRLSDRGDLPVVYHWAAGNYSGAEGSLAHARARVEETVGFGMRQL
FT                   SLF"
FT   gene            complement(157587..159164)
FT                   /locus_tag="Rmet_3622"
FT   CDS_pept        complement(157587..159164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3622"
FT                   /product="Major Facilitator Superfamily MFS-1 (multidrug
FT                   resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10494"
FT                   /db_xref="GOA:Q1LH82"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH82"
FT                   /protein_id="ABF10494.1"
FT                   /translation="MTAQADPWHRLRARMRWLRLLSHQQRQTLLMILLGLATGVEFLEN
FT                   IMFVFASSHIIGGIDADPRSFALVQAAYAVGSMLMILTQHWLARRFGYRYYLTGSLLLF
FT                   MAGTLAAATSTGLTQMVGARFVQGVGGGALFTSCRILVNMMFSQTDRVRASRIFMLGIF
FT                   SASALGPAFAAELVDRGVWQDVFYGVLPFAALATIGAWLLLPDAEARDDVEGPGLGPLL
FT                   LFGVAIVALQATLTEARFDVFSHPIRIALIAALALTLLTVFLWQQWHHEKPVLHLRALY
FT                   QPVFLTGLAMYFVYYMISNLAAYVFPIYAEQALRFPLATTGWLNTFAATISLVGIWVYQ
FT                   RVARKLKHKKPLMTTGLLLMAGAMTWFSFMPPDVGPPALIVGLIGKGLFGVMVIIPIAG
FT                   LTFGSLAGDDFAHGYRSKNLIRQIASSFASALGAVLLQNRQFAVHTSLVHALGQRPAET
FT                   EQWMHTVQAALVARGFEPGQAHAGALAQLAALVDQQARLIACEDLYRLIAVLAMAAAVF
FT                   MLVQRRLD"
FT   gene            complement(159161..159658)
FT                   /locus_tag="Rmet_3623"
FT   CDS_pept        complement(159161..159658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3623"
FT                   /product="transcriptional regulator, MarR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10495"
FT                   /db_xref="GOA:Q1LH81"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH81"
FT                   /protein_id="ABF10495.1"
FT                   /translation="MSFERRIDRFCAEYPEAPRDLILASRLLLRSARLLRQHIERALAV
FT                   HDLDLNQYLVISMLGIDAMEPTMPSELGLTIDATRTQMTRLIDGLETRGLVQRKASQHD
FT                   RRSLELILTPAAHDLLKRAAPTVHAAYAEAWAPIGKTGLAAVTRDLGRLHQHLAALGAN
FT                   AS"
FT   gene            complement(159745..161760)
FT                   /locus_tag="Rmet_3624"
FT   CDS_pept        complement(159745..161760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10496"
FT                   /db_xref="GOA:Q1LH80"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH80"
FT                   /protein_id="ABF10496.1"
FT                   /translation="MSKKAKTVAVRPLGHQEQGMLIGQLALVLAPQARTLPVSVSLLLV
FT                   LLLAWRWMLWKRRAPLPSKLTVGLAAILVLVVAGALVWQSGGNLGRELCIALLAAFVVL
FT                   KLMETRALGDATLITQLSFYLLLTLYLADQPFWLALYSMAIGAWVLRNWLLLHHPEARG
FT                   RLAIWPLLGRMAMFGLPWAVFLFVLFPRLDHPLWRLPQSEPIGRTGISDTMKPGSIGKL
FT                   IRSPDVAFRVDFVGEAPSPASLYWRAFVLWDYDGETWRPARSRSVRPADGLRDDIGDSD
FT                   FAGSAAPGAHEYNITLEPTQASWLYVLDRGQAISSSLNAQVSTDNEFFANLPVDRPLRY
FT                   RARSVFGAAPEPLTQRTLRRALTLPEGNPRSRELAARWANEYPDPWQRVQAALRLFAAA
FT                   PFAYTLSPPPLDQDQVDSFLFETHRGFCEHYASGFVFLMRAAGVPARVVAGYQGGDLNP
FT                   VGRHYVIRQSDAHAWAEVWIAQRGWVRVDPTGAVAPSRVEQGVDAALAGDEIPALRDLR
FT                   APGWLRDLRWGLDGLSYTWQRWVLQYDRVQQGKLMEQAGLAGKLPSVLVGGLAALSLLA
FT                   LLPLWLRRRHADPVQALYDRFCGLLARHGCVRDTSEGPRDYSARACAALPRAASAVQAF
FT                   TNGYVAWRYGAPTTQQQTEVIVRLRTSLRELSKALR"
FT   gene            complement(161757..162707)
FT                   /locus_tag="Rmet_3625"
FT   CDS_pept        complement(161757..162707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10497"
FT                   /db_xref="GOA:Q1LH79"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH79"
FT                   /protein_id="ABF10497.1"
FT                   /translation="MWLRRKRAPVNGVVTLDRRHLYILPTRGGIGFSVLLATMLLTSLN
FT                   YAISLGFALTFLLAGIGMGCMWMAYRNLLDLRVSAGPVTPAFVGECAIFTLHVDNQDAA
FT                   ARIGIEARTPLSGADTETAALTLDGVSSGTLPVRLSAIRRGRLVLPRVTLSSRFPFGLF
FT                   RVWSYADLGLATVVYPAPEASPPPLPRHPQSDDADDGAASFAADDGIDQLRRYRPGDPL
FT                   HRIAWKHSARTGKWLTRSGHTPQQPSCWIDWNTLPPAMDTEARLSRLCAWVLMAGEVSE
FT                   IGLRLPGVEITPGRGSAHVRACLEALALWPERRAR"
FT   gene            complement(162795..163721)
FT                   /gene="moxR"
FT                   /locus_tag="Rmet_3626"
FT   CDS_pept        complement(162795..163721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="Rmet_3626"
FT                   /product="putative ATPase with possible chaperone-like
FT                   activity (MoxR-like)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10498"
FT                   /db_xref="GOA:Q1LH78"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH78"
FT                   /protein_id="ABF10498.1"
FT                   /translation="MTARPKIAASLTEVQTQLGRIVLGKPRQVRLALACILAGGHLLLE
FT                   DVPGVGKTTLAHALARTLGLHYQRVQFTSDLLPADLVGVSIFKRETGEFHFHHGPVFAQ
FT                   VVLADEINRAPPKTQSALLEAMAERQVTHDGITETLSAPFFVIATQNPLEQIGTHPLPE
FT                   SQLDRFTMRISLGYPDAAFERVLYLGGAIKDEAEAVMDADQVVALQTAVEKVYASPALV
FT                   DYVLALVQATRVESSFVTGLSPRAGLALLACARAWALLDQREMVLPEDVQAVFEPVAAH
FT                   RLLPAGQVALNQGTDTLARLLASVAIP"
FT   gene            163975..164820
FT                   /locus_tag="Rmet_3627"
FT   CDS_pept        163975..164820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3627"
FT                   /product="putative deoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10499"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH77"
FT                   /protein_id="ABF10499.1"
FT                   /translation="MTAPQHHASGASASLDFDSSAPLADQAALASLAREFHAGGYIVLR
FT                   KFASEATCAALEAVTRQQLAAAVPPVEFEADLGYPGAPATRESAGGHTVRRLRQAYGRD
FT                   EVFRRWASDPAVVATVEALLGEPARLTLAHHNCVMTKHPHYGSQTGWHRDTRYWSFVKN
FT                   DLITVWLALGDEDERNGVLRVIPGSHRAKLDPAQLDPAEFLIEAHPASQQLLKGTMPLA
FT                   LHRGDVLMFDSRLFHAAGRNDSEAVKLSVAFAYFGASNRPVAGTRSAEFGSVELPPTTL
FT                   "
FT   gene            complement(164924..165106)
FT                   /locus_tag="Rmet_3628"
FT   CDS_pept        complement(164924..165106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10500"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH76"
FT                   /protein_id="ABF10500.1"
FT                   /translation="MGMTIMQYPDASYFDRPVGEQLLSHFARRDAVRHTTPLLPFRFAD
FT                   VLALFRGTNAHRKTV"
FT   gene            complement(165316..166056)
FT                   /locus_tag="Rmet_3629"
FT   CDS_pept        complement(165316..166056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3629"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10501"
FT                   /db_xref="GOA:Q1LH75"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH75"
FT                   /protein_id="ABF10501.1"
FT                   /translation="MNDATASAYSQIPDAPAASLGAQHSPLFALVTDTLRQRILGGQYE
FT                   PGERLVENTLSLELGVSRIPVREALRALAAEGLVHIEPRRGASVARLSPNIAREMVEVR
FT                   ATLEGLNAKLAAQRRDPALIQELEKVLKEGNDAVDSGQTQRFVELNSRFHEVLGTIAAN
FT                   SVLQEMMRSLRERTALLFAPANLTRARTNWDEHAQILQAVIAGDADLASLLATRHVYSA
FT                   AKAVEAMNPDATAASASADANKAA"
FT   gene            complement(166189..167193)
FT                   /locus_tag="Rmet_3630"
FT   CDS_pept        complement(166189..167193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3630"
FT                   /product="multidomain oxidoreductase, (2Fe-2S) and
FT                   FAD/NAD(P)-binding (antC-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10502"
FT                   /db_xref="GOA:Q1LH74"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH74"
FT                   /protein_id="ABF10502.1"
FT                   /translation="MSYRVEIAETQQVFMVAPGESVLDAALRCGVNLAHECTFGGCGTC
FT                   RVRVVDGAVTYEEFPMGLTEEEDAAGFALACQARPAGDLVISTARAAEPAIPARRTTAT
FT                   VQAITSLGPDVLHLRLALSDDEAFAFEPGQYMKILLEDGSHRSFSMASAPNGNTVDFHV
FT                   RQIAGGRFTTGQLPQLRPGDKLDVEVPHGSFSLRKEDYRPLLMVATGTGLAPIKSMLEA
FT                   LMDDPDCPPVWLYWGMRSAADLYLHDEIARWGERLYDFQYVPVLSRADDTWQGRRGYVH
FT                   DAVAADIGDLSEHAIYLCGSPNMIHDAKQTFMVLGAQAPFIYSDGFTFQHAPG"
FT   gene            complement(167211..167690)
FT                   /locus_tag="Rmet_3631"
FT   CDS_pept        complement(167211..167690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10503"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH73"
FT                   /protein_id="ABF10503.1"
FT                   /translation="MKKAIKLELKEARHMVAAAIRKAEEIGVLESICIVDDGGYPLLLE
FT                   RMDGARITGPQIAWNKAFTAAGHKRSTHLFNTPPNGPALPGNEAFGIQWSFDGKFAVFV
FT                   GGYPIVVNGEVIGGVGLSGGNGEQDTACGVAALEALRDLLAAEDLTVLAQADIKK"
FT   gene            complement(167715..169163)
FT                   /locus_tag="Rmet_3632"
FT   CDS_pept        complement(167715..169163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3632"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10504"
FT                   /db_xref="GOA:Q1LH72"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH72"
FT                   /protein_id="ABF10504.1"
FT                   /translation="MTETYRNYIDGEWCDSASGRTVDNVNPADTRDIVSRHAASDARDA
FT                   AAAVAAAAAAFDGWKKTPIGKRAKILNDAAAHLEANADTIATELTREEGKALNLARDEV
FT                   MRSAQTLRFYAVEGQTFSGESYPNDDPDMLVYSLREPLGVVTVISPWNFPVSIPARKIA
FT                   PALITGNTVVFKPSSDAPLSGYRLAEAFVRAGIPKGVLNFLTGSAAEVGPTIVESREVR
FT                   AVSFTGSTSAGEQIHKSVPMTTRTQMELGGKNPLIVMEDADLDRAVDLAVKGGLSLSGQ
FT                   ACTGTSRILVMRDVKQAFTEKLVAKVKALKIGSGMTAGMDLGPLATRKQLETVLSYIAI
FT                   GKQEATLLCGGEQLSDGDFAHGYYVAPTVFTDVTQSMRIAREEIFGPVLAIIEVDSYAD
FT                   AIAQANDTEYGLSAAIATRNPRYMHDFTRDIESGTVKINRTTTGNLVNAPFGGLKRSST
FT                   STFRESGRAGLEFYTQIKTVYQGI"
FT   gene            complement(169239..169955)
FT                   /locus_tag="Rmet_3633"
FT   CDS_pept        complement(169239..169955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3633"
FT                   /product="transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10505"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH71"
FT                   /protein_id="ABF10505.1"
FT                   /translation="MAELMNREEFRTALENAIKGKSANQAPFSKAWASGELSREHLARW
FT                   AENHYHYVGPFADYLGYIYARTPDHMTEAKDFLLANMYEEEIGGDRHTDLLIRFAEACG
FT                   TTRERVVSPDNMSPTTRGLQSWCYAVAMREDPVVAVAGLVVGLESQVPSIYRKQTPTLR
FT                   EKYGFTDEEVEFFDLHIVSDEIHGERGYQIVLEHANTPELQQRCLKICEIGAQMRLLYT
FT                   TALYYDYVDTKAQAAA"
FT   gene            complement(170105..171082)
FT                   /locus_tag="Rmet_3634"
FT   CDS_pept        complement(170105..171082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3634"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10506"
FT                   /db_xref="GOA:Q1LH70"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH70"
FT                   /protein_id="ABF10506.1"
FT                   /translation="MKHCVDCIPKYKQDAPMLHITDTLIDRHVTAADAQAAMLDAFRSF
FT                   GRGQAAMQERIRTEAGGVKLSTLGAVIPDQQVAGAKVYTTIAGQFSFVILLFSTVDGRP
FT                   LASFDAGAITRLRTAACTVLAAKRLARSDAQTLALFGAGTQGVQHALQLSAALPFQRIL
FT                   ICDPYADAEAATRLSAQCGVSVSFAQAEEAVAAADIIVTASRSTTPLFPGAIVKPGTFI
FT                   AAIGSSLPHTRELDDVALSRAAAVVVEWRPQSLREAGDLVLADKAVLPDEKIVELADVL
FT                   LDTAPTRKHADDILIYKSVGVGLEDVALAGIAYQRITAAQAAAA"
FT   gene            171133..171318
FT                   /locus_tag="Rmet_6617"
FT   CDS_pept        171133..171318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6617"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45216"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY46"
FT                   /protein_id="ADC45216.1"
FT                   /translation="MRTFRALERKSAPFLGISLGVVISACVRGYAEYSIQLVVKIEIHI
FT                   RPHKGLHSRGASCIKP"
FT   gene            171303..172841
FT                   /locus_tag="Rmet_3635"
FT   CDS_pept        171303..172841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3635"
FT                   /product="putative transporter, IT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10507"
FT                   /db_xref="GOA:Q1LH69"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH69"
FT                   /protein_id="ABF10507.1"
FT                   /translation="MHQTVEIGLAHWVYLLGVAVIVLTMIMRANVVVPSIVGTFLVILA
FT                   ITGSPVTALGGIFSASLVAAKELFNIFLVIAFMTALLNALKSLRSDVRMVEPFRVVMKN
FT                   GHSAYFILAGITYVISLFFWPTPAVPLVSAILLPAAIAAGLPPLAGAMAIAIAGQGMAL
FT                   SSDYVIGVAPGISAKAAGAAVSAAVVADRALILSIITGGIALTLAYLSMRRHIVPASGA
FT                   LLDRWQARATGVDTAVEATGTFDKAEIARGTSHEEPLDTDANIERSLAMVAQRRVKWSK
FT                   FFAVLTPLAFACVVTLMVLPKISSGMVDLKGGAAAALVGGVAAVLMMLATLAAEGPRKM
FT                   LDTCPEHITDGFVFAFKAMGSVLPIAGFFFVGAGETAAQILGVDTGRAPSLLFELIQAY
FT                   QHMIPDNHVLVAFGVLLVGMITGIDGSGFAGLPLTGTLAGALGPVVGFDSATLAAVGQM
FT                   GAVWTGGGTLIAWSSLIAVAGFARVPVLDAVRALLLPVLAGLFVSTICAMLIWH"
FT   gene            172894..173196
FT                   /gene="fdx"
FT                   /locus_tag="Rmet_3636"
FT   CDS_pept        172894..173196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="Rmet_3636"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10508"
FT                   /db_xref="GOA:Q1LH68"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH68"
FT                   /protein_id="ABF10508.1"
FT                   /translation="MPKVVFHKNGQVFVDEVKPETNLVVRAGIKQFPYPNLRYECGMGK
FT                   CSKCACRVLSGAEHLPPPNWKEKKQLGDRLDQGFRLTCQIWLTHDIELEQEELAA"
FT   gene            173236..173556
FT                   /locus_tag="Rmet_3637"
FT   CDS_pept        173236..173556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH67"
FT                   /protein_id="ABF10509.1"
FT                   /translation="MNQAMYVILTSKPGQFRTEAVPGVEPVETWEYLFYGRCTATFVIA
FT                   ELSDTQHPLKVRVIDEADKSAEVVNHVPTKFLERFDTLDAARTALQSLAHFGSMDLSLR
FT                   KQ"
FT   gene            173553..173912
FT                   /locus_tag="Rmet_3638"
FT   CDS_pept        173553..173912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3638"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10510"
FT                   /db_xref="GOA:Q1LH66"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH66"
FT                   /protein_id="ABF10510.1"
FT                   /translation="MMQAQTDIGDIDAGAAVPDTDTPPKPRTIEITFVTNGEKTVNAPE
FT                   NSNLLRVSLREQGGIPFKCGGGICGTCKCRIERGLEHTDAVKPKERKHLSDDDLRAGYR
FT                   MACQTFVKGDIAVSW"
FT   gene            complement(173941..174852)
FT                   /locus_tag="Rmet_3639"
FT   CDS_pept        complement(173941..174852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3639"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10511"
FT                   /db_xref="GOA:Q1LH65"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH65"
FT                   /protein_id="ABF10511.1"
FT                   /translation="MRQTGKAGAFPLPFRPFRANSGASTPMFRSMANPADTATSRAPVA
FT                   GATEKPSDSYVQSFARGLSVIRAFNASHPAQTLTEIAQASGLTRAGARRILLTLVGLGY
FT                   VQNDGRLFRLTPKILDLGFAYLTSMPFWNLAEPIMEALSQSVHESCSISVLDGTEIVYV
FT                   LRVPARKIMTINLSIGSRLPAYCSSMGRVLLSGLDQEELDRVLHASDLRPRTRRTVTDI
FT                   GELKTLIGEIRERGWAQNDQELEEGLVSLSAPIRNRGGQVIAAINISGQANRTSAQEMV
FT                   ERFLPPLLEAAGKISAMVGLRT"
FT   gene            175023..175889
FT                   /locus_tag="Rmet_3640"
FT   CDS_pept        175023..175889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3640"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10512"
FT                   /db_xref="GOA:Q1LH64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH64"
FT                   /protein_id="ABF10512.1"
FT                   /translation="MIEQGTFTAAAAALDCPKSRVSAAVARLETAIGAKLLERTTRRMR
FT                   LTDAGGAVYRDVAPLFARLREIRQETLAREERVQGMLRIATPYEFGAQQLGGVICRTLA
FT                   AHPALDITVEISQGLVDPIREGFDIAFVTVDTDLPDSGTIARRIWHIERGLVAAPSLAA
FT                   SLPAQMQPEDLSHMPTLATPGVSVWEFSRDGERISVPIRPRMQTYNAELRMQAALAGIG
FT                   IARVPMATAEAEIAQGRLVRMMPDWPLPPLRVFALLPDRRLQPRKVRAFMEAIESMMGA
FT                   DLDDLGQ"
FT   gene            complement(175961..176233)
FT                   /locus_tag="Rmet_3641"
FT   CDS_pept        complement(175961..176233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH63"
FT                   /protein_id="ABF10513.1"
FT                   /translation="MKTLALSLLCAIGLSVGATAAQASEFNSDLARLDGSIARKVDPYL
FT                   DGARGVTEKRDVYTEGARGVTEKRDVYTEGARGVTEKRDVYSEGA"
FT   gene            complement(176446..177054)
FT                   /locus_tag="Rmet_3642"
FT   CDS_pept        complement(176446..177054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10514"
FT                   /db_xref="GOA:Q1LH62"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH62"
FT                   /protein_id="ABF10514.1"
FT                   /translation="MAESVRLPTPYNRKTEIRPMFTEIILFLLDTVFTLFGMALLLRLW
FT                   MQLSRLPSRNPVSQGVFQVTDWIVRPLRRIIPGLGGIDWATVFAAYLTAVAFLLCRALV
FT                   LGADPLGFLPVILALGVLSMLKWGISMVMWVTLLMAVLSWVNPNSPLAAPIWHLTAPLL
FT                   RPIQRVVPRLGGFDISPLILFVIAQILLMVIANVSRGVA"
FT   gene            177147..177656
FT                   /locus_tag="Rmet_3643"
FT   CDS_pept        177147..177656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3643"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10515"
FT                   /db_xref="GOA:Q1LH61"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH61"
FT                   /protein_id="ABF10515.1"
FT                   /translation="MGGRSTNALADPTSMPRKSAQARASEETAVLHKQDFEALSDFRYQ
FT                   LRRFLRFSEEAARAEGVTVQQYLLMLHIRGCPDKNWASVGELAERLQAKQHGVVALVNR
FT                   CEAAGLVSRKVNPDDRRVVQIHLLAKGERCLNRLAALHRTELESLRNTFRVARITAFND
FT                   DGAERI"
FT   gene            177816..178556
FT                   /locus_tag="Rmet_3644"
FT   CDS_pept        177816..178556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3644"
FT                   /product="surface antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10516"
FT                   /db_xref="GOA:Q1LH60"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH60"
FT                   /protein_id="ABF10516.1"
FT                   /translation="MSFPFRPVVLAALAASALAGCAAPYGGYGDGYGSGYGGSYGSSGS
FT                   YGSTAYGGATYGNAGYGGSGTQVSGGYPTYPQQQGYPQQQGYPQQQGYPQQQAYPQQQT
FT                   YDQYAYPSQPSAPQGGNYDSGYNNGYNDQYAVRYGWVESIEQLAGQPADTSGAGAVIGG
FT                   VVGGLLGHQVGGGRGNTVATIGGAVAGALAGNEVEKRSGTTPAAFRVRVRTNDNVYVTV
FT                   TQNSPYNLRTGDRVKIQNGVAMPY"
FT   gene            complement(178632..179342)
FT                   /locus_tag="Rmet_3645"
FT   CDS_pept        complement(178632..179342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3645"
FT                   /product="carboxymethylenebutenolidase (dienelactone)
FT                   hydrolase (DLH)"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10517"
FT                   /db_xref="GOA:Q1LH59"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH59"
FT                   /protein_id="ABF10517.1"
FT                   /translation="MTTNSRWIRIDTPDGSFDAYLSLPPAGKQPGNPGIVLIQEIFGVN
FT                   EHIRSVADQYAADGYVVLAPDVFWRTAPRVELGYSGKDWEEAMKLRQAVNLEEAVSDIG
FT                   ATAKALRAEIGASGKVAAVGYCFGGLLSYMAAARGMVDAAVPYYGGGIQNNLKEAEALN
FT                   VPVQFHYGALDAHIKPEDVERVRQAVAGKRGVEVFVYDQADHGFNCWARGSYHQRSAAL
FT                   AHGRALTFLTNALS"
FT   gene            complement(179530..179949)
FT                   /locus_tag="Rmet_3646"
FT   CDS_pept        complement(179530..179949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH58"
FT                   /protein_id="ABF10518.1"
FT                   /translation="MRTEQIAMRQRARNLCAVGVAVMSLGAAMAARADITSSTSGPITY
FT                   VCGGVAADEQAEMRSEARNYDMGLLFTQGGRGEYLSDVNVKLMKNGKEVAEFRSTGPRC
FT                   LIRGPRASYQVVATYEGMSKHATLSPGEKNVQMRW"
FT   gene            180255..180461
FT                   /locus_tag="Rmet_3647"
FT   CDS_pept        180255..180461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10519"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH57"
FT                   /protein_id="ABF10519.1"
FT                   /translation="MSNHTYKLVEIVGSSADGSDAAIRNALAKASESIKNIDWFEVVET
FT                   RGHVQDGKVAHFQVTLKIGFRVN"
FT   gene            complement(180513..182189)
FT                   /locus_tag="Rmet_3648"
FT   CDS_pept        complement(180513..182189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3648"
FT                   /product="putative activation/secretion signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10520"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH56"
FT                   /protein_id="ABF10520.1"
FT                   /translation="MRTRKRVAALLIGIGAIHSGLSHAERSPVQGDPTQTLPTIAPSKP
FT                   AQSNVTVQVERPDAAMQNLLASRLTPKHFKIEGAKTLPFEQIAAKFSPLANREISVAEL
FT                   LQAAESVTQMYKDAGYPLSFAFVPAQSFENGDVLITVVEGYVANVTVRGKPGPAEGRLR
FT                   KIAQQLMRDRPLRQESFEHYVNVLSQQPGMQINATVQPPTTTDGACEMVLEAKRKPFTF
FT                   GTGVEWMSPGLRAIATATTNSLTPLGEQLSFTTLFPKGHNDEEYYALNYAQPIGTEGML
FT                   AKVTASHYRGVPENTSLAPIGFESRYVNDSKRLGGTLSYPVILNNRHALTLTGGFYANN
FT                   QFERYTQAVQPGAGRQIELSTDVRVASAEASYLQRGQGFTRNATLGFYKGFDGLGASRQ
FT                   NNINDLSFFRTRLLVSQANDLPYGFGTSISAAGQYSGNRLASSEQISFGGRFFGLGYPA
FT                   GEVAGDKGWGASAEINRMFAVDYTYLKTLQPFIVTDYARVFSNSVSLSHRTLQSVAIGL
FT                   RFSDRRYYTMDISVAQPVGDKPTNASHRSPRFNLLWSYQFD"
FT   gene            complement(182341..183924)
FT                   /locus_tag="Rmet_3649"
FT   CDS_pept        complement(182341..183924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3649"
FT                   /product="hemagglutinin-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10521"
FT                   /db_xref="GOA:Q1LH55"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH55"
FT                   /protein_id="ABF10521.1"
FT                   /translation="MRQQQDFKKRIVITAVLGALFALGGCASGSGSTSMGTSGSGGSGG
FT                   TAGTSAGTGSSGTNGGAGGSGSTGGSGTDLGSNGTGGNGSNNGGNNNNNNNGGGTTAAL
FT                   TPTSAIVSNAGSVADGAGKTVSGLGDAISNANVPGLPSQTQAGLGGVVTSVGNAVSTLA
FT                   NGVQSGLGNIPNATNPVGTTVASTGGVVSQLGNAVTNAGSAVSGLGTGPLAPLAALTTP
FT                   LGGVVSQVGGTVSNVGTQLGTALSIGPVEQLTGGVSKIIVPLTSTLTNGTQTLGAATGL
FT                   GQPVNNLLATVGGALAVAGTTLTNTNTPVVSGVGGVVTGVGNTVASVGGVVNGPAGGSV
FT                   TNPLAPVTGLVSGLTGGLSGATGGSASPLAPVTGLVSGLTGGLTSAAGGGTSPLAPVTG
FT                   LVSGVTGGLTSAAGGGTSPLAPVTGLVSGVTGGLTSAAGGGGSPLAPVTGLVSGVTGGL
FT                   TGGNSAGTTASPLAPVTGIVAGLTGGNAPASTSGTTTGGTKAANPLAPVTGLVGGLVSG
FT                   LTGALGGTRH"
FT   gene            184430..185659
FT                   /locus_tag="Rmet_3650"
FT   CDS_pept        184430..185659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3650"
FT                   /product="hemagglutinin-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10522"
FT                   /db_xref="GOA:Q1LH54"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH54"
FT                   /protein_id="ABF10522.1"
FT                   /translation="MKTTSQLQRPRYSTNVVALACAAALALLAGCSSGGSGSGASPSPS
FT                   TPAGPTPTPTPTPTASTMPTAKVVEGTGNTVTAAGNAVSQIGQQIKDTNVPLVPTGAKN
FT                   ATGDVVINAGATVATLGAGVANGLGKMGAVDNPVGVTVANTGNVVTQTGKTVVSAGDLV
FT                   QAVGTGQLAPLAPVTTPVGGVVQSVGSAVMGAGNQLGTALSTGAVAELTGSTSKVIVPL
FT                   TTQLANATQTVGGATGLGAPVNNLLVTVGNTVASAGSMITNTNTPIVSPLGGVVTETGK
FT                   TVAVAGGLLHGTGSGAGANPLGSLLSSLPINSLPVANVASAPGSASANPVSGLLGSLPI
FT                   SNLPVVGSVAGAAGGAGGAAGANPLAPVTGLVSGLTGGLTGATGGAASGSGSQNPLAPV
FT                   TNLLGGLTQR"
FT   gene            185811..185984
FT                   /locus_tag="Rmet_6618"
FT   CDS_pept        185811..185984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6618"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45217"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY47"
FT                   /protein_id="ADC45217.1"
FT                   /translation="MQDAARRCRFYCPSFNNWRFLIPKHENLAMLFQTYVPHYADSYLA
FT                   QMGGMDETFHIL"
FT   gene            186104..186295
FT                   /gene="pilA"
FT                   /locus_tag="Rmet_3651"
FT   CDS_pept        186104..186295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="Rmet_3651"
FT                   /product="Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10523"
FT                   /db_xref="GOA:Q1LH53"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH53"
FT                   /protein_id="ABF10523.1"
FT                   /translation="MRQVKASLFRKAQRGATAIEYGLIAGLIAVAIVAGVTNLGQNLGT
FT                   GFSNLATKVTTWFAAVGP"
FT   gene            186633..187094
FT                   /locus_tag="Rmet_3652"
FT   CDS_pept        186633..187094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3652"
FT                   /product="putative tight adherence (TadE/G) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10524"
FT                   /db_xref="GOA:Q1LH52"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH52"
FT                   /protein_id="ABF10524.1"
FT                   /translation="MHLRGKADGRRAKGIAALEFAIVAPLFLTLVLGITYYGTVFVLQQ
FT                   ALTLAAEEGARAALRYPLTSTGGTTASTLDLRVAAAAQTARAMLPTSMSSLISSANVAQ
FT                   PVTCASPSGTQCVQVTLSLPTRSILPSVPMVPVPAVLTGSAMVQLSPDI"
FT   gene            187169..188128
FT                   /gene="cpaB"
FT                   /locus_tag="Rmet_3653"
FT   CDS_pept        187169..188128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB"
FT                   /locus_tag="Rmet_3653"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10525"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH51"
FT                   /protein_id="ABF10525.1"
FT                   /translation="MSSKQIRIVAIVLLVLAGLLALLALQAARHTAAPAPAQGVVATHA
FT                   VVVTTRAVPAGKPLPADALQVLQLPIDPGGAYQDVARVAGQVPLVNLGANVPVLESQLL
FT                   AGLARQIPDGARAMAVAVDEVIGVGNQVQPGDFVDVFVVLRRDSQEIPQSQTRMLLSRL
FT                   RVLAYGTGAVNEAPKQQGEQMMARREGAKTAVLSVPLEQVGTLVMAQQAGRLMLALRNP
FT                   TDEAMPSDGMFADPPGVLQARAGVPPEAQRAPVDKAVAGVSLAGLVGEPRAPQTPAPAM
FT                   RPAALPTGLPGMVATARRDPQNEGNGVEMIRAGKRAIE"
FT   gene            188142..189563
FT                   /gene="cpaC"
FT                   /locus_tag="Rmet_3654"
FT   CDS_pept        188142..189563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaC"
FT                   /locus_tag="Rmet_3654"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10526"
FT                   /db_xref="GOA:Q1LH50"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH50"
FT                   /protein_id="ABF10526.1"
FT                   /translation="MPKKLNHRVLARLVALTMLALAAAPISQTDAQAATQAATQAMSPP
FT                   TGSFDTAGSRTLRLLAGAQQEIRPGQALERVAVGNPEVADALLLKHRGGPSTVLVVARK
FT                   PGVTDLKIWSRDVAPVSYTVRVDAVRPDPGGASVDLSSAGASISGESPDAPAAARTLMA
FT                   ARAAVSSADGKRAGVVVDRSTVPVSGTVQVDVKVVEISKTVLKEIGLNFYRDNGGFAFG
FT                   TFSPSSLTKATFTPGVGTVVDSVSPISSAFNLIAGSVSKGIFANLSLMEANGLVRVLAE
FT                   PSLVALSGQSASFLAGGEIPIPVPQALGTTTIQYKPFGIGLTVSPTVMSRERIALKVAP
FT                   EASDLDPSRGIVLNGATVPAIVTRRADTTIELGDGESFVIGGLVSRNTVSNVSKVPFLG
FT                   DLPVIGSFFKNLNFHQEDRELMIVVTPHLIKPLAKDSPAAAGASQDGRTSANPNVWGRY
FT                   MLGEYADQSLPGFSR"
FT   gene            189575..190813
FT                   /gene="cpaE2"
FT                   /locus_tag="Rmet_3655"
FT   CDS_pept        189575..190813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaE2"
FT                   /locus_tag="Rmet_3655"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10527"
FT                   /db_xref="GOA:Q1LH49"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031580"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH49"
FT                   /protein_id="ABF10527.1"
FT                   /translation="MERNTSVDHFLLNTTREDVRHWLGHALGAVGTLVADADSQDSFVE
FT                   KIGTLRPGLVLLDFTQSRAIDSARLAEQIARLFPQLPLVAVGHAGEPEALLAALRAGVR
FT                   DFIDLGGAPDHAASVARQLMVPRVQVRPVAATRRDGKIVALLGARPGVGVTSLAVNLAA
FT                   AVRRGAQAEVLLLDLGLPARDGALYSNVSPEFHFVEAVRNLRRFDQVFVDTAIVRHTNG
FT                   MSVLPLPASLAEMRDISFSEAMALLDRLREFFDLQVVDLGGFSNAEFMAQIVKAADTVV
FT                   LVAEQSVGAIVSAAELLQELKKREVERDDLHLLVSRFDAELGVDAEQIADRIGVASVGV
FT                   LPERRAALLQAGNRGVVLADQSPADPYVRAIGALLERLGFREGQVPERSVLARIKEKLP
FT                   QVLRPVRAARVGN"
FT   gene            190815..192131
FT                   /gene="tadA"
FT                   /locus_tag="Rmet_3656"
FT   CDS_pept        190815..192131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="Rmet_3656"
FT                   /product="type II/IV secretion system protein, ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10528"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH48"
FT                   /protein_id="ABF10528.1"
FT                   /translation="MTDAIEFSDNAAAPFPVSQEFHNIKEAAHEHLLTRIEELGAEFGR
FT                   WSRAAIQRFVDLELESFTRLRRIPINEAELRQISEALTNELAGFGPIEDLLNDPAVEDI
FT                   LVNGHMDVYVSRHGVLERIPVRFADGGHLLRIVRRILAPIGRRLDESNPMVDARLPDGG
FT                   RINVIIPPLALEGPVVSIRKFRKDPLTPLDLQTLGTMSPEITELLDAAVRARCNILVSG
FT                   GTSSGKTSLLNALATFIPSTERVITIEDTAELALNHPHVVRLESRPGGFEGTGTVTIRD
FT                   LLRNSLRMRPDRIIVGEVRGGEVLEMLQAMSTGHDGSMGTIHASSPRECLYRLEMLAGF
FT                   AGFQGSEVSLRRQIANAIDFIVQIGRLSNGRRRILSITEVTGLGDNIISTQELYRHEPV
FT                   QNPDGTESDRWQSLGILPHSPKLARMRPANFSLDDRFDL"
FT   gene            192121..193050
FT                   /gene="tadB"
FT                   /locus_tag="Rmet_3657"
FT   CDS_pept        192121..193050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadB"
FT                   /locus_tag="Rmet_3657"
FT                   /product="type II secretion system protein, pilus assembly,
FT                   transmembrane part"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10529"
FT                   /db_xref="GOA:Q1LH47"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH47"
FT                   /protein_id="ABF10529.1"
FT                   /translation="MISSASLFIAALAMIMVGLGLLMLAAARSRSRAEDARAHLTAQTE
FT                   QVRARYATVSDPTPQSATRDLRRRWDDLMRRADLKPTRRTYLVVGVPMVLAVLGGAIAG
FT                   GGIGAGAMLVMVLTLLCFFVWLRIRRIKEKMLRQLPGFLDGVVRLMTIGSSVPAAFQNS
FT                   VANTEPPLRQCLVQVIHLQRAGKELDQAVLQMGRAYDLDELVIVSSVLRLSQRYGGRAD
FT                   VVMERTATFMRDREEAQRELMALSAETRMSAWVLGLLPLIVGGGMFVFNAGYILLMWRD
FT                   PGGRAMLLTAAGLEVAGAFLLYRLARSI"
FT   gene            193060..194169
FT                   /gene="tadC"
FT                   /locus_tag="Rmet_3658"
FT   CDS_pept        193060..194169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadC"
FT                   /locus_tag="Rmet_3658"
FT                   /product="type II secretion system protein, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3658"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10530"
FT                   /db_xref="GOA:Q1LH46"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH46"
FT                   /protein_id="ABF10530.1"
FT                   /translation="MDVFTLISISLLVGAVAMILLAWPLMQQWRQRRAAARTIDEALVR
FT                   QATQRAAGAAAQAGATQAGAAPATQPAQQMSPRAAAVAAATAAATAATQGASPAPGVAD
FT                   TRRGSIGAQLGGRISERFNQHWLESRLGKAAVSAEEQQLLEQCGFYGVRPRAVFGALRL
FT                   LVPGILAALAFAWKLDVSLAGALAWAFAAFAGGFLLAKTLLRRRAAQRLRSVADELPIL
FT                   IDMLRLLQGVGLSIDQSLQIIVTEFGSMLQVLGPELQRSNQQFASGRSREQTLLRIGKL
FT                   FDDEDLKGLITLLTQVDRHGGAVQEPLRQFGERLQIARKARMKDKIGRLTVKMTGVMVV
FT                   SLLPVLLILTAGPGFLGVMRMLAQMNGGS"
FT   gene            194170..194991
FT                   /gene="tadD"
FT                   /locus_tag="Rmet_3659"
FT   CDS_pept        194170..194991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadD"
FT                   /locus_tag="Rmet_3659"
FT                   /product="flp pilus assembly protein (TPR domain),
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10531"
FT                   /db_xref="GOA:Q1LH45"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016931"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH45"
FT                   /protein_id="ABF10531.1"
FT                   /translation="MKTVMSPWSRWSPRTLLPASLAMPLAAALLLSGCASTPNTAEVMA
FT                   QQADAQIELAKLRDKEARAEYNDQSVYLGLINRMQTEGMYFASLAHIDAFQQKFGSNPS
FT                   LLAMRADALRETGQDDAALQAYRDLLGTDRAARAHHGIGLVLGRQGDFMRAAGELRQAV
FT                   SMEPVNPQYSSDLGYALMRGGALQDARVPVMQALELDAANPRLISNAVVWLWASGKRAE
FT                   ANAMMQRAAMQEPTRAAIRKEADRVSRAAQVRDKTAPRGAQAVALNAGVKP"
FT   gene            194988..195356
FT                   /locus_tag="Rmet_3660"
FT   CDS_pept        194988..195356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10532"
FT                   /db_xref="InterPro:IPR022053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH44"
FT                   /protein_id="ABF10532.1"
FT                   /translation="MTRNRSRLTDAACAVAISAMLLGAAGAAGAQAAQSTQAVEPPPSP
FT                   TFHPNDVPVGDTTRMLLEVQRNGSQAGPQQSMTGEEAAIGYARYMRSFQYPLPEFFSSQ
FT                   STGSALRGSTGSPAPVGQ"
FT   gene            195365..197092
FT                   /locus_tag="Rmet_3661"
FT   CDS_pept        195365..197092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10533"
FT                   /db_xref="GOA:Q1LH43"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH43"
FT                   /protein_id="ABF10533.1"
FT                   /translation="MRHVTSGSIHPRQRGTVSLMAALLIAAIGVAALVSLDVGFVFYTQ
FT                   RQLQKLVDVAALSGAQQLKSADDQATTNANVLSSVTSAAAQNGYTKAVANDCTTAVAGA
FT                   ADGVRTCLGLWDPANPANGDSTRHFDPGYPATTVSANAVRVQATLTVPLLFMFQGGQSR
FT                   QLHAEAIAAASPPAASFTLGSGLLRLSSGNGLLGLLLGNSVNLSVADWSGLVGANVTLE
FT                   QLRLRAGVGTVDQLLNTSLSIQDFYALVLGAAGQSALLNAALGSPTTQLGLNGIGTKVT
FT                   LGQMLDLGVLTPAASSAAEAALNVATLLTTAAYVARGTSAVDLSTLNVKTALGSIGGSM
FT                   YIIQPPKVAVGPAKQYPDGTWKTTATTAQLGLKLAAQVSVPLVVANVNLNLPLWLQIAQ
FT                   AKGDLTHIQCAAAVPDRRATVNVSTNAVMACLGNPGGTGCSGGPLTIADVQLSAVGLFP
FT                   IADAKMIGQPISQSGLAGAGNSFVLAPGGYVAASSSTVIGDTVTNVINGLNPTLDVSLL
FT                   QLQLLSISPGWLLQQVLNPLLTLINQLVNTLTSLLGISLANADLWLNGVDCNNTELVY"
FT   gene            197104..198468
FT                   /locus_tag="Rmet_3662"
FT   CDS_pept        197104..198468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3662"
FT                   /product="putative transcriptional regulator,
FT                   sigma54-interaction region (Fis family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10534"
FT                   /db_xref="GOA:Q1LH42"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH42"
FT                   /protein_id="ABF10534.1"
FT                   /translation="MKADRWAYESLEVYVWEGKYEIADRVARFLTPLGAEVVRAGALDA
FT                   LPAEPRVKPSIAVISASAIGSAKFTLDWEAAHGMPVIWVGAPDRESDPGRFPPEYAYIL
FT                   PHDFTGADLRTQIAKLMPQLMAAAEARPDVADLVAGSAAMQSLLEQVDTFANFDSNVML
FT                   YGETGAGKERIARLFHDRNATYGKGPFVAVNCGAIPDGLFESQFFGHAKGAFTGAMFAH
FT                   RGFFEQATGGTLFLDEIGDLPLFQQVKLLRVLEENAVTRLGSAMAVKLDFRLVAATNKD
FT                   LREAVTQGRFRADLYFRLAVIELRLPSLEDRGPADKIGLLQSFMRHMIGAAAYDALPPM
FT                   PDWLKGAVGSAFFVGNVRELRNLAERIGITVQQRGEWDEARIRPLFRSLRPGAFDGTER
FT                   ADPRGDAEERRRIIAALDANSWRRQDTATCLGISRKVLWEKMRKFQIEDSEAEPV"
FT   gene            198565..199710
FT                   /gene="sbcD"
FT                   /locus_tag="Rmet_3663"
FT   CDS_pept        198565..199710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="Rmet_3663"
FT                   /product="exonuclease dsDNA SbcCD, ATP-dependent, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10535"
FT                   /db_xref="GOA:Q1LH41"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH41"
FT                   /protein_id="ABF10535.1"
FT                   /translation="MRFLHTADWHLGRLFHARSLIEDQSHVLDQFVALVRDLRPDAVLI
FT                   AGDVYDRAVPPPEAVALLDDVLARIVVDAGVPVVMIAGNHDSAQRLGFGARLLAARGLH
FT                   VAGRTGPETSCVTLHDAHGEVRIYALPYAEPAAVRDALGTDLPTHEAALNAQLDAVRAT
FT                   HPAGVRSVAVAHAFVVGGAVSESERPLSVGGSGAVAADVFHGFDFVALGHLHRPQSIGA
FT                   RIHYSGSLLKYSLSETEHIKTVSLIDVDAEGGVRIEAIPLRPLRELRVLTGTLAGLLEA
FT                   GATDPHRDDYVHAVLTDAGALLDPMARLRQVYPNALAIERAVLARSGQAGEAGRKLREL
FT                   DTASLFANFFREVADTDLDDDQRRALDDLLAVMQASERESA"
FT   gene            199707..202760
FT                   /gene="sbcC"
FT                   /locus_tag="Rmet_3664"
FT   CDS_pept        199707..202760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="Rmet_3664"
FT                   /product="exonuclease dsDNA SbcC, ATP-dependent, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3664"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10536"
FT                   /db_xref="GOA:Q1LH40"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH40"
FT                   /protein_id="ABF10536.1"
FT                   /translation="MKPLYLKLQAFGPFAATETIDFTRLGDQAFFLIHGPTGAGKTTLL
FT                   DAICFALYGDTSGGERSAQDMRSANADPALRTEVTLEFSLGATRYRVTRSPTQDRPSPR
FT                   AAGGFVKETAKAQLDAQVDGEWKSHASQPVRVTDAVRVLLGFDSAQFRQVIVLPQGRFR
FT                   ELLTADSKARQSILERLFQTELYRRVEELLKEQAASIRREAEEISVRRKTLLEQYQLPS
FT                   ELALDERIAAHRETLTELERREALARAGSEAAQASLRKGELESTQIKAWKEAEGAYAVL
FT                   SARVPAVDTDRARLQAARRAAQVTPVAQLLEVARQDQTAALAANAAAGTRVASASRAAD
FT                   IATGALRAEQARGEARLAAQRTVAKLEAILPQARRLGVLRNGVALASTGLAAAQVALTA
FT                   KAKARDAAVAAAKTLEGELELARRDGANAQALQLQLGLARERATRVARCRQLDAELGPL
FT                   RESLAAAEAGASRATQTRDTARVAMRQAESDWRFGQAARLAAGVKRGEPCPVCGGKDHP
FT                   ALAQQTLALVTDEDLDTTRAVLQHADEALADAQAVRQKAEANVAQCQVRLADLREGAGD
FT                   VSDAGVQALDQEIQTLTASGAKAEAAATRAERLAAQTIQARQAQESAEAAVQAAEGALR
FT                   TAMHEHAQQDGEWRAASAQVPEDSRDPDVVTASLEAAQREAGALEAALQAAQGAERDAV
FT                   ALLAGANAALAAAREATTRAEERAAQREAAFVEALATAGFAGADDYRAASLADDATRVL
FT                   DDAVRAFDVDLARAAEWRQRTAEIGQALQTPDMPALLAARDAAAVQLEAAIRQRSELAA
FT                   VRDALLQCKGLLDSLAAEGRDVETRYAVLGRLSEVANGNNPRRMTFQRFVLATLLDEVL
FT                   EAASLRLLRMSRGRYALQRVREQGDQRVAGGLDLEVFDHDTGGTRPANTLSGGEGFLAS
FT                   LSLALGLADVVQSRAGGIQLDTLFVDEGFGTLDPESLDFAIRTLLDLQQAGRLVGIISH
FT                   VTELRERIDVRLEVRPGVAGSQAVLRLP"
FT   gene            203005..204441
FT                   /locus_tag="Rmet_3665"
FT   CDS_pept        203005..204441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3665"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10537"
FT                   /db_xref="GOA:Q1LH39"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH39"
FT                   /protein_id="ABF10537.1"
FT                   /translation="MRIHRRPEAVRALVAAVLVTCAAGAVAQSLPASKAPPATLTPDQQ
FT                   RFHDIYKELVEINTTHSAGDSAQAARAMEKRLVEAGFSASDIQVFEPFPRKGNLVMRFK
FT                   GTGARQPVLLLAHIDVVEAKREDWKTDPFQLQETNGYFTARGSIDDKAMASAFVSVLGQ
FT                   LKQEGFKPSRDIILALTSDEERGDVPSNGADWLVKNKPELLKAEFGINEGGGGELRDGK
FT                   PVLHRVQVAEKMYTTYELEVRDVGGHSSVPTKSNPVYAMSEALSRLGAYQFPVKMADVT
FT                   QTYFARSAPLAKGQLAEDMREVGTGRPSQAAIDRLSAIPFYNAQLRTTCVATMVNAGHA
FT                   ENALPQSAKAIVNCRILPHDDPADIDRQLKSALGNDKISVRYINKPLASPASPLDGALM
FT                   KEVDALTKQMWDVPVIPAMSTGATDSRFMRNAGIRMYGVSGLFTEPSDMRAHGLDERIE
FT                   IARLYDGREFLYRLVKRLSE"
FT   gene            204661..204945
FT                   /locus_tag="Rmet_3666"
FT   CDS_pept        204661..204945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3666"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10538"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH38"
FT                   /protein_id="ABF10538.1"
FT                   /translation="MEFVSRTLWESGEQGRKLLTFAGIRSKHLHEAAARWLTKQLQDCW
FT                   TVLDGPPRTERGDIRQDARPATAGDSFACRAPLRPVPVCAPDPSILERK"
FT   gene            204966..205631
FT                   /locus_tag="Rmet_3667"
FT   CDS_pept        204966..205631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3667"
FT                   /product="3-oxoacid CoA-transferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10539"
FT                   /db_xref="GOA:Q1LH37"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH37"
FT                   /protein_id="ABF10539.1"
FT                   /translation="MESAMADIHDGATILIGGFGLAGMPAELIDALIAQGARDLTIVNN
FT                   NAGNGDTGLAALLKAKRVRKIICSFPRQADSYVFDSLFHAGEIELELVPQGNLAERIRA
FT                   AGAGIGGFFTRTAYGTPLAEGKETRIIDGQGYVFEKPIHADFALIKAETADRWGNLVYR
FT                   KTARNFGPIMAMAAKCPIVQVSNVVELGELDPEHIITPGLFVKRVVKVASAAKPASAA"
FT   gene            205660..206307
FT                   /locus_tag="Rmet_3668"
FT   CDS_pept        205660..206307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3668"
FT                   /product="3-oxoacid CoA-transferase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3668"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10540"
FT                   /db_xref="GOA:Q1LH36"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH36"
FT                   /protein_id="ABF10540.1"
FT                   /translation="MQRLTRDQMAARVAKDIPDGAVVNLGIGLPTLVGNQLPADREILL
FT                   HSENGLLGMGPAPAPGEEDGDLINAGKQPVTIKPGGSYFHHADSFAMMRGGHLDFCVLG
FT                   AFQVSEKGDLANWHTGAPGAIPAVGGAMDLAIGAKQVFVMMEHLTKQGESKIVSQCTYP
FT                   LTGIGCVTRVYTDLATIDVTPDGLVARDLVDGLSFDELQRLTGVPLKQAVAA"
FT   gene            206336..207538
FT                   /locus_tag="Rmet_3669"
FT   CDS_pept        206336..207538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3669"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10541"
FT                   /db_xref="GOA:Q1LH35"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH35"
FT                   /protein_id="ABF10541.1"
FT                   /translation="MSEAFIVDAIRTPIGRYAGSLSGVRADDLGAVPLKALMARNASVD
FT                   WSAIDDVIFGNANQAGEDNRNVARMSALLAGLPDAVPGATINRLCGSGMDATGTAARAI
FT                   KAGEANLMISGGVESMSRAPFVMGKATSAFSRDAQIFDTTIGWRFINPAMRAAYGVDSM
FT                   PETAENVATDYKIGREDQDLMALRSQEKASRAQADGTLAQEITPVTIPQKKGDAIVVDR
FT                   DEHPRATSMEALAKLRGVVRPDGTVTAGNASGVNDGACALLLASEAGLKQHGLKPRARI
FT                   VGMATAGVAPRVMGIGPAPATQKLMKQLGMTLDQIDVIELNEAFAAQGLAVLRQLGIAD
FT                   DDKRVNPNGGAIALGHPLGMSGARLVTTAMYQLERTGGRFALCTMCIGVGQGIAMVIER
FT                   V"
FT   gene            207798..208529
FT                   /locus_tag="Rmet_3670"
FT   CDS_pept        207798..208529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3670"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10542"
FT                   /db_xref="GOA:Q1LH34"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH34"
FT                   /protein_id="ABF10542.1"
FT                   /translation="MSLPVATLVTGASSGIGRAIAEMLLADGVTRVINVDYAAPTWSHP
FT                   NMTFFQADLTNADATRAVAEQVTSQFAVTRLVNNAGATRPGTADTATAEDLDYVVGLTL
FT                   QATMLLTQACLPAMRAAGFGRIVNMASRAALGKPERVVYSAAKAGLVGMTRTLAMELGG
FT                   DGITVNAVAPGPIATELFRRSNPEGSEQTRRILASIAVKRMGTPEDVARASLFFLAPEN
FT                   GFVTGQVLYVCGGTTLGVAPV"
FT   gene            208633..209637
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3671"
FT   CDS_pept        208633..209637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3671"
FT                   /product="Extra-cytoplasmic Solute Receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10543"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH33"
FT                   /protein_id="ABF10543.1"
FT                   /translation="MSITKQTSKARRRLLAVGVALATGVAAMTGAQAQGTYPTKPITMI
FT                   VPFSAGGTTDILARIVGLQLGKALGQPVVIDNRPGAGGNIGASLAAKAPGDGYTLFMGT
FT                   IGTHAINQSLYSKLPYDPVKDFAPITRVAMVPNIVVVNPKVPVNNIKELIAYVKANPDK
FT                   LSYGSSGSGSSMHLSGELFNSMTGLHIQHIPYKGSAPAVNDLLGNQIGLMFDNMPSSYP
FT                   HVKAGKLRAIAVTSAKRSPALPNVPTVAESGVPGYEATSWFALYATGGTPQAVVDRLNA
FT                   EVVKILAMPEVKKQMAEQGAEPHPEKPAELAAFMKSEAAKWAKVVKASGATVD"
FT   gene            complement(209834..210043)
FT                   /locus_tag="Rmet_3672"
FT   CDS_pept        complement(209834..210043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH32"
FT                   /protein_id="ABF10544.1"
FT                   /translation="MNARPDATAGTAAAEATKPVTRTRAGTAPFYYRLPDTPEGHHIKE
FT                   YASGLRQLVRFVGVEEQVVKYSLS"
FT   gene            210370..210939
FT                   /locus_tag="Rmet_3673"
FT   CDS_pept        210370..210939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3673"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10545"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH31"
FT                   /protein_id="ABF10545.1"
FT                   /translation="MSTQHALLISLIEKPSSGYDLARRFDKSIGYFWHATHQQIYRELG
FT                   RMAELGWIASDEPEVTVDGDGAEKKGRKKVYRVLPAGHDELVRWVLAPVQGLDQREEIL
FT                   VKLRADAAIGPLGLDKEMGRLIALHEARLETYRGIERKDFSGTLDRRQQIQYALLQRGI
FT                   QFQESWLAWGRSLLPLLTATGSGVKD"
FT   gene            complement(210973..211962)
FT                   /locus_tag="Rmet_3674"
FT   CDS_pept        complement(210973..211962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3674"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10546"
FT                   /db_xref="GOA:Q1LH30"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH30"
FT                   /protein_id="ABF10546.1"
FT                   /translation="MALPALLQNLSLPAVCSPLFIISNPDLVIAQCKAGVVGSFPALNA
FT                   RPAEKLEEWLDRITTELGEHNAKHPDRPAAPFAVNQIVHKSNDRLEHDLEMCVRYKVPI
FT                   VITSLGARVEVNEAVHSYGGIVLHDVINNTFARKAIEKGADGLIAVAAGAGGHAGTLSP
FT                   FALLHEIREWFDGPLLLSGAIASGDAVLAAQAAGADLGYIGSAFIATLEANAQDAYKQM
FT                   IVDSSADDIVYSNLFTGVHGNYLRESIVRAGLDPAALPTSDASKMNFGSGSAKAWKDIW
FT                   GAGQGVGAIKRVVPAAELVRRFVEEYALARRRLGLAAPAGAARAVDLA"
FT   gene            212143..213219
FT                   /gene="int"
FT                   /locus_tag="Rmet_3675"
FT   CDS_pept        212143..213219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="Rmet_3675"
FT                   /product="phage integrase / Tyr recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10547"
FT                   /db_xref="GOA:Q1LH29"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH29"
FT                   /protein_id="ABF10547.1"
FT                   /translation="MTQASADFVTADGETPATSGDLFDADLDAWRKHPDRAFDGWLARH
FT                   GFRHGTAVVYRAMWGKLLRWSGEQGLTPLTWSAAQIGAFLDAQNLHKRHRYRYARLIER
FT                   VFHHLSQLQQNLHNPASQAVKSHLADGENDPTAFLLPGERDLLVARILAPAPEPVAEAA
FT                   RPDSQAISPKQWKRARDVALLAVLLGGGLKVAEARALRVEAIEGLGGGAMAIRMVRTDN
FT                   GRAYTVPLFGFVHAPLRRWLETRAAAETLGDLVFPAMTNGRAMHAASVYRRVEILLEEA
FT                   GVLAGRSERASPQTLRNTCGAMHFDAGTPPAAVAQLLGMRDMESGWRLRAAYEAWQART
FT                   GLPVMGRPLSRPNGGSGA"
FT   gene            213312..214331
FT                   /locus_tag="Rmet_3676"
FT   CDS_pept        213312..214331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3676"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10548"
FT                   /db_xref="GOA:Q1LH28"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH28"
FT                   /protein_id="ABF10548.1"
FT                   /translation="MAETLLLTGATGYIASHTWVALHEAGYNVIGLDNLCNSSAEVVNR
FT                   LAKITGTTPHFVEGDVRDRALLDRLLAEHKINGAIHFAALKAVGESVSKPLEYYGNNLE
FT                   GLITLCSAMQSAGVRQLVFSSSATVYGNPHAMPILENFPLSATNPYGQTKLMGEQILRD
FT                   LEISDPEWKIAFLRYFNPVGAHESGTIGEDPGGIPNNLMPYVAQVAAGRREKLSVYGGD
FT                   YPTPDGTGVRDYIHVSDLADGHVAALAYLGKNSRGMTVNLGTGRGYSVLEVVKAYERAS
FT                   GRPIPYEIVARRPGDIAECYADPGIARTLLGWSARHDLDRMCEDSWRWQSLNPVGFTA"
FT   gene            complement(214533..214841)
FT                   /gene="stpA"
FT                   /locus_tag="Rmet_3677"
FT   CDS_pept        complement(214533..214841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stpA"
FT                   /locus_tag="Rmet_3677"
FT                   /product="Histone-like nucleoid-structuring protein
FT                   HNS-like: transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10549"
FT                   /db_xref="GOA:Q1LH27"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH27"
FT                   /protein_id="ABF10549.1"
FT                   /translation="MATYQEIVQKISELQKQAEEIKAREQASVIADIREKIEQYGLTAE
FT                   DLGFGGKAVAGKKAVSRKVPVRYRDSAGNTWTGRGKRPGWLTQALANGKSMEDFLIR"
FT   gene            215393..217210
FT                   /locus_tag="Rmet_3678"
FT   CDS_pept        215393..217210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3678"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10550"
FT                   /db_xref="GOA:Q1LH26"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH26"
FT                   /protein_id="ABF10550.1"
FT                   /translation="MSFHQNIQIKTLLRGAMALLTANLLLVGGAGLLGISQSNGALKET
FT                   YSNQLASSQALSEAMLGTTRLRLALDRGVMRGSENDDLKKHVDRANVFIESSDKGWKTY
FT                   MSLPQNDDEKALAGELAAKRQAFFETGVKPLEQAMVAGNHDEALRLARDVLPDLQRGMS
FT                   AAHEKLEKFQFDTGKANFEGAQSRYETTRAMSLALIALGILVAVFATVMLHRAIVRPVQ
FT                   EALDVFERMTRGDLTSRISSMSKNEIGRMMQALATMQESIAGIVAEVRGGTDSMASATQ
FT                   QISAGNTDLSQRTEEQAASLEQTAASMEELTTVVRQNADNARQAGALAGEASEIAMKGG
FT                   DVVGRVVDTMNEINGASRKVVDIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRSLAQRSANAAKEIESLINESGQRVESGTRLVAEAGQTMGEIVHAVRRVTDIMNEI
FT                   SAASQEQTTGIEQVNQAVAQMDQVTQQNAALVEEAAAAAGALEEQAQKLKGVVSVFTLV
FT                   SDGGNARANAGAQRAVHSLATSPTSAPATAPASAPAMARSAERASPPAMLPPNRRSPVA
FT                   RMSAESRPLRPSASQPAAAATADDDWATF"
FT   gene            217347..219329
FT                   /locus_tag="Rmet_3679"
FT   CDS_pept        217347..219329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3679"
FT                   /product="diguanylate cyclase/phosphodiesterase (GGDEF and
FT                   EAL domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10551"
FT                   /db_xref="GOA:Q1LH25"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH25"
FT                   /protein_id="ABF10551.1"
FT                   /translation="MIATSSSLLLLAALLGIAAAVGVRAAKTEGGPGRKAMWSMTWPAA
FT                   LMSHGMLGMPLWVTLASGTLTAANDGARMAATFAATLAASLAASHLFGPPLQWLRQGAR
FT                   GWRVAVAAAMLAGAGLVAVAGARLGRACGGTVMTARACIDTADFSEASFLACGIALLCV
FT                   AMFAMHRAQARGWLQGQAELAMHDDVADDHATMPMLRAGDGRVSRRGPGRIPGLTIRPS
FT                   GSGLSPVGEYSVSTDLPDRTAFARWLDQSIAHARLAETGCAVLLIHIADYREVDEVFEV
FT                   RADDILAQDAGALAQAALEPHDFLARLARDEFAVGVPNLVHHSRAHDLGSRVLGSLAEF
FT                   VAARGLQMQIGVNIGIAIYPRDAATSEGLMQAARVSLSEARESGSNQVRVFNSAAGERA
FT                   RRTRVIRRDLWPAIQDDGLSLMFQPKFDVKTRQVVGAEALCRWRHPTLGAVSPVEFIMV
FT                   AEQSGQIDKLDDWVISRVCGQVRSWQDAGLPVVPVAINVSGTRFASRNFPRYLLEHIHQ
FT                   HDIPPSAITLEITETAAMKDIAKSLETLAELQSLGIQVALDDFGSGYSSLGYLKRLRVG
FT                   TLKIDRTLIGGLDADPQGRAIVGSMVALAHELRMKVVAEGVESASQLEILHGMGCDEVQ
FT                   GYLLAVPLDSPGFADVLHAARPLAV"
FT   gene            219489..219872
FT                   /locus_tag="Rmet_3680"
FT   CDS_pept        219489..219872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3680"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10552"
FT                   /db_xref="GOA:Q1LH24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH24"
FT                   /protein_id="ABF10552.1"
FT                   /translation="MSLLSILVVDDSPSLRRMTSACLRAGGYGVTEASDGKEAYEVARE
FT                   GNFDMLVTDQVMPVMDGLSLIRALRAMPDYATVPMLMLSTEHDDAILERAREAGASGFL
FT                   AKPFDPDELMASVDALLGPPNVG"
FT   gene            219960..220511
FT                   /gene="cheW"
FT                   /locus_tag="Rmet_3681"
FT   CDS_pept        219960..220511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="Rmet_3681"
FT                   /product="purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10553"
FT                   /db_xref="GOA:Q1LH23"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH23"
FT                   /protein_id="ABF10553.1"
FT                   /translation="MRGNGKGTPARQRSTMPAGATMNISINRTDGSGEEFLAFRLGREE
FT                   YGIDILKVQEIRGYETVTQIANAPAYLKGVINLRGTIVPIIDLRIKFNQAQISYDQYTV
FT                   VIIVDIHERTTGIVVDGVSDVLTLAPAQIKQAPTLSGGVETDYIRGIGSLEGRMLILAD
FT                   IEKLMNVDDLAAIEAAAGAA"
FT   gene            220629..222287
FT                   /gene="aer"
FT                   /locus_tag="Rmet_3682"
FT   CDS_pept        220629..222287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aer"
FT                   /locus_tag="Rmet_3682"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10554"
FT                   /db_xref="GOA:Q1LH22"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH22"
FT                   /protein_id="ABF10554.1"
FT                   /translation="MRNNQPVTQREHPLPPDVYLISRTDLKGRITFANRTFVEVSGFTS
FT                   DELLGAAHNLVRHPDMPPEAFADLWDSLQAGKSWVGVVKNRCKNGDHYWVQATVTPTRV
FT                   GDRVVGYTSVRSMASREQIGAADAAYRRFRENRAGGLAIRDGAVVRTGLAGLVGRVTRI
FT                   TLKRRILWAQLAGLVWFLAAIAGVHWLAEEQAAQLWPWLWGAFGFAVLSSFMAGSMLVS
FT                   RVERPVREMLDFALRMGAGDLTSNFEHRSADEVGELSRAMRTMQRSLQSVVNDIQGGMA
FT                   SISAATHQVAAGNNDLSQRTEQQAASLEETASSMEQLTSTVRQNADNAHQATRLAADAS
FT                   ETAVRGGEAVGRVVQTMDEINEASRKIVDIIGVIEGIAFQTNILALNAAVEAARAAEQG
FT                   RGFAVVAGEVRSLAQRSANAAKEIKGLIGNTVARVESGAEQVSQAGATMDEIVQAVKRV
FT                   TDIMGEISSASAEQSAGIEQVNEAVTQMDDVTQQNAALVEQAAAAAGSLEEQAERLRES
FT                   ISTFRVSMQAEVRPPRKRQVATMGETGKEAGLVNA"
FT   gene            222326..224167
FT                   /locus_tag="Rmet_3683"
FT   CDS_pept        222326..224167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3683"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10555"
FT                   /db_xref="GOA:Q1LH21"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH21"
FT                   /protein_id="ABF10555.1"
FT                   /translation="MQWFNQLRVTTRLIAGFLVVSVIGAIIGLLGVVNMGRMTEWTGKI
FT                   YNSDLQALKAVQDGNINLVYASRAQIALLSASTMGERATEREQIEKSLSTLETRVKSAR
FT                   DSFTTPQGQALFKQYETLLPPFRERMQKYVELIGKQPLDTSQFESIVFTESAELIKDSR
FT                   ALEDLLLKIVKRRDERAKANMDESTSVYNHSRVLMLALVLGGLAVSVLLGGFLARQLSR
FT                   QLGGEPGYAAAIAARIAEGDFSDAVNLRAGDRTSLLHAMDQMQQQLSRMVRDFKVSAES
FT                   IGSASSEIAAGNNDLSQRTEQQAASLEETASSMAQLTSTVRQNADNARQASGLAANASE
FT                   TAVRGGEVVGRVVQTMGEINDASRKIVDIIGVIEGIAFQTNILALNAAVEAARAGEQGR
FT                   GFAVVAGEVRSLAQRSANAAKEIKTLIDNSVAQVDTGAALVSQAGTTMDEIVQAVKRVT
FT                   DIMGEISAASAEQSSGIEQVNQAVSQMDEVTQQNAALVEQAAAAAGSLQDQASRLMASV
FT                   SGFRLSHGDDAVPALAAPAPAVRPAARPSGAKRLPAPARPVRKTAAKAAGTALAATSGA
FT                   AAAVEESVEAADSQLKRPAISASTTISASDNGDWSAF"
FT   gene            224276..225028
FT                   /locus_tag="Rmet_3684"
FT   CDS_pept        224276..225028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10556"
FT                   /db_xref="InterPro:IPR025146"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH20"
FT                   /protein_id="ABF10556.1"
FT                   /translation="MNTDISLSLSAEASARLRADFDAFVKVSTGLDAQFIPPAFDDFLR
FT                   ARLMQQDGPLTERAVMRLLASGEYGWAKKVFDKQLPNALAALMRDAQRFGFGLAVQPDW
FT                   TPQQRVEHARQWATQILSEAGADAAFTEALAAQISASAVDIRTLEERMKTPAWRVADGL
FT                   RQRAYDVMYGLQTEQSEALGRSKVGELRVLLGLALEYGSIGAEEAARVLEQVERACPHL
FT                   FREAPDDVFARLAAWLRRVFSQGALVRQ"
FT   gene            225427..225744
FT                   /gene="flhD2"
FT                   /locus_tag="Rmet_3685"
FT   CDS_pept        225427..225744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhD2"
FT                   /locus_tag="Rmet_3685"
FT                   /product="DNA-binding transcriptional dual regulator with
FT                   FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10557"
FT                   /db_xref="GOA:Q1LH19"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH19"
FT                   /protein_id="ABF10557.1"
FT                   /translation="MESSEVLQEIREVNLAYLLLAQRLVRENQVEAMFRLGVSKEIAEI
FT                   LAKLTSAQLVKLAASNMVLCRFRFDDHALLSTLTHTAKSHDMQQIHAAILLARQPVESL
FT                   N"
FT   gene            225741..226346
FT                   /gene="flhC2"
FT                   /locus_tag="Rmet_3686"
FT   CDS_pept        225741..226346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhC2"
FT                   /locus_tag="Rmet_3686"
FT                   /product="DNA-binding transcriptional dual regulator with
FT                   FlhD"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10558"
FT                   /db_xref="GOA:Q1LH18"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH18"
FT                   /protein_id="ABF10558.1"
FT                   /translation="MTALLQASPARSFAATPIPNRKSVLQDANQTQLAIELIGLGARLQ
FT                   VLEAETTLSRDRLIRLYKELRGASPPKGMLPFSTDWFTTWLPNIHSSLFFSAYQFMVQE
FT                   GETSGIRAVVAAYRLYLEHVSLLGGEIVLSFTRAWTLVRFFESNMLQLSSCTCCGGQFV
FT                   THAYEPHTNFVCSLCRPPSRAGKVKKLSKDAAAAQTEA"
FT   gene            226433..227332
FT                   /gene="motA"
FT                   /locus_tag="Rmet_3687"
FT   CDS_pept        226433..227332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Rmet_3687"
FT                   /product="chemotaxis MotA protein, proton conductor
FT                   component of flagella motor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10559"
FT                   /db_xref="GOA:Q1LH17"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH17"
FT                   /protein_id="ABF10559.1"
FT                   /translation="MPDACFSDGDPIVLVVLGYVVVVVAVLGGYALTGGHMGALYQPAE
FT                   LIIIGGAAVGAFISSNSGKAIKATMKAMPSLLKGSKYKKELYLDVMALLYVLLSKARRE
FT                   GILFLEKEIADPASSSVFSQYPRILADAKMMEFLTDYLRMMVNGNMNAFEIEALMDHEI
FT                   ETVRHEAEIPAHALSRVGDGLPAFGIVAAVMGVVHALASADLPPAELGALIANAMVGTF
FT                   LGILLAYGFVSPLASRVEHQVSESIKMYECIKVTLLASLNGYAPLVAVEFGRKVLYSTV
FT                   RPSFLELDDHVREVKSLT"
FT   gene            227346..228323
FT                   /gene="motB"
FT                   /locus_tag="Rmet_3688"
FT   CDS_pept        227346..228323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="Rmet_3688"
FT                   /product="OmpA/MotB, protein that enables flagellar motor
FT                   rotation"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10560"
FT                   /db_xref="GOA:Q1LH16"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH16"
FT                   /protein_id="ABF10560.1"
FT                   /translation="MSSAQDLRPIVIKKAKSHAKPHGNHSWKIAYADFMTAMMALFLVL
FT                   WLLSSSSPKVLVGVAEYFRTPLKVAIAGGDKSSLSTSVIPGGGKDVTAKDGEIMKAQTN
FT                   DPAADAQRRRDQIESERLRGLKKRLEQIIENNPVLRQFRPQLLLDITSEGLRIQILDTQ
FT                   NRPMFRTGSAAVEPYMRTILREIGPVLNELPNKVSLSGHTDSAKYMMGQRAYSNWELSA
FT                   DRANASRQELVAGGMEEGKLLRVLGLADTMPLEKNDPLAPVNRRISIVVLNQRAQAQFE
FT                   AENASAADVTVQAQKGQAAQDVQAQLGSASAAGAGESKGKGKGE"
FT   gene            228384..230399
FT                   /gene="cheA"
FT                   /locus_tag="Rmet_3689"
FT   CDS_pept        228384..230399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="Rmet_3689"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3689"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10561"
FT                   /db_xref="GOA:Q1LH15"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH15"
FT                   /protein_id="ABF10561.1"
FT                   /translation="MSVDIDITQFYQTFFEEAEELLVQMEQLLLEVDIESPDAEALNAI
FT                   FRAAHSIKGGAATFGFTALTETTHIFENLLDRTRRRELALSRVIIDTFLETKDVLHDQL
FT                   NAYRNGTEPDPETLARICAVLQQLAQEASGEAAPAPAATPAPVAASAPAAAPAGGNLKV
FT                   SLIKVSAADQALLREELANLGEITGQQESDGDLIIWLNSQCSPDDIIAVCCFVIDEKQI
FT                   AVETVTPGEAPAAPVGAPTPAPVAAPAAVAPVAPAAAPVAAKEKEKAKPAAAHSPDAGS
FT                   IRVPTEKVDQIINLVGELVITQSMLAQTASSLDPVLFDRLFSGMGQLERNARDLQEAVM
FT                   SIRMMPMDYVFSRFPRLVRDMMGKLGKQIDLVTFGKATELDKGLIERIIDPLTHLVRNS
FT                   LDHGIETPEKRIAAGKEPTGQLILSAQHAGGNIVIEVSDDGAGLNRERILAKAMQNGLP
FT                   VSESMPDDEVWQLIFAPGFSTAEVITDVSGRGVGMDVVKRNIQEMGGHVEISSRAGLGT
FT                   TTRIVLPLTLAILDGMSVRTGEETFILPLNCVMESLQPLADDVHTAANGERVMNVRGEY
FT                   LPLLELHKVFNVANAVQEPTQGIAVILAAEGKRFALLVDQLIGQHQVVLKNLETNYRKV
FT                   PCISAATILGDGSVALIVDVGALQRTGVRRQAPMAA"
FT   gene            230424..230918
FT                   /gene="cheW"
FT                   /locus_tag="Rmet_3690"
FT   CDS_pept        230424..230918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="Rmet_3690"
FT                   /product="CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10562"
FT                   /db_xref="GOA:Q1LH14"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH14"
FT                   /protein_id="ABF10562.1"
FT                   /translation="MAGIGHIDTQGSEASGQEYLVFTLGTEEYGIDILKVQEIRSYETV
FT                   TRIANAPDFLKGVTNLRGVIVPIVDLRLKFKLGNVRYDHQTVVIILNVAGRVVGIVVDG
FT                   VSDVLTLTGDDIKPAPEFGVSVSNEHLTGLGSVEGRMLILIDIERMMTSPEMELIEAEL
FT                   A"
FT   gene            230982..231893
FT                   /gene="cheR"
FT                   /locus_tag="Rmet_3691"
FT   CDS_pept        230982..231893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="Rmet_3691"
FT                   /product="chemotaxis regulator, protein-glutamate
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10563"
FT                   /db_xref="GOA:Q1LH13"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH13"
FT                   /protein_id="ABF10563.1"
FT                   /translation="MTPLRSSSSAIRKPGAAMTPGAPVLAPLRDEMRDFLLTERDFEKI
FT                   RALIHKRAGISLGSHKREMVYSRLARRLRTLQLADFSTYLAQLEADERSSEWEYFTNAL
FT                   TTNLTSFFREAHHFPLLAEHAKKIGRPYSVWCAAASTGEEPYSIAITLAEALGERAGTV
FT                   LATDIDTQVLAKARSGIYTAEQVSRLSQERLKRFFLKGTGARAGSVKVKPELAATVTFE
FT                   PLNLLAPDWGLREKFDAIFCRNVMIYFDKPTQGQILERFAPLLKPNGLLFAGHSENFSY
FT                   VTRAFQLRGQTVYELTNKSGAA"
FT   gene            231890..232552
FT                   /gene="cheD"
FT                   /locus_tag="Rmet_3692"
FT   CDS_pept        231890..232552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="Rmet_3692"
FT                   /product="Probable chemoreceptor glutamine deamidase cheD"
FT                   /EC_number="3.5.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10564"
FT                   /db_xref="GOA:Q1LH12"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LH12"
FT                   /protein_id="ABF10564.1"
FT                   /translation="MMRGTPQMPEAIATRKYFDREFDRQAIKLLPNEYYVTAEDVVLTT
FT                   VLGSCVSACIRDEVAGVGGMNHFMLPDDENAGADRMLSTSMRYGCYALEVLINELLKMG
FT                   ARRERLEAKVFGGGAVLANMTTLNIGDRNADFVLKYLRTEEVRVAAQDLRGPHARRVSY
FT                   FPRTGLALVRRLTRQDDTVGIEREERALARALSTSTKAPARGAVELFTRQTTARIPT"
FT   gene            232620..233693
FT                   /gene="cheB1"
FT                   /locus_tag="Rmet_3693"
FT   CDS_pept        232620..233693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB1"
FT                   /locus_tag="Rmet_3693"
FT                   /product="Chemotaxis response regulator protein-glutamate
FT                   methylesterase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3693"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10565"
FT                   /db_xref="GOA:Q1LH11"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LH11"
FT                   /protein_id="ABF10565.1"
FT                   /translation="MTAAKIKVLCVDDSALIRSLMSEIINSQPDMEVVGTAPDPLVARD
FT                   LIKRVNPDVLTLDVEMPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAV
FT                   DFVTKPKLGIREGLLDYTQTIADKIRAASRARVRARAEQSAGAAPVAPMLRAPLLSTEK
FT                   LIIVGASTGGTEAIKDFLTPLPPDSPAVMIVQHMPAGFTKSFAHRLNGLCRITVKEAEH
FT                   GERVLPGYAYIAPGDSHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAIHGGKNV
FT                   TGVILTGMGKDGARGMLRMREAGAYNLAQDEQSCIVFGMPKEAIAAGGVHEVVPLHQMS
FT                   QRVMAHLATFGARAQRV"
FT   gene            233733..234152
FT                   /gene="cheY"
FT                   /locus_tag="Rmet_3694"
FT   CDS_pept        233733..234152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="Rmet_3694"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3694"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10566"
FT                   /db_xref="GOA:Q1LH10"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH10"
FT                   /protein_id="ABF10566.1"
FT                   /translation="MAIRNRFGAVTVDKNIKILVVDDFPTMRRIIRNLLKELGFTNVDE
FT                   AEDGAAGLEKVKDGSFQFVVSDWNMPNMDGLTMLQTIRATPEIAKTPVLMVTAEAKKEN
FT                   IIAAAQAGANGYVVKPFTAATLDEKITKIFEKMGQ"
FT   gene            234165..234800
FT                   /gene="cheZ"
FT                   /locus_tag="Rmet_3695"
FT   CDS_pept        234165..234800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="Rmet_3695"
FT                   /product="Chemotaxis phosphatase, CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3695"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10567"
FT                   /db_xref="GOA:Q1LH09"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH09"
FT                   /protein_id="ABF10567.1"
FT                   /translation="MSTTPTFSNEAAEQIIHRIGNLTRMLRDNMRELGLDKEIERAAQA
FT                   IPDARDRLSYIAAMTEQAAERSLTAVELAQPLQEELEAKATALDKRWGEWFEQPVELGD
FT                   ARALVLDTREFLTEVPEKTKATGSHLLEIMMAQDFQDLTGQVIKKMMDMIRTLEQELLQ
FT                   VLIDNVPADRRVEAPPSLINGPQINPEGKADVVSDQSQVDDLLASLGF"
FT   gene            234929..236287
FT                   /locus_tag="Rmet_3696"
FT   CDS_pept        234929..236287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3696"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10568"
FT                   /db_xref="GOA:Q1LH08"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH08"
FT                   /protein_id="ABF10568.1"
FT                   /translation="MPARCTVVALAAAALAGMLVGIAHAQTLPLPQVSPAVDTAYTKLE
FT                   ASPAYKKLMTDVRADDARALTELKTMTEIPAPPFKERSRAEYFVSRLKALGLADAHIDA
FT                   EGNAIGIRKGVGNGPKLLISAHLDTVFPEGTDVTVKARDGKLYAPGIGDDTRGLAVLLS
FT                   WLKVLNDNNVRTAGDLVFVGNVGEEELGNLRGMKAVFREHPDIDGMVGIEPGTGDRVLT
FT                   QGTGSHRYEVTFRGPGGHSFGAFGLPSAIHAMGRAISKISDVRTPSDPKTTFTVGTVSG
FT                   GTSVNAIAGDARMAVDIRSNGTPALLETEKHIMDAIAAGVADENRRWAPAKSQEITFQT
FT                   KLIGDRPAGQTPTDSVIVQSAVRVIRANGKEPPTLRGGSTDANVPMALGIPAIIIGSGG
FT                   KSGGAHSRDEWFDPTNAWEGAQWGLTTVLGLVGVDGVEAPLLARRRGNPPITR"
FT   gene            236403..237134
FT                   /locus_tag="Rmet_3697"
FT   CDS_pept        236403..237134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10569"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LH07"
FT                   /protein_id="ABF10569.1"
FT                   /translation="MTDTPDTPDTPMATGASSRPPLRALTPLEGRVVAVLLEKQFTVPD
FT                   TYPLSLNALAAGCNQKTARSPVMSVGEDEILTAIDGLKSLSLVFEGSSSRVPRFEQNLA
FT                   RVLGVPSQSAALLSTLLLRGPQTAAELRLNTARLHAFADISSVEAFLDELAERDPALVV
FT                   KLPRGPGEREHRWTHLLCGEVSLAEAPGLRTSASIEIAPSELEALRISHRELEDKVARL
FT                   QALVEEMAEQLGISIDPDRLS"
FT   gene            237413..238555
FT                   /gene="flhB"
FT                   /locus_tag="Rmet_3698"
FT   CDS_pept        237413..238555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="Rmet_3698"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10570"
FT                   /db_xref="GOA:Q1LH06"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH06"
FT                   /protein_id="ABF10570.1"
FT                   /translation="MSEESDLEKTEPATARRLEKAREEGQVVRSRELGTFAMLMTGVIG
FT                   LWATGGVLGRKLDAVMHAGLAFEPATAFDTNRMLSQFAAIVWDALLAFLPLLLMFGVAA
FT                   LVTPLALGGWMFSTKSFSPDFSRMSPISGLGRLFSAHSLVELAKAIAKSLLVGGVGAWM
FT                   IWRKLPEAIALMDAPIQEALLHMMELVLYVSGVVAGSLILVAALDVPWQLYTFHKKLRM
FT                   TKEEIKQEMKETDGDPHIKARIRQQQRAIARRRMMAEVPKADVVVTNPTHYAVALRYEE
FT                   GRMGAPRVVAKGADEVAARIRELAAEHRVPMLSAPPLARALHRHVELGHEIPAGLYTAV
FT                   AEVLAWVYQLKNWHYSYGPQPNGPADLVVPDELAVPESRA"
FT   gene            238552..240639
FT                   /gene="flhA"
FT                   /locus_tag="Rmet_3699"
FT   CDS_pept        238552..240639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="Rmet_3699"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10571"
FT                   /db_xref="GOA:Q1LH05"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH05"
FT                   /protein_id="ABF10571.1"
FT                   /translation="MNALTNILNMPGLRSGAQMKALAGPVLIIMILGMMILPLPAFVLD
FT                   LLFTFNIALSIMVLLVGMYTQRPLDFAAFPAVLLFSTLLRLSLNVASTRVVLLEGHTGP
FT                   DAAGKVIEAFGHFLVGGNFAVGIVVFAILVVINFMVITKGAGRIAEVGARFMLDAMPGK
FT                   QMAIDADLNAGLINEEGARKRRAEVAQESDFYGAMDGASKFVRGDAIAGLLVMFINVVA
FT                   GMVVGMVQHDLDFGTAVHNYTLLTIGDGLVAQIPALVISTAAGVIVSRVSNEQDVGQQL
FT                   TGQLFSNPRVLFITAAIIGMMGIIPGMPHFAFLLLAAGLIWLGRHMMRREATAEETKSN
FT                   EARAPAAPAEAAEASWEDVTMVDPLGMEVGYRLITLVDRAQNGELLGRIKSIRKKIAQD
FT                   IGFLVPVVHIRDNLELKPTAYRITLKGVEVGSGEANPGQWMAINPGQVTGTLPGAATRD
FT                   PAFGLPAVWIDAALKEQAQAYGYTVVDASTVVATHLNHLIQMHASELLGRQEVQSLLDR
FT                   IAKESPKLTEDLVPKTITLTGLQKVLQSLLDEGVAIRDMRTILDVIAEHAPKVSDPAEL
FT                   TTLVRVALGRAITQQLFPNNADLQVIGLDAGLERVLSQALANGGGIEPGLADAVLQQAQ
FT                   GAVVRQEQLGLDPVLLVPSPLRPLMARFLRRTLPQLKVLSHAEVPDNRNIRITAMIGGA
FT                   A"
FT   gene            240649..243126
FT                   /gene="flhF"
FT                   /locus_tag="Rmet_3700"
FT   CDS_pept        240649..243126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="Rmet_3700"
FT                   /product="putative flagellar biosynthetic protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10572"
FT                   /db_xref="GOA:Q1LH04"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH04"
FT                   /protein_id="ABF10572.1"
FT                   /translation="MSVAKFVAANGREAMRKVREAMGPDAVVLSNRTIDGGVEIVAMRD
FT                   TDLGAVNANAQPYVSPTPAASQILETAPAQIGPIAIAAANAVDGQATRTDDGAIGDLRG
FT                   ELASMRSMLERQFAGLSSGAGNVAVGDPLRESLFEWMVNAGFSGQLSRTLISRLPVGTD
FT                   RPAAMSWIRQEIAKKVPVLSNEDALFDQGGVLALIGPTGVGKTTTTAKLAARYVLRHGA
FT                   DRLALLTTDRFRIGAHEQLRIYGDILGVPVHAVKDAADLRFALSAMKDKHLVIIDTVGM
FT                   SQRDRSLSDQIAMLAGVQAPMQRVLLLNGAAHGDTLNEVVHAYRHDAAGDAGGIDGCII
FT                   SKLDEATHLGSVLDVVIRHRLPVFYASTGQRVPEHLELAQASTLVERAFMTPRRGSLFN
FT                   DADMARRHAVAADAATPRPAERNGADDMLRSLTDSANAVGTCVEELNAAGYGFDVARQL
FT                   WQQRGAGAVGLRQMGQQARMAMCRDASRACERYVLAVSQNFTQPVQGRRAPQLMQCTLW
FT                   LADRDGMPLAGTTAPVGRTRQSMSEADADAEAETVRATLSAARTVVNLNASVPSAAVIA
FT                   RWHQLGERWVAGTRKTARVITGGAASKLDAIADTLTFHAIGDTTWRDRDAVHWVGHCAV
FT                   RIPEGTVRAVGRARDNTAETGTEACLVVSRMADRDTGETLAVEYVLCDAALTDDAAQVA
FT                   RWMQWANAADEQFRTLRHAAEHFAQDGDASDSQGTSLVSLQLGLTTLRLQHTPTATAPA
FT                   FLSRLAGRAATRANVPVPGSVLNEGMGRLLALLDVLENYPGRAASPALVGDITADVAMQ
FT                   ATVGLPQLAVAGE"
FT   gene            243130..243954
FT                   /gene="flhG"
FT                   /locus_tag="Rmet_3701"
FT   CDS_pept        243130..243954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhG"
FT                   /locus_tag="Rmet_3701"
FT                   /product="Flagellar biosynthesis protein FlhG"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10573"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH03"
FT                   /protein_id="ABF10573.1"
FT                   /translation="MNVMGSDQAESLRRLLAPRVTRRIAVVAADAGAGATTVTLGLANA
FT                   LAMQGERVLLVDEDRHGVRATRLSGAAPVATLADVLASRVSAAAAIGTRPASGIAVLPA
FT                   GDIPVDAGNMDRALSDLIPDMRSVLIDARTDATGALSPLAATAHNVVIVMRPEVTSITA
FT                   AYARIKRLHHEYACRRFHLVVNMAATEATVAALARNLARTASQYLGVEAGLTGYLPIDP
FT                   LVARAFQLSRCVVEAYPAAASTSALRHIASGIGAWPLRHDTTPQGAAVAVPA"
FT   gene            244062..244778
FT                   /gene="fliA"
FT                   /locus_tag="Rmet_3702"
FT   CDS_pept        244062..244778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="Rmet_3702"
FT                   /product="RNA polymerase sigma 28 (sigma F) factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10574"
FT                   /db_xref="GOA:Q1LH02"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH02"
FT                   /protein_id="ABF10574.1"
FT                   /translation="MYTIQGKLEQADVVKSHAPLVRRIALQLAAKLPASVQIDDLIQAG
FT                   MIGLLDAAKRYEDNHGARFETYASQRIRGAMLDEVRANDWQSRSLRQFTRKIERTQRQL
FT                   EQKLGRSPIDSEVAKELEMGLEEYQELLNEVHGCQLLHYEDFERSGEEDFLDRHLGVTD
FT                   EANPLTVLMESGMRDALIRAIEKLPEREKLVLSLCYDQELNLREIGAVLEVTESRVCQI
FT                   RSQAITRLRNQLRGML"
FT   gene            244778..245224
FT                   /gene="flhE"
FT                   /locus_tag="Rmet_3703"
FT   CDS_pept        244778..245224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhE"
FT                   /locus_tag="Rmet_3703"
FT                   /product="Flagellar protein flhE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10575"
FT                   /db_xref="InterPro:IPR009420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH01"
FT                   /protein_id="ABF10575.1"
FT                   /translation="MRHLLAFALCLCLAPTWVDAQTYVRATYELSGSRYAWTSSAQGPL
FT                   IASRGQRTMSSPVLPPGTMPQASGIVTSVRWRYSFASTPPIDLEAYLCNARRCVLLSGA
FT                   QGKTDAFAGDDATGGFVFAYRVAGRGGLSPTLQGRSNEVTVSYR"
FT   gene            complement(245410..246501)
FT                   /locus_tag="Rmet_3704"
FT   CDS_pept        complement(245410..246501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3704"
FT                   /product="outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10576"
FT                   /db_xref="GOA:Q1LH00"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LH00"
FT                   /protein_id="ABF10576.1"
FT                   /translation="MKLRHLALAAALGLPAIANAQSVTLYGVIDTGIEYLNHVGTASNS
FT                   VVKMANLSGTVPSRWGLRGTEDLGSGMKANFVLESGFAPDSGVSNQGGRLFGRQAWVGL
FT                   SGNWGQVSLGRQYTMLFWATLDSDILGPNAYGSSSLDNYLPNARADNAIAYKGKFGGFT
FT                   IGATYSFGRDTVNAGPSPSGTNCGGENPADKTACREWSAMLGYETNWWGILGAYDSQRG
FT                   GPGAFGGLTSSSLKDDRATLGGYMLVDRAKIGAGWIGRRNGAIATPRSDMFYAGVAYDI
FT                   TPAVTLSGEAFYLKYHNSADKAWLGALRASYAFSKRTSVYTTLGYIDNGGKLALSVDSA
FT                   STGASPAPGGSQFGAMLGMKHVF"
FT   gene            complement(246580..247605)
FT                   /gene="ligJ"
FT                   /locus_tag="Rmet_3705"
FT   CDS_pept        complement(246580..247605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligJ"
FT                   /locus_tag="Rmet_3705"
FT                   /product="4-oxalomesaconate hydratase"
FT                   /EC_number="4.2.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10577"
FT                   /db_xref="GOA:Q1LGZ9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ9"
FT                   /protein_id="ABF10577.1"
FT                   /translation="MIIDCHGHFTTAPKALEDWRQRQIASLNIPALAPSVSELRISDDE
FT                   LRDAIASNQLRLMRERGMDLTIFSPRASFMAHHIGSFETSATWAAICNTLCHRVSELFP
FT                   DQFVGAAMLPQSPGIDTKSCVKELERCVLEYGFVGVNLNPDPSGGHWTSPPLSDPYWYP
FT                   IYEKLVELDVPAMIHVSTSCNACFHTTGAHYLNADTTAFMQVLTSDLFRRFPTLKFVIP
FT                   HGGGAVPYHWGRFRGLAQEMKLPPLGEHLLNNVFFDTCVYHQPGIDLLTRVIPVKNVLF
FT                   ASEMIGAVRGIDPETGHYYDDTRRYIDQAALSDEERHQIYEGNARRVYSRLDARLKARG
FT                   H"
FT   gene            complement(247602..248750)
FT                   /locus_tag="Rmet_3706"
FT   CDS_pept        complement(247602..248750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3706"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10578"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ8"
FT                   /protein_id="ABF10578.1"
FT                   /translation="MTPCLASDLRAIPCTLMRGGTSRGPFFLASDLPEDVPARDRVLLA
FT                   AMGSPDPRQIDGLGGAHPLTSKACIVSRGTPGHADLDFTFAQLQPNADTVDTTPNCGNM
FT                   LAAVLPFAIERGLIAPQGDITRARVLTRNTGMLCDITIQTPGGVPRFSGNARIDGVPGA
FT                   AAPIVIDFLDTAGSVCHAMLPTGNAIDVLTINDPVRGGSRLIAATLIDNGMPMVLMRAE
FT                   DLDRTGYESVAALNADHELKQRIEAARLVAGELMGLGDVSDKSYPKMCLLARPRQGGSI
FT                   ATRCFIPRVCHDAIGVLAAITVGTACVLPGTVASDIAVTSVGPLHAISVEHPTGEFTVE
FT                   LETDPAKPGSIVRSALIRTARPIMRGEVLVPTSAWPLSDELP"
FT   gene            248922..250142
FT                   /locus_tag="Rmet_3707"
FT   CDS_pept        248922..250142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3707"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10579"
FT                   /db_xref="GOA:Q1LGZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ7"
FT                   /protein_id="ABF10579.1"
FT                   /translation="METISLHHLHVFAGVAAAGGVRRSSESLHRASSAIARSVAALEET
FT                   LGVVLFERKGRGMLLTRAGEIVLERARHIEGALREVREEAVRMRAQSGAAVASIDALHN
FT                   ERRLEVAAMLAEVHHMPSVAASIGVSQPAVSQAIARLEDALGQPIFARTARGMVPTDAG
FT                   SRWVVRFERVLAELRNIRADIAALKGVLEGVVTVGALPLGRTLLLPMAIADVHRRHPHL
FT                   RFRTLESPYEELTAGLLAGRIDFILGAVRPLASQGLATERLFQDRISLIVRAAHPLAAR
FT                   KRVTLADLEPYPWVLSRAASPSRQALDGVFASRGLPLPQPLVETGDLALVRGMLLQGDM
FT                   VTALSAHQLRHEIDAGWLRELGLPLPDTARSIGITTRVGARLSPGADALIAALRHASGS
FT                   MEQAVDK"
FT   gene            250312..251637
FT                   /gene="pcaK2"
FT                   /locus_tag="Rmet_3708"
FT   CDS_pept        250312..251637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK2"
FT                   /locus_tag="Rmet_3708"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10580"
FT                   /db_xref="GOA:Q1LGZ6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ6"
FT                   /protein_id="ABF10580.1"
FT                   /translation="MTTQRLDIRAHINERKMSGYQWLLLVLCFLIVATDGMDVAIMGFL
FT                   APDITREWGISKAAFGVVMSAAPIGLAIGALVVGPLSDRFGRKKLLVGSIALFGVFNLL
FT                   SAFADGTATLSLLRFLTGLGLGAAMPSTTTLLSEYVPERSRSMLLATMFTGFNLGSALV
FT                   GFGAAALLPHHGWRAVLVAGGAIPLICLPFYIMLIPESARFMVVRNVAPARIARTLRRV
FT                   IGSVVADDTVFTISEPPVSGKQPVRTLLSSGYRSMTLALWVTYFMGLLVIYLLSGWLPT
FT                   LIKDAGLPIDRAANLTALFQLGGTVGALVVGYCMDRFAPHRVIGVSYVLGAMFILMLAS
FT                   GSVTSSMFALYVLLAGFCMSGAQTGLNAFAPQCYPTPVRATGVSWMLGIGRFGSITGSM
FT                   AGGVLLSMGWSFSAVIAILAVPATMAAISIVSTKAQPRAVTA"
FT   gene            251647..252939
FT                   /locus_tag="Rmet_3709"
FT   CDS_pept        251647..252939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3709"
FT                   /product="protocatechuate 4,5-dioxygenase (ligAB fusion
FT                   protein)"
FT                   /EC_number="1.13.11.8"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3709"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10581"
FT                   /db_xref="GOA:Q1LGZ5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR034939"
FT                   /db_xref="InterPro:IPR034940"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ5"
FT                   /protein_id="ABF10581.1"
FT                   /translation="MATIIGAIASSHTPTIGFALDAGKQQDPAWAPIFAAYAPVSEWLA
FT                   RKKPDVLLVVYNDHVTSFFFDHYSAFALGIGDTYHAADEGGGPRNLPPARGHVELARHV
FT                   GASLVADEFDMSFFQDKPLDHGCFSPMSVMLPHEGEWPVKILPLQVGVLQFPAPSARRC
FT                   YKLGQAIRRAVESYPEDLKVAIVATGGLSHQVHGERAGFNNTAWDHQFLDLFESDPESL
FT                   LDITHAEYAKRGGFESAEVVMWMVMRGAMSSRVRCLHRDYYLPSMTGIAVAVYENESAD
FT                   APALREARAERQREHIGHQLHGIEQLDGTYPFTLETSVRAYRINRYLHQLIDPAFRERF
FT                   RADPLATYDEAALTPEERDMITRRDWRGMIHYGVIFFMLEKLGAVCGVSNLHIYAAMRG
FT                   QSLEDFQKTRNAPGALYSVAGSGSASWSAKS"
FT   gene            252921..253460
FT                   /locus_tag="Rmet_3710"
FT   CDS_pept        252921..253460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3710"
FT                   /product="putative rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10582"
FT                   /db_xref="GOA:Q1LGZ4"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ4"
FT                   /protein_id="ABF10582.1"
FT                   /translation="MECEVLTGRCRGLEFRRNAAMCEAVFDSHQPPLGFRMYKKGTSVE
FT                   IQFSPQRLNDAAGDPYWVDLTIDEAQALLAQLQAHLAQAASGTTAPLVFSLEGPPVRAD
FT                   IAPARTKANAEEEPAANAESEFKQWVCIICGWVYDEAAGLPEDGIAPGTRWEDIPADWR
FT                   CPECDVGKEDFAMVEF"
FT   gene            253750..254337
FT                   /locus_tag="Rmet_3711"
FT   CDS_pept        253750..254337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3711"
FT                   /product="acetyltranferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3711"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10583"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ3"
FT                   /protein_id="ABF10583.1"
FT                   /translation="MEPVPTARLRLRQWREEDRVPFRAINADEEIMAFFPSTLSDAQSD
FT                   ALMDRIRQHHAQHGFGLWALELRETSTFIGFTGLAIPSWAPPFGPCVEIGWRLAREHWG
FT                   RGYATEAARATLDFGFGALRLAEIVSFTAAINQRSEQLMQRLGMHHAASDDFDHPALPS
FT                   GDRLARHVLYRLSGAQWDGSTGTGSRIPDPGK"
FT   gene            complement(254372..254848)
FT                   /gene="nagH"
FT                   /locus_tag="Rmet_3712"
FT   CDS_pept        complement(254372..254848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagH"
FT                   /locus_tag="Rmet_3712"
FT                   /product="salicylate 5-hydroxylase (oxygenase small
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10584"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ2"
FT                   /protein_id="ABF10584.1"
FT                   /translation="MTTVETWQQVLLLYADYTAALDNKQWEKWPEFFLEQCVCNAQSHE
FT                   AHICGLPMATPAFESCGLLMEKACANGIGAQDLHYRQQVGIPRILEDSGSQIRTETSYA
FT                   VFRTTPDDTSAIHSVGRYLDTIARTDAGLKFASRVCILERRAIPDLLAGRCMSR"
FT   gene            255171..256133
FT                   /locus_tag="Rmet_3713"
FT   CDS_pept        255171..256133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3713"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10585"
FT                   /db_xref="GOA:Q1LGZ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ1"
FT                   /protein_id="ABF10585.1"
FT                   /translation="MELQDIDLNLLVVFNELLRQRKMSAVARTLGISQPAVSNALNRLR
FT                   KLLDDDLFLRTSKGMIPTQLAGTLAGPITEALDVIHHSLNARATFDPLTSTRAFTVAMT
FT                   DIGEIYLLPGLMERLGKLAPGVKISTVCIHGDSLKGAMESGCIDLAIGFLPGLTAGFFQ
FT                   RRLLSQQYVCIFRKGHPLGRRDMTLEAFAMADRVSISAEGTGHTRVDAAIQQAGVTRRS
FT                   RLSVPHFAALGHILQSTDLIAVVPQAYAERALVLFNLVSAPCPVKISEISVNVFWHATR
FT                   HREVGNQWLRNVISDRFAVCPIPEATMSPQGLVVNCRGE"
FT   gene            complement(256114..256314)
FT                   /locus_tag="Rmet_3714"
FT   CDS_pept        complement(256114..256314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3714"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3714"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10586"
FT                   /db_xref="GOA:Q1LGZ0"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGZ0"
FT                   /protein_id="ABF10586.1"
FT                   /translation="MQKNAGTLDRLVRVAIGVVLIALTLTDQIGVWGWIGAVPLVTGLL
FT                   GYCPLYRVFGFNTCPITRRGS"
FT   gene            complement(256369..256686)
FT                   /locus_tag="Rmet_3715"
FT   CDS_pept        complement(256369..256686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY9"
FT                   /protein_id="ABF10587.1"
FT                   /translation="MHRNTYFLAIAAASVALTSLPASAQKNYTDGGDLYGGAHAPVTKD
FT                   AQAPAKSGKHKNSASRSGKFDPYSEGAQTKSNLTPQKKGAGDAAHAAKFDPYTEGQAAK
FT                   Q"
FT   gene            256841..257371
FT                   /locus_tag="Rmet_3716"
FT   CDS_pept        256841..257371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10588"
FT                   /db_xref="GOA:Q1LGY8"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY8"
FT                   /protein_id="ABF10588.1"
FT                   /translation="MAENLVIFYSRTGTTRQAAEMLGSRLGWRVVELRDAVSRAGWWGD
FT                   LRCVLDNRLGRKVGYRYDGPPLDTCGSVVVMAPVWVEHLAAPMRSFLQDQSSYKGPLAA
FT                   IAVMAARGGFRAAEEVATAMGRPPHPAMVLLQQQVTTGEAKADLDEFARILQRDPRAGD
FT                   AAPRSAWLSPNEA"
FT   gene            complement(257472..258134)
FT                   /locus_tag="Rmet_3717"
FT   CDS_pept        complement(257472..258134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3717"
FT                   /product="nitroreductase family protein (FMN dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10589"
FT                   /db_xref="GOA:Q1LGY7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY7"
FT                   /protein_id="ABF10589.1"
FT                   /translation="MKAMKLSEMIATRHTVKAYEPGRAIPQDVIDELLAVLHKSPSSVN
FT                   SQPWHFVVASTPEARARVARAASGGYSANAPRIENASHVIALAVRADMDNAHLNKLLEA
FT                   EERDGRFTAEGAKAGQDKGRRYFVDLHRFAFRDVQQWMANQVYLALGSLLTGAAVLGVD
FT                   ATPMEGFDRNILDAELGLRERGYTSLVLVSLGYGSEQDFNADLPKSRLGKEEVFTFL"
FT   gene            complement(258207..258671)
FT                   /locus_tag="Rmet_3718"
FT   CDS_pept        complement(258207..258671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10590"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY6"
FT                   /protein_id="ABF10590.1"
FT                   /translation="MEPAHPASPRDAWQFDHLNVSIGADHALRALFEGVMDMHPGYRPP
FT                   FPFPGLWLYEGDQAMVHAVDDDSLSASSGEVRMGHIAFRSQARATDVIARLQAAGLRFR
FT                   VAHVPADGTIQIFVPLPGGLVVELDVPGDPDIATSHQYSAERRAPDASDI"
FT   gene            258805..259713
FT                   /locus_tag="Rmet_3719"
FT   CDS_pept        258805..259713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3719"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3719"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10591"
FT                   /db_xref="GOA:Q1LGY5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY5"
FT                   /protein_id="ABF10591.1"
FT                   /translation="MRLLQELDIFVRTADNGSLSATARALDLTPAATSAALKRLEGELG
FT                   VQLFVRSTRTMRLTREGEQYLAQCRPALEVLQQASRDLLTGNQAFQGVVRLSAPSDFGR
FT                   NLLLPWLDAFQDRHPLVEFRLQLTDRMANIYSDPVDVAFRYGEPPDSNLVAVPVATGIH
FT                   RVLCASPGYLASHDMPQTPYDLSAHRCLCYMFGDDVHDRWRFAREDGETLTVRVKPANV
FT                   SNDGDAVRRWALAGKGIAYKAWFDVADDLAAGRLRALCTAWTAEASPLYMVVAGRSQLT
FT                   PLLRGLRDFVAERVERLVARY"
FT   gene            259797..261557
FT                   /locus_tag="Rmet_3720"
FT   CDS_pept        259797..261557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3720"
FT                   /product="sulfate transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10592"
FT                   /db_xref="GOA:Q1LGY4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY4"
FT                   /protein_id="ABF10592.1"
FT                   /translation="MLSDGRNPGASRKARIPNSWLRWLPGVAMARDYQASWLPRDLTAG
FT                   LVLTTMLVPVGIAYAEASGVPGVYGLYATIVPLLAYAVFGPSRILVLGPDSALAAPVLA
FT                   VVVQMSGGDPARAIAVASMMAIVSGLFCIVMGLLRLGFITELLSKPIRYGYMNGIAFTV
FT                   LVSQLPKIFAIRVEDTGPLRELVLLGQALVAGQVNWYSAAVGAGSLVLILALKRFERVP
FT                   GILIAVIVATLCVIMFDLDQMGVKVLGSIPQGLPAFAVPWASGLDFVKIVAGGCAVAMI
FT                   AFADTSVLSRSFAARHHHRVDPNQEMVGLGAANLAAGFFQGFPISSSASRTPVAEAAGA
FT                   RTQLTGVVGALAVAALLVVAPDLMRYLPNSALAAVVIAAALGLFEFADLKRIYRIQQWE
FT                   FWLSMVCFVAVAVFGAIPGIGLAVVLAIIEFLWDGWRPHYAILGQVEGLRGYHDLERYP
FT                   HGKRIPGLVLFRWDAPLFFANAELFQERLQEAIDESPAPVYRVVVAAEPVTSVDVTSAD
FT                   MLRELSRTLGEHGIALHFAEMKDPVRDKLRRFELMDVIGEDRFHPTVGSAVDDYVGRQG
FT                   DWPEAWGRNE"
FT   gene            complement(261660..262697)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3721"
FT   CDS_pept        complement(261660..262697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3721"
FT                   /product="Extra-cytoplasmic Solute Receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10593"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY3"
FT                   /protein_id="ABF10593.1"
FT                   /translation="MFRHADAIKRIKVGDDVLRIKHQASRIARVVAIAVAGLSIHHGAI
FT                   AADAWPAKPIKVIVPYTPGGSTDTVARVVFEKVSQSLGQPIVIENKPGANSTLGVGVVA
FT                   RSAPDGYTFVSVLAAYSANMSLYSKLSYKPTDLAPVAEMAELPLFLFSSKKLPVKTVAE
FT                   LVDYGKKHPDTLTFGSSGIGSSAHLTGERLAMESKVKMTHIPYNGSAPILPALVSGEIS
FT                   MAFDPLLVPMPHVKSGKINVLAVASAKRWPSEPNIPTMEESGFPGFVMSSWTGLLAPAG
FT                   TPQPIIDRMAKEIAAATRNPDVTKKLTELGFIPVGGTPEEFRKLIERDTSRYGQIVKAG
FT                   KITLD"
FT   gene            262572..262802
FT                   /locus_tag="Rmet_6619"
FT   CDS_pept        262572..262802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6619"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45218"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY48"
FT                   /protein_id="ADC45218.1"
FT                   /translation="MVDGKAGNGNGYNARNARGLMLDTQDVISYFDSLYCVRMAEHMQP
FT                   MGSARVIIGDASTQWRVNDGQKRMRCNANVR"
FT   gene            262884..263354
FT                   /locus_tag="Rmet_3722"
FT   CDS_pept        262884..263354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3722"
FT                   /product="CMP/dCMP deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10594"
FT                   /db_xref="GOA:Q1LGY2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY2"
FT                   /protein_id="ABF10594.1"
FT                   /translation="MNTNHAERYLGEAIELARTNLEQGGRPFGAVIVKDGEVIATGVNQ
FT                   ILSTNDPTAHAELTAIRAASQKLGSPSLDGCAVYASGHPCPMCMAAMRMAGVKEVTYAY
FT                   SNDDGEPYGLSTAAIYADLAKPFAEQSMKIRYMPVRPASCPDLYAEWKRRAG"
FT   gene            complement(263355..265241)
FT                   /locus_tag="Rmet_3723"
FT   CDS_pept        complement(263355..265241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3723"
FT                   /product="methyl-accepting chemotaxis protein (MCP)"
FT                   /note="sensory transducer; HAMP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10595"
FT                   /db_xref="GOA:Q1LGY1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY1"
FT                   /protein_id="ABF10595.1"
FT                   /translation="MRLLRGMTIQRKLILSTITCLLLVVTMTAMLILWQISKGLQERVV
FT                   DLELPAIVGEIRNDMLHQIARPLAAAQAMAGNTMLRDWESNGLADDYVPTWRRYAAEIK
FT                   SRNQADAVFWVSASQGKYLTEKGVDRTVQADSAGDKWLFDFLSRGKPYELSLDKDRNSD
FT                   SYMLFINARAEAGNGKLAVAGLGLSINHLAETINGYRLGRTGSIFLARADGNVLMHRDA
FT                   RLAEAGTPLADLPGFTTDAARTLLARQPFAHTEVDAPEGKRIVAASYVPELDLYVVAQV
FT                   PKSEVLEEIRHSSIIAAVTAGLSGSLLGVIVLYFVIRALVAPIGRVASALDAIATGNGD
FT                   LTQRLPVDSQDEVGRLADAFNRFVASLNRTIGDVRQGVVAIADATREIAQGNHDLSTRT
FT                   ENQAAGVEETASATEQLTATVATNADTARRASALAASVSMDVRRSGEMMTNAVSTMETI
FT                   THSAGQMSSIIDAIEGIAFQTNILALNAAVEAARAGEHGRGFAVVAGEVRGLAQRSANA
FT                   AKDIKTLIVGTEEAVRTGRSLVNEAGDAMQQIVPAMQQVSTLVEEIAEASGEQSRGLGE
FT                   INLAITEMDSTNQQNASLVEQAAAAAKSLEDQATVLNRVVAVFKLDERLLQA"
FT   gene            265504..267114
FT                   /locus_tag="Rmet_3724"
FT   CDS_pept        265504..267114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3724"
FT                   /product="EAL-containing signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10596"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGY0"
FT                   /protein_id="ABF10596.1"
FT                   /translation="MRGLITRIVTYAALALAFMLPVCASVWMSYRLALSEQQLHTGILA
FT                   AEVLYRVHVFSEQNLRINAALRRHGATSPCSPDNVALMRNLAVGASYLQVVGYVEGNVL
FT                   QCSSYGYGDGDAGIPIGPPAYRSRLGNWVRTSVKLPFDESRRYIALTDSVTGYSSLALP
FT                   DMLLDTGGGGHGFAIALVAISNRQIVVQRDPIDLGGMPPLIRERGTITWQHRGATGSVS
FT                   LSPSRDYAAVVMSPASALHANWRNVATWLVPFGALLGGALVALARLGLRRRHGLLRQLD
FT                   RALRDDELSLAYMPIVELESGKWIGAEALMRWCHDGQWIAPDKFIPLAERHHRIRKLTN
FT                   RMLDLLVADAQALPRDLARAMYFSVNLSAEDLAACAIAQRVADVRQACGVDGVMVEATE
FT                   GVLLEASRVIPNIERLRKLGIRVAIDDFGTGYSSLSYLGSLDVDYIKIDKSFVSAIGTN
FT                   SVRGHVVAHIIDMAKDVGVAVIAEGVETQEQADYLMARGVRYAQGWLFGKAMPMQDFVS
FT                   AIRMHNLYYKNCMQKRQVL"
FT   gene            267171..268508
FT                   /gene="pbuX"
FT                   /locus_tag="Rmet_3725"
FT   CDS_pept        267171..268508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuX"
FT                   /locus_tag="Rmet_3725"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10597"
FT                   /db_xref="GOA:Q1LGX9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX9"
FT                   /protein_id="ABF10597.1"
FT                   /translation="METLLYKVEDRPPILTTVLLAAQHLLAALGGIIAVPLVLGGALKL
FT                   PPDQIVALVNAALLGSGIVTIIQCKGVGPVGIRLPCVMGTSFTFVGAGISVGLEHGVPG
FT                   ILGASLAGSLVMIVGSFFMPTIRKLFPHTVTGVVVTMIGLSLTPVAIDWAAGGAGSANY
FT                   AAPGSLAIAGIVLLLVIGFVQWGKGIVSASAVVLGIMIGYLICLALGMVDFSQLHDAPV
FT                   FALPQPASFGMKFPISGIAAMSLAFLVTIVETTGTFMALGSATRTPMPGKTLARGILCD
FT                   GVGSAFAALLSSPPVSTFAQNVGVVSLTGVASRHVVALTGGMLVLAGLFPVLGALVVTI
FT                   PQPVLGGAGLMMFAMIVSAGIRMLGHSAPTKRNSLIIAVSIGCGLAVTIRPDLLAKLPA
FT                   FVKEVFGSGITVGALVAVVLNLCLPGREVDAIDEEVEGETLVQELA"
FT   gene            complement(268591..269181)
FT                   /locus_tag="Rmet_3726"
FT   CDS_pept        complement(268591..269181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10598"
FT                   /db_xref="GOA:Q1LGX8"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX8"
FT                   /protein_id="ABF10598.1"
FT                   /translation="MRQAPSPHDFAIPYAGSRRKHYTNPHPQTLQTRPTMQAPDTRRSI
FT                   RLYVLCLCILAWLGGCAALTGQEPLRVAVAGVEPIPGEGLEMRFNVKLRIQNPNDAPIE
FT                   YNGVSLELDLNGQSFASGVSDQSGTVPRFGETVIDVPLTVPAFSAVRQAFAFAGGVSSG
FT                   NIPYEVRGRLAGGFAGGTRFTDHGKLSLPTGGT"
FT   gene            269270..270469
FT                   /locus_tag="Rmet_3727"
FT   CDS_pept        269270..270469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3727"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3727"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10599"
FT                   /db_xref="GOA:Q1LGX7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX7"
FT                   /protein_id="ABF10599.1"
FT                   /translation="MDFRPDPSLQAFRQEVREFLRESLPPDLPRRKGGFRSPRADLARW
FT                   QGILHAKGWGAPYWASEHGGTGWTVPQRLIFDEECSAAGAPTQDGFAQKLVGPVLNYFA
FT                   TPEQRAAHVPAILAGKRMWCQGFSEPGSGSDLASLRTRAERDGDHYVVNGQKIWTSYGH
FT                   EADWIFLLVRTDTQVKKQAGISFLLVDMKTPGITVRPIISIDGAHHLNETFFEDVRVPV
FT                   SNLVGAEGEGWKLTKFLLNNEHASTADLPTLQRFQRQLRALAATRGAGGGTLIGRHEFA
FT                   LRLARLEAELQAITVMVQRVAAMEADHSPAAHAMGSILKVRGTELQQKMSEFLVEALGD
FT                   HGAVAYPGSHAATAGARSLPMQEVAQSIAADMLFRRATTIYGGTSEVQRGIIAKSLFQF
FT                   "
FT   gene            270493..271638
FT                   /locus_tag="Rmet_3728"
FT   CDS_pept        270493..271638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3728"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3728"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10600"
FT                   /db_xref="GOA:Q1LGX6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX6"
FT                   /protein_id="ABF10600.1"
FT                   /translation="MHFKLNDAQQMLQDSARRFVEKAYAFEARTALIQAGQTGGTRHWQ
FT                   TFAENGWLAAALPETCGGLGGSVIDTALIAQELGRGLVLEPFLGSGVLATQTLLAAATP
FT                   SQREALLPSLAEGTRRYALAYSEADARGMPEILSTSAEAGTDGYTLRGTKTLVLGGVDA
FT                   DAFIVSARLADSGEPSAITLFLVDAGTPGLTCHALPLHDGTWAAELEIDGARVPASAML
FT                   GQPGEGLRALRHGLAHATAALCAELVGGMEKAVEVTADYLKVRKQFGVPIGSFQALQHR
FT                   MSDMAAEMELARSMLFSLLAAIDHEDEATLLHRVSQAKAFVGRAARYVCGQAIQLHGGI
FT                   GMTDEYLIGHYYKRAIVADLIFGSADRHEAICAEAIQAAMA"
FT   gene            complement(271791..274034)
FT                   /gene="icdA"
FT                   /locus_tag="Rmet_3729"
FT   CDS_pept        complement(271791..274034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icdA"
FT                   /locus_tag="Rmet_3729"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10601"
FT                   /db_xref="GOA:Q1LGX5"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX5"
FT                   /protein_id="ABF10601.1"
FT                   /translation="MSNQQPTIIYTLTDEAPLLATSAFLPIIRTFAGPAGVNVVTSDIS
FT                   VAGRILGEFPEFLTEAQRVPDNLAELGKLTQDPDTNIIKLPNISASVFQLVSAIKELQS
FT                   KGYKIPDFPEDPKTEEEKAIQKRYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKHPHS
FT                   MGEWSMASRTHVAHMKHGDFYHGEKSITLNGAREVRMELLTKSGKTIVLKPKVALLDGE
FT                   VIDSMFMSKKALLDFYEDQMEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKVFYKDAF
FT                   AKHQKLFDELGVNVNNGLVDLYTKIETLPESKREEVIRDMHACHEHRPEMAMVDSAKGI
FT                   SNLHAPNDVIVDASMPAMIRIGGKMWGADGRTKDTKCLIPESTFARIYQEIINFCKTNG
FT                   AFDPVTMGTVPNVGLMAQKAEEYGSHDKTFEIPEDGEARIVDNATGEVLTALTQQVEAG
FT                   DIWRMCQVKDAPIRDWVKLAVTRARNSGMPAVFWLDPYRPHEAELIKKVETYLKDYDTN
FT                   GLDIQIMSQVRAMRYTLERVIRGLDTISVTGNILRDYLTDLFPIMELGTSAKMLSIVPL
FT                   MAGGGMYETGAGGSAPKHVAQLVEENHLRWDSLGEFLALAVSLEELGIKSGNERAKILA
FT                   TTLDAATGKLLDNAKSPSPKTGQLDNRGSQFYLAMYWAQELAAQKGDADLAKIFAPLAK
FT                   TLTDNESTIIGELGAVQGKPVDIGGYYMPDAAMLEAVMRPSQTLNSALAAVKA"
FT   gene            complement(274402..275490)
FT                   /locus_tag="Rmet_3730"
FT   CDS_pept        complement(274402..275490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10602"
FT                   /db_xref="GOA:Q1LGX4"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX4"
FT                   /protein_id="ABF10602.1"
FT                   /translation="MRNPGSALYTRSVHFSVIAMFEALRKTTSALFDPDRRFRQARIFH
FT                   AVRVALALLVSIALTTGIHIPHGEWATITVLVVIGGLQHHGNIRRRAAERGAGTVIGAF
FT                   LGLLLILQEAYFHIPVLTWLLLAVICGYCAYHAVGKGGYIALLAAITVVITAGHGNQHV
FT                   EDALWRTLDVLIGTVIALAFSFALPAYASYSWRFKLAGMLRSCAAVHAKIARGMRDEKE
FT                   RQQDMMKLSASLVQLRSLIPSVAKETGVPTADLEEVQHSARVCISALEMLAAIDPVAAE
FT                   PTDEERHIRDLLLEMASALESGDESMVQLNLPLPEPHPDDPSIGHSSHTFLTLHLAAEI
FT                   GHLRDHLAQMARQSRFPYNGTH"
FT   gene            complement(275555..276019)
FT                   /gene="flgN"
FT                   /locus_tag="Rmet_3731"
FT   CDS_pept        complement(275555..276019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgN"
FT                   /locus_tag="Rmet_3731"
FT                   /product="flagella synthesis protein FlgN"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3731"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10603"
FT                   /db_xref="GOA:Q1LGX3"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX3"
FT                   /protein_id="ABF10603.1"
FT                   /translation="MTQAALIQTLSIEAGAIAAFGRALADEREAIKRQDFQALTDLLGK
FT                   KMELAQALTRATAAREAQMIALKLRVGAGGLLIGGPLEPGVAEAWRKVVFFAHKARDAN
FT                   ELNGAIVNAHLEFTQEAIQVLRQGGAGPNEMYGRNGKASATAGGVSLAAG"
FT   gene            complement(276027..276407)
FT                   /gene="flgM"
FT                   /locus_tag="Rmet_3732"
FT   CDS_pept        complement(276027..276407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="Rmet_3732"
FT                   /product="negative regulator of flagellin synthesis
FT                   (anti-sigma-28 factor, FlgM)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10604"
FT                   /db_xref="GOA:Q1LGX2"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX2"
FT                   /protein_id="ABF10604.1"
FT                   /translation="MPKVSGGASDKPEEPSKDFTVKINNSPSSRPTEPSASEGGARPAA
FT                   SGAAASSDPTALTGVRVSPLAAQVREIGTRLLQDSDSDIDVAKVAEVRKAIAEGRIQID
FT                   PSKIADGLLASLHELSQGGSKP"
FT   gene            complement(276586..277323)
FT                   /gene="flgA"
FT                   /locus_tag="Rmet_3733"
FT   CDS_pept        complement(276586..277323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="Rmet_3733"
FT                   /product="flagellar basal body P-ring biosynthesis protein
FT                   FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10605"
FT                   /db_xref="GOA:Q1LGX1"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX1"
FT                   /protein_id="ABF10605.1"
FT                   /translation="MNLYRQAAALLALAGIAMSQPVLAAPAVATPVTAQTPSTPFVDDP
FT                   ARVAVEQFLLRQAGGLPGKVSVQVGTPSGGRAPECVDPQPFLPPGAAPYGRVNVGLRCG
FT                   GDRPWTRYMQARVSVLTDYYVAARAMGPGETITAADLEVRQGDLAMLPRAVVTDPSQVD
FT                   GAVSANRIAAGSPMRTDLVRKPIAVKSGQTVNVTVEGDSFQLSSEGKVLTDAATGNMVQ
FT                   VRLRNGQVVSGLVRSGDTVVLQQ"
FT   gene            277380..277577
FT                   /locus_tag="Rmet_6620"
FT   CDS_pept        277380..277577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6620"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45219"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY49"
FT                   /protein_id="ADC45219.1"
FT                   /translation="MSFSGAHCRQRVARDRSGNARVSRPYSSDWRDNPTPKMATLKKPD
FT                   CGAGHVYLATRRRSPRNAAI"
FT   gene            277602..278006
FT                   /gene="flgB"
FT                   /locus_tag="Rmet_3734"
FT   CDS_pept        277602..278006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="Rmet_3734"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10606"
FT                   /db_xref="GOA:Q1LGX0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGX0"
FT                   /protein_id="ABF10606.1"
FT                   /translation="MDKLDAAFRFQQDALSLRTQRQSVIASNIAHADTPGYKARDFDFA
FT                   STLAQSVERGQRSEGTSLSTTSVRHLPGQAPTSTGHELDYRIPLQSSIDGNTVEMDTER
FT                   VAFADNTVHYEAGLTVMSSKIKTMLAAIQS"
FT   gene            278018..278425
FT                   /gene="flgC"
FT                   /locus_tag="Rmet_3735"
FT   CDS_pept        278018..278425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="Rmet_3735"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10607"
FT                   /db_xref="GOA:Q1LGW9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW9"
FT                   /protein_id="ABF10607.1"
FT                   /translation="MGTMSIFDVAGSAMAAQSQRMNVTASNLANADSAVAPNGQPYRAK
FT                   QVIFEMAPTPGQSDVGGVQVAGVMEDTAPARMVHNPSHPLADANGYVTMPNVNPVEEMV
FT                   NMISASRSYQANVEVLNTAKNMMLKTLTIGQ"
FT   gene            278467..279135
FT                   /gene="flgD"
FT                   /locus_tag="Rmet_3736"
FT   CDS_pept        278467..279135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="Rmet_3736"
FT                   /product="flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10608"
FT                   /db_xref="GOA:Q1LGW8"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW8"
FT                   /protein_id="ABF10608.1"
FT                   /translation="MTTTSNVGSSTTSAVNQALQNGSASAADLQNQFLTMLVTQMNNQD
FT                   PLNPLDNSQLTSQLAQISTVSGLQTMNTTMTQLLQQTAASRAMDSANLIGKTVMVPGSA
FT                   VSVSGGVPGQIGVDIPSTADSVTVQVLDASGNVVRTIDMKGQTAGVKDVAWDGKNDQGN
FT                   AVADGDYSFKVAATANGKDVKPVALVYGKVQAISGDSSGVLVDLGNGQTASVDDVRRIS
FT                   "
FT   gene            279209..280456
FT                   /gene="flgE"
FT                   /locus_tag="Rmet_3737"
FT   CDS_pept        279209..280456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="Rmet_3737"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10609"
FT                   /db_xref="GOA:Q1LGW7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW7"
FT                   /protein_id="ABF10609.1"
FT                   /translation="MGFGQGVSGLNAAASNLDVIGNNIANANTVGFKQSTAQFADVYAG
FT                   SKIGLGTRVNSVVQSFTNGNISSTGRNLDVAISNGNGFFRLASTDGGVYYSRNGQFQRL
FT                   DDGRLVNASGLQVTGYPAGTTAGGVAPQPIVISNAQMPPQATTNIKAQFQLDSRSTVPT
FT                   NAFVSTPGATPPVLPNSTMFNYSTAMTVYDSLGNKQQLTAYFGKSIPATTPAPPNAFGG
FT                   TDWDMNVTDASGNVLQTVKLSFDANGMLKAPSATTMPTVTLPAANGAAAMTATLDLSGT
FT                   TQFGADNDPKSIVQNGFTSGSLLGFSVQSDGTILGSFSNEQTKSLGQIAMAAFGNAEGL
FT                   KPEGNNVWSATGASGQELLGVAGGSMGTLQSGSVEESNVDLSGQLVNLIVAQRNYQANA
FT                   QTIKAQDTVMQTLVNL"
FT   gene            280483..281226
FT                   /gene="flgF"
FT                   /locus_tag="Rmet_3738"
FT   CDS_pept        280483..281226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="Rmet_3738"
FT                   /product="flagellar basal body proximal rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10610"
FT                   /db_xref="GOA:Q1LGW6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW6"
FT                   /protein_id="ABF10610.1"
FT                   /translation="MDRMIYTALSGAKQILDQQAAVSNNLANASTTAFKAQVNMYRAVP
FT                   VVGQETQTRAFTLASTPGADMKAGPLSYTGRNLDVALQGNGWLAVQMPDGSEAYTRAGS
FT                   LQVSPDGQLQTSLGLPVMGDGGPIGIPPGSTVSIGTDGTVTARGPGEAANGLAQVGKLR
FT                   VVTPPPEGLARGDDGYFRLRPGVDPLQQDPNVRVISGALEGSNVNPVESMVEMIANARR
FT                   FEMQMKMITGADSNDQRANALLSNN"
FT   gene            281275..282060
FT                   /gene="flgG"
FT                   /locus_tag="Rmet_3739"
FT   CDS_pept        281275..282060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="Rmet_3739"
FT                   /product="flagellar basal body distal rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10611"
FT                   /db_xref="GOA:Q1LGW5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW5"
FT                   /protein_id="ABF10611.1"
FT                   /translation="MIRSLWIAKTGLDAQQTQMDVISNNLANVSTTGFKRSRAVFEEMM
FT                   YQTIRQPGAMSSDQTVLPSGMQIGTGVRPVATERIHTQGNPQQTGNAKDVAIIGNGFFQ
FT                   VTMPDGTTSYTRDGSFQVDQNGQLVTSSGFVINPAITLPANYTSVNIARDGTVTVMQPG
FT                   STNAATVGQLQLATFPNPTGLESMGENLYVQTDASGAPNTTVPGLNGAGTLQNNYVEAS
FT                   NVNVVEELVSMIQTQRAYEINSKAVQTSDQMLQRLTQMG"
FT   gene            282067..282780
FT                   /gene="flgH"
FT                   /locus_tag="Rmet_3740"
FT   CDS_pept        282067..282780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="Rmet_3740"
FT                   /product="flagellar basal body L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3740"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10612"
FT                   /db_xref="GOA:Q1LGW4"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW4"
FT                   /protein_id="ABF10612.1"
FT                   /translation="MTMAATRSGSRIVAFVAHAIVGLAALASGGCAMMPKEPLVQLPTT
FT                   ARAESRPVSAPTGSIFASSYAAGNPLFEDRRPRNVGDILTIVITENINASKNSGSNASR
FT                   AGNSTLSFNAVPRALAGLFSSASNADIGGTNTLKASGGSSANNTFNGTITVTVLEVLPN
FT                   GNLVVSGEKQMAINQGAEFIRFSGVVNPRTITGDNGVLSTQVADARIEYTAKGYIDEAQ
FT                   NMGWLQRFFLNVLPF"
FT   gene            282788..283972
FT                   /gene="flgI"
FT                   /locus_tag="Rmet_3741"
FT   CDS_pept        282788..283972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="Rmet_3741"
FT                   /product="flagellar basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10613"
FT                   /db_xref="GOA:Q1LGW3"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW3"
FT                   /protein_id="ABF10613.1"
FT                   /translation="MFLPPMPFHKPGSLLGTPPGLHSRSGRAVFLAGLLLALFLGLGFG
FT                   HAHAERLKNLATFQGVRDNPLVGYGLVVGLDNTGDQTMQTPFTTQSLQNMLSQLGITLP
FT                   AGKNMQLKNVAAVMVTAALPAYAQPGSQIDVVVSSMGNAKSLRGGTLLMTPLKGIDGQV
FT                   YAVAQGNMLVGGAGASANGSKVQINQLAVGRIANGAIVERAVPSFQPEGGFMNLELKDT
FT                   DFGTVERVVEAINRNLGAGTAAAMDGRVVQVRTPQAPSARVGFMARIENLDVTPAKAAA
FT                   KVILNARTGSIVMNQAVTVEDCAIAHGNLSVVINTQPVISQPGPFSQGQTVVAPVSQID
FT                   MKQGGGSLQIVKAGASLAAVVKGLNALGATPADLQTILEAMRAAGALRAELEII"
FT   gene            283972..284994
FT                   /gene="flgJ"
FT                   /locus_tag="Rmet_3742"
FT   CDS_pept        283972..284994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /locus_tag="Rmet_3742"
FT                   /product="peptidoglycan hydrolase (muramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10614"
FT                   /db_xref="GOA:Q1LGW2"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW2"
FT                   /protein_id="ABF10614.1"
FT                   /translation="MTGATLSGQSDISQRFALDTQGFEALKNQARAGNNSGSLQAAARQ
FT                   FEAVFTNMVLKSMRDATPSDGLFDNEQTKLYMSMMDQQLSQQLSTRGIGLADVMIRQLA
FT                   RATGQQLPPNMATAGGVTAASIQDAQMAGLLDGRGATDADGPALPVGTTLPGPAWNPTA
FT                   GVRQYQNQADWQGNGQAQLGQLPNDTPEHISSFVNRMAGPAMVASRASGVPAKLIVGQA
FT                   ALESGWGRREILNSDGSTSFNVFGIKAGANWKGPTTEVLTTEYVDGQPQKVRARFRAYG
FT                   SYEEACNDYARLLTSNPRYAGVVAANSADEAAHGLQRAGYATDPAYGEKLVRIMKKVST
FT                   "
FT   gene            285260..287155
FT                   /gene="flgK"
FT                   /locus_tag="Rmet_3743"
FT   CDS_pept        285260..287155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="Rmet_3743"
FT                   /product="flagellar hook-filament junction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10615"
FT                   /db_xref="GOA:Q1LGW1"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW1"
FT                   /protein_id="ABF10615.1"
FT                   /translation="MSLFNIGLSGLNVAQNALTTTGHNFSNAATPGYTRQSTIIASAGG
FT                   QFTGSGFFGQGSSTVTVQRVYDGFLTGQLRTATSASSELSTFSSQISQIDNLLADQNAG
FT                   LAPLMQKFFAAVQTVSDTPGDTAARQGMLSAAQALTGQVKASSDYFKQLQDGINTQLTS
FT                   SVRQVNDYTKQIASLNKQISQLTAASGGQPPNDLLDQRDQAVSELTKLVGAKVVVQDGN
FT                   TYNVFVGNGQPLVMGSESYDMTAVPSAADPSRITIGYTLPNGNTVQSEDGSVTGGSIGG
FT                   LLRFRSQSLDQAQNAIGRLSLAIGQVFNNQHKLGIDLNGATGTDLFSLGQPTTYANANN
FT                   KSNAVATATITNAGSLTTSDYSLKFDGTNYSLTRLSDNTVVATSTSLSGISADGISVSL
FT                   NGPMSANDSFLIQPTRNAAAGFGTLITDPAKVAAASPARADASTQNTGSGTAKLSGVAQ
FT                   GFTQLSGKITAKYTGAGYTFTDALGNVVTPTSTAASGTGTDYTFSGLTFHFDGTPKAGD
FT                   TFTLSSNSGATADNGNALALAKLQTAKTINGTSSFNDAYASLVNQVGSDAKSASIASES
FT                   QDSITTQVTSAQQSVSGVNMDEETVNLLKFQQLYQANAKVIQTASTIIDTLLSIG"
FT   gene            287211..288449
FT                   /gene="flgL"
FT                   /locus_tag="Rmet_3744"
FT   CDS_pept        287211..288449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="Rmet_3744"
FT                   /product="flagellar hook-filament junction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10616"
FT                   /db_xref="GOA:Q1LGW0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGW0"
FT                   /protein_id="ABF10616.1"
FT                   /translation="MRVATSTLYQQGLASMNNQQSKLLYVQQQLGTGRRILTPSDDPVA
FT                   ATRALGVAQAQSVNGQYATTRKQANASLGLEENTLQSVTTTIQNIQSLLVNAGNGTMSD
FT                   TDRASLATALQGQYDQLMGLANADDGNGNYLFAGLQANTVPFAKNAAGAAVYQGDNSHQ
FT                   LLQVDVARQMESGNTGAEVFMSVTTNAGYVLNGNAGNAGTATYGPISVSDPTNPLYGTP
FT                   LKLTFQPNATTGAMEYQVSNATTGTAIGTAQPYSDGTPINVGGVSFTVKGTPAAGDSLT
FT                   AVPAQQAGADIFANLQNVISALKKPIDTGANTDAANANLQNVLATGIRQMGNSLDNVLT
FT                   VRSSVGSRMQELDALDTIGQNRDLNSKSALSDLQDLNYASAITEYYQRQTALQGAQQSF
FT                   MQIQGMNLFQYLR"
FT   gene            complement(288812..289990)
FT                   /locus_tag="Rmet_3745"
FT   CDS_pept        complement(288812..289990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3745"
FT                   /product="putative GGDEF/cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10617"
FT                   /db_xref="GOA:Q1LGV9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV9"
FT                   /protein_id="ABF10617.1"
FT                   /translation="MSPTHKPMPEPTEVFTLPRWKITRWLTDTDRDVPTDIKRALIGSL
FT                   FGTLSIFVGGVVNTLLVAALIAWHIQRPAFFAWFGLECLICIARISILVSARRRARAAR
FT                   STHTDLHLALSLAWAFSVGLGTYLSITSGNWLAAALACLSSAAMIGGICFRNFGAPRMS
FT                   GLMILLALGPCCLGAIVAREPLFLLTLIQLPVYVASMTSASFRMHAMLVATMQSERENA
FT                   HRARHDSMTGLLNRGSLLAEIRATMECNAISPLRSALLYLDLDGFKRINDVHGHGCGDE
FT                   LLQQVADRMRATVPEGTHVSRIGGDEFVILLNLHESDDVQVLAQRLLRDIAVPYLLANG
FT                   ETVAIGVSIGITHISPNGQSADAVLNVADRALYVAKARGKGCFHFSEAVQAL"
FT   gene            complement(290271..290633)
FT                   /locus_tag="Rmet_3746"
FT   CDS_pept        complement(290271..290633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3746"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10618"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV8"
FT                   /protein_id="ABF10618.1"
FT                   /translation="MWMPCHDEFNLMWADKPGTGHYFAPPIHPDPHMYKYVWWVWTRAS
FT                   PWDGTSFFTNTPALSMGEFRQIERQLIDAREHFFVYGIQRPRRGSALERSTPQWAHPIF
FT                   APAYDEDEDIAWQGHK"
FT   gene            complement(290645..290851)
FT                   /locus_tag="Rmet_6621"
FT   CDS_pept        complement(290645..290851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6621"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45220"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY50"
FT                   /protein_id="ADC45220.1"
FT                   /translation="MRLETIRDPRSLVMGFIATAEHGVGVAHDTHMKVLGTYSVERNFT
FT                   YDSLGCPFARGNRLLALVHRSAD"
FT   gene            complement(290890..291969)
FT                   /locus_tag="Rmet_3747"
FT   CDS_pept        complement(290890..291969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3747"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3747"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10619"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV7"
FT                   /protein_id="ABF10619.1"
FT                   /translation="MKRNSTHAQPLSDLAITTLELMASRPDGYPSGELQSALEGHADRR
FT                   TIRRALSELETCGFAKSDGATKGRVWKALSPTPGGRRPSVNEAIALLTLRHLAYRHLPA
FT                   SVVGALEADFIAAAHVLDEHPTASNLAAARLWLDKTARLHAGYPLVAPAIKDELFQIVG
FT                   HALYNDESLDITYRTSRESAPKQYRALPHALIEKGPLWYLIVKNKRRTAEGSMFSLRMD
FT                   RIIDARPAGIDLTRDRTFNLDAYIRKDKSMEFFAGKPVQLVLRVNEMIDAKRIEHAFRS
FT                   LHLSDDQTIVEEDGGFLLVATVVPSVPLTNLLLEKSTTVEIVAPPDMREGMIAHLKRAL
FT                   SRYEHGSAPVENLDTTGPH"
FT   gene            292060..292257
FT                   /locus_tag="Rmet_6622"
FT   CDS_pept        292060..292257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6622"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45221"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY51"
FT                   /protein_id="ADC45221.1"
FT                   /translation="MVPCWPNYPAIPKRGIEYRVMGRYAIWTGIIPKVGWVKEGQVLSF
FT                   ASRTRLATRGSNYYLSKNRK"
FT   gene            292291..292650
FT                   /locus_tag="Rmet_3748"
FT   CDS_pept        292291..292650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3748"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV6"
FT                   /protein_id="ABF10620.1"
FT                   /translation="MRMIMFLLGLFAIVCVLYGISAGVQTIQRGLARLLNNGRNDEAPA
FT                   VLPAPITSETPESGSAKEPAPSCQGYIGELRELYELHKQGALSNEEFQDWKHHLLSAMR
FT                   SMPSVRGSGHFRDTT"
FT   gene            292670..293776
FT                   /locus_tag="Rmet_3749"
FT   CDS_pept        292670..293776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3749"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10621"
FT                   /db_xref="GOA:Q1LGV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV5"
FT                   /protein_id="ABF10621.1"
FT                   /translation="MPLPFIIGAAALVTAAYGAKKGYDGYQKHSEADEIVKDAQARYER
FT                   RKSAVDAQEEKTTLALDLLGKKELEIGKSIGEFKTLADKLLQQLNAGRDNKLNISIPKH
FT                   ELQKIENYSITAISVLGTAVGAGAAGAAVGFAVYGGVMALGAASTGTAISALSGVAATN
FT                   ATLAALGGGALSAGGLGMAGGTVILGAAVAAPVLAIAGWAYDSHGEEALINARKANDEV
FT                   SRAVEKLMKASEQLAKTEVYARKIKSELTTISGQFQQYFDTLKGINRFIDDIKGRNVDV
FT                   GAEIEKLGDDVLRVIENGFALAAILVNLIIVPIFRPAKSNGKVVHNKDGVPEMEKDADG
FT                   SMILNDAELDLALRRAESQAGNIEAVRS"
FT   gene            293835..295460
FT                   /locus_tag="Rmet_3750"
FT   CDS_pept        293835..295460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3750"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10622"
FT                   /db_xref="GOA:Q1LGV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV4"
FT                   /protein_id="ABF10622.1"
FT                   /translation="MSTAVANYPWAEELEKTVVNSLVTTFGLDFLLFKDKVGGDVDTVH
FT                   NVRQGIWGTEKEQQAYEQRGAYDGTAYHTHPNYISTGKKDKALHQTGQLNDAYRGQVMA
FT                   MDEQRNLDHIISAKEIHDDAGRVLAELDGVELANQGSNLQTTLETINKSKKQSPIDDYL
FT                   KNLPRLVEGHEKDLARKQEKLRNLPRETPEQRHKAEALEEKVRKAQKKIEGLKSIDAEA
FT                   MRKKDQQARKKYDGAIDRAYYGGSKFMQQTGFAAGLSGFKMGTRQMLGLVMAEVWFELR
FT                   AQVPIILDTLKRQFSFEKFVEDIQSTFRGIWRRIRLRFKDFLTSFKDGIFGGIVSSLTT
FT                   TVFNIFATTQKATIKIIREIWGQLCKAFKLVFFNPEKLGFADLCKAVMGVLSAAAGVTV
FT                   GSIAHAQLLPLCSFPFGAELASFVGALVTGLATLGFTYVLLHGSVAQRAWAYLESMMPH
FT                   ADTVKKYQAINAELDGYLTELARQEFNMDTDELAAFSRDLSACNDEMQRGLVLKDEIAR
FT                   QGIELPYEMGSATSTRKWLASLAK"
FT   gene            295457..295738
FT                   /pseudo
FT                   /locus_tag="Rmet_3751"
FT   CDS_pept        295457..295738
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3751"
FT                   /note="conserved hypothetical protein (fragment)"
FT   gene            296328..296630
FT                   /locus_tag="Rmet_3752"
FT   CDS_pept        296328..296630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3752"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3752"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10624"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV2"
FT                   /protein_id="ABF10624.1"
FT                   /translation="MSIASISNAPPFAFYKGFDLYPLVYKNQPVQTWPRVKPDGRFNAS
FT                   IVICRAGYRPGSEHTRVFRLENALWENIGTARRGAVQFGEDIINGLVAGESVVSL"
FT   gene            296688..296855
FT                   /locus_tag="Rmet_3753"
FT   CDS_pept        296688..296855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3753"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45222"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY52"
FT                   /protein_id="ADC45222.1"
FT                   /translation="MASKVIRSNTMAKSQLRSTREAKKPKQPKKPAVPGTPFGTTHSRV
FT                   GNEGVAKRKT"
FT   gene            296966..297283
FT                   /locus_tag="Rmet_3754"
FT   CDS_pept        296966..297283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV1"
FT                   /protein_id="ABF10625.1"
FT                   /translation="MIHHNTDPTFRGLPLTAEQDSEIRHYLNRKSRLGKPWNTPELRGM
FT                   LEDMLLPPSTEDDSQTDIPRDALAAAERAAAFVDQDMEPVEAYEELHAAMEAESMKRDT
FT                   H"
FT   gene            297353..297604
FT                   /locus_tag="Rmet_3755"
FT   CDS_pept        297353..297604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3755"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3755"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10626"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGV0"
FT                   /protein_id="ABF10626.1"
FT                   /translation="MTLTFPNPSRTYDEAKRGVWFWGYDNTGEITFLVEDRVLMSFDPA
FT                   LGSGEARMLDSFDRHRDEILQIAMDLYAKGRQTLYTLH"
FT   gene            complement(297688..298311)
FT                   /locus_tag="Rmet_3756"
FT   CDS_pept        complement(297688..298311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3756"
FT                   /product="putative mRNA endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3756"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10627"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU9"
FT                   /protein_id="ABF10627.1"
FT                   /translation="MVVREMRLELGVTSPHWALKTPAITVHCIERRGEDGFGEGNFKAL
FT                   FESWEQGQVRRGPLTGSHIFKVHIMQSKTTITLADPHPVLGSTQVFKTFNYAPAVAAGG
FT                   LLFIAGQIGIRADGTVPETVEEQIDLAFQRLRAILQAAGLGFEDLVELVSYHVDVDKQL
FT                   TAFREIKDRYIKADAPVWTILGVAALARPTLFVEIKAVAATRAV"
FT   gene            complement(298666..298821)
FT                   /pseudo
FT                   /locus_tag="Rmet_3757"
FT   CDS_pept        complement(298666..298821)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3757"
FT                   /note="acyl-CoA dehydrogenase-like protein; partial
FT                   overlap"
FT   gene            complement(298818..299003)
FT                   /locus_tag="Rmet_6623"
FT   CDS_pept        complement(298818..299003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6623"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45223"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY53"
FT                   /protein_id="ADC45223.1"
FT                   /translation="MVANATRLHHLEEENDEPIQQDLPPETGVPHKQPYEQSYKLPYTP
FT                   TVSPGKLAPPCTARSA"
FT   gene            298911..299258
FT                   /locus_tag="Rmet_3758"
FT   CDS_pept        298911..299258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10629"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU7"
FT                   /protein_id="ABF10629.1"
FT                   /translation="MRHARFGGQVLLDGLVVFFFEVVEPSGICDQRADGFTPFGCTVLG
FT                   SVDARALLSPTGAECKVGGGSGKVVRPRYAYFRSEFCRRWNFARRSPLLKLRSSNVQRS
FT                   ALVVWTPVAGR"
FT   gene            299272..299661
FT                   /locus_tag="Rmet_3759"
FT   CDS_pept        299272..299661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3759"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10630"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU6"
FT                   /protein_id="ABF10630.1"
FT                   /translation="MLCVVMCFIPFLIPAAVIIAALSYLRIQTTRIEVTTKRVTVRSGI
FT                   MSMKLDEVELSLVRDIQLTQPLLLWLLKLANIAIVSSNGASPDIHLHGIPNAYVLREKI
FT                   RRCVENHRDSKGVRDSESRHLVAHA"
FT   gene            299750..300748
FT                   /locus_tag="Rmet_3760"
FT   CDS_pept        299750..300748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3760"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3760"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10631"
FT                   /db_xref="GOA:Q1LGU5"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU5"
FT                   /protein_id="ABF10631.1"
FT                   /translation="MNSSSTPTARFVSTGTLPGPEEIRSLVEAAYENFREEAGGKLADY
FT                   IPALAEADPSAFGICVANTRGHAFMVGEAAETFSIQSVSKPFVFALVCEALGAAEAATR
FT                   LGVDATGLPFNSIMAMELRTDGTSNPLVNAGAIAATSLIPGFGADDRWHHVRQGLSRFA
FT                   GRELACDEHVYESEAANNQRNAGLAHLLRGHGRLYCDPDEAVEVYTRQCALLVSARDLA
FT                   LMGATLAGGGVHPLTGEQVVSAATCQRVLAVMATAGLYERSGSWLYDVGLPGKSGVSGG
FT                   ILTIAPGKGAVATFSPPLDAAGNSVRGQLVMRFLSERLGLNLFISAPAAHL"
FT   gene            complement(300847..301074)
FT                   /locus_tag="Rmet_3761"
FT   CDS_pept        complement(300847..301074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45224"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY54"
FT                   /protein_id="ADC45224.1"
FT                   /translation="MSLRDIEELLFERGVVVSYETTRRWCDKFGGNFSHRVTAVRRRPG
FT                   STWHLDERPRKTLGFDTPAERFHQPVALTG"
FT   gene            complement(301199..301582)
FT                   /locus_tag="Rmet_3762"
FT   CDS_pept        complement(301199..301582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10632"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU4"
FT                   /protein_id="ABF10632.1"
FT                   /translation="MYPERAALLQSEVHVMKNNRMLAVACGTFIVALSAAHAQPTQAPN
FT                   SGANPSYSNSQGKFDPYTQGANTDSTKSNLSPSATPSSPMDPSTPMQGTSQVNPYPQGV
FT                   RQDPQFNPGGHVYDVRNPFFMGS"
FT   gene            complement(302183..302521)
FT                   /locus_tag="Rmet_3763"
FT   CDS_pept        complement(302183..302521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3763"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10633"
FT                   /db_xref="GOA:Q1LGU3"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU3"
FT                   /protein_id="ABF10633.1"
FT                   /translation="MHRDAEEVPHMPTLDKTFMLIGSDGKPYSSAMPGIFGGHRDSKLY
FT                   GRMDCRAALQAIARGGYVKHRVFFADEATAIAAGYRPCAICMPQEYATWKVNQPTKSSG
FT                   NTRKEARS"
FT   gene            complement(302511..303215)
FT                   /locus_tag="Rmet_3764"
FT   CDS_pept        complement(302511..303215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10634"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU2"
FT                   /protein_id="ABF10634.1"
FT                   /translation="MTAFDATLDRLNWVDIGLQLDAEGYAVLPGLLGADAARDLARLTS
FT                   ASGADRVALASSGLGRGELLVFGTGLPAPLEQWRTALYRRLVIVANRWNETIGVDHRYP
FT                   AELEDFSRRNRKAGQTRGQSHLSRLSVEDHVLLHQRNEGEQVFPMQIVAVLSEPGVDFQ
FT                   GGEFVLTEQRPRMQSRPAVLPLWIGDVAVITTAERPFKGTKGYYRVNLKHAISRVRKGE
FT                   RIGLELSFHDAP"
FT   gene            complement(303230..304294)
FT                   /gene="ada"
FT                   /locus_tag="Rmet_3765"
FT   CDS_pept        complement(303230..304294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="Rmet_3765"
FT                   /product="fused DNA-binding transcriptional dual regulator
FT                   ; O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10635"
FT                   /db_xref="GOA:Q1LGU1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU1"
FT                   /protein_id="ABF10635.1"
FT                   /translation="MKTTIAYETEDDRWTAVQARDAGADGHFVYAVRTTGVYCQPSSSA
FT                   RLPKRENVEFFDSAEIAEAAGYRCSRRAHGDQTSAAAERAALVARACRMIEASETPPQL
FT                   DDLATAIGMSPFHFHRLFKAETGLTPKAYSSAYRARKLREELSSPEASITNAIYDSGFN
FT                   SNSRFYEASDQLLGMRARDYRSGGVGAVIRFAVGQCSLGAILVAQSQRGICAILLGDDP
FT                   DQLVRDLQDQFRKAEIVGCDGEFEQLIAQVVGFIEAPAMGLHLPLDVQGTAFQERVWRA
FT                   LREIPPGTTVSYAEIAERIGSPKAVRAVAQACATNHIAVAIPCHRVVRRDGDLAGYRWG
FT                   VDRKRELLRRETQV"
FT   gene            complement(304378..305034)
FT                   /gene="alkA"
FT                   /locus_tag="Rmet_3766"
FT   CDS_pept        complement(304378..305034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="Rmet_3766"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10636"
FT                   /db_xref="GOA:Q1LGU0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGU0"
FT                   /protein_id="ABF10636.1"
FT                   /translation="MSGIHAKTIAADLSPLAYRRAVKFLSELDEDWALHIAAIGPCRHE
FT                   AKPAREPYEALVRAIAYQQLHARAGDAILGRLLALYPGVSFPAPEQLLASDPELQRACG
FT                   FSAEKLATIRRIAQATVEGLVPNLEEARRLPDTALIERLTSLRGVGRWTVEMFLIYSLE
FT                   RSDVLPVDDFGVREGYGRLKGLERAPTPRQMREIGEAWSPFRTVAAWYLWRLPSR"
FT   gene            complement(305037..305588)
FT                   /gene="ogt2"
FT                   /locus_tag="Rmet_3767"
FT   CDS_pept        complement(305037..305588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt2"
FT                   /locus_tag="Rmet_3767"
FT                   /product="O-6-alkylguanine-DNA:cysteine-protein
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10637"
FT                   /db_xref="GOA:Q1LGT9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT9"
FT                   /protein_id="ABF10637.1"
FT                   /translation="MFLSQLDSPLGAMLLVTDARRVVRALDFADHKSRLYRGLREHYGE
FT                   VELTEIPAPAEIADALARYFHGELEALKVLRTATSGSALQRRVWAALRRIPVGTTTTYG
FT                   KLAKALGFDDPRAAVEIGAANGANPIAIVVPCHRVIASNGDLKGYAWGLHRKRWLLEHE
FT                   NAMVAKKMQPETQTAMLPGF"
FT   gene            complement(305637..305828)
FT                   /locus_tag="Rmet_3768"
FT   CDS_pept        complement(305637..305828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3768"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT8"
FT                   /protein_id="ABF10638.1"
FT                   /translation="MSRISAEPPGQLADTRRQVEAYCQSLVDTGEARWRINNDGDTELH
FT                   MKGGEAYLFGKFGVTRLK"
FT   gene            complement(305913..306497)
FT                   /gene="alkB1"
FT                   /locus_tag="Rmet_3769"
FT   CDS_pept        complement(305913..306497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB1"
FT                   /locus_tag="Rmet_3769"
FT                   /product="alkylated DNA repair protein alk"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3769"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10639"
FT                   /db_xref="GOA:Q1LGT7"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT7"
FT                   /protein_id="ABF10639.1"
FT                   /translation="MVLRGFALPYVPDLMPAIAGIETTSPFRHMVTPGGFTMSVALTNC
FT                   GALGWTTDRRGYRYTTVDPDTGKPWPVMPEVFFRLANEAAAEAGFDDFEPDACLLNRYL
FT                   PGSRLALHQDKNEQAYETPIVSVSLGMRATFLFGGHARTAPTIKVPLHHGDVVVWGGAD
FT                   RLRYHGVMPIKDAPHALLGSQRINFTFRKAA"
FT   gene            306672..306968
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_3770"
FT   CDS_pept        306672..306968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_3770"
FT                   /product="transposase DNA binding site ISRme3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10640"
FT                   /db_xref="GOA:Q58AB8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q58AB8"
FT                   /protein_id="ABF10640.2"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
FT   gene            306965..307858
FT                   /gene="tnpB"
FT                   /locus_tag="Rmet_3771"
FT   CDS_pept        306965..307858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB"
FT                   /locus_tag="Rmet_3771"
FT                   /product="transposase catalytic site ISRme3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3771"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10641"
FT                   /db_xref="GOA:Q1LA93"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LA93"
FT                   /protein_id="ABF10641.1"
FT                   /translation="MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRG
FT                   RLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRK
FT                   YIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVV
FT                   GWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMS
FT                   RRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSP
FT                   MTFEKNWSAAQQHRAA"
FT   gene            307932..308213
FT                   /locus_tag="Rmet_3772"
FT   CDS_pept        307932..308213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3772"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3772"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10642"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT4"
FT                   /protein_id="ABF10642.1"
FT                   /translation="MQLREMAELRIKNEAITDAVTSLLMLGKKQDTVVKKLRELAMKKS
FT                   DADASWLVKQYLAWESEAPAASDAQSLEMRAAQEMEQDQRTLMGSTAV"
FT   gene            308210..309517
FT                   /gene="tnsD"
FT                   /locus_tag="Rmet_3773"
FT   CDS_pept        308210..309517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnsD"
FT                   /locus_tag="Rmet_3773"
FT                   /product="Tn7-like transposition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10643"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT3"
FT                   /protein_id="ABF10643.1"
FT                   /translation="MNVFMSPAYDDELVYNVCTRYLAEFPTVSRERIITDVFGVNIVLS
FT                   PHLPRNLHQFCERTGQVIAKTKEEMFWWHSMYPFICAYQTSERRAQARDYAFYGRAVRR
FT                   MPGILAAIEPPKFLRWCPDCVVEDRARPDCGEAYWRRTHQIPGVWQCDKHGTDLVDSQV
FT                   PRFASVTSDHPAEMMIPRNVRPFRKKRPCSPMEALLRKHLVALLKAGHFEDRPEHPNFR
FT                   EAAARAGFGPTVKIDYTELYEAFSEYWGDVLERLDERYRTRPAGVSWLHAQFNARGLMG
FT                   QPVVRELFDIFFRDRCGLDVYQMPPLESSYKRFMPVFYCPNPYAAHGRGEQVKRVTRCK
FT                   DNPDILDISCKCGFTAMVSAASAGKTMTMADVIKVGKFGPTWPEQCAKLRAEGKGLSQV
FT                   AKELNLPENTARYLWRQSKPLLAADEKTLKKQESAK"
FT   gene            309514..311229
FT                   /locus_tag="Rmet_3774"
FT   CDS_pept        309514..311229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3774"
FT                   /product="putative transposon transposition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10644"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT2"
FT                   /protein_id="ABF10644.1"
FT                   /translation="MNVFVSPLYEDELLYSHCVRYLSEFPMVWRNKLMLDMFGAELHLS
FT                   PHLPRNLQEFSERTAISLSMTKEEIFWRHSMYPFLCAYFPEKSRTFAMDYAYYGHENRP
FT                   MLAVLRGVFPPRFMRWCPDCVTEDRARPECGEAYWRRAHQLPGVWQCEKHRCDLIDSAI
FT                   PRASSSEPFRAADVVIPEDAHRFRAKRNCSSMEAMLRTRLVGLLNSGDFAYRPEHPNFR
FT                   EAAARSGFETAGKIDYPKLYEAFSGYWGDVLDRIDSQHLRTKVVGTGWLRRQFTKKEVI
FT                   YQPVGREMLDIFFQDRFGIDLNELPMEIPGRRRPPVFYCPNPYAEHGAETPVRKSIRRP
FT                   SMPGVASLSCECGFTALVPETSAEQAIGLADVIKVTRYGPSWVKECLKLRAEGKTLDEV
FT                   AAALGVKYQAAFDWSREGGPKYSPMSSEQSEARRAEWVAILEKIAPGPPKLATKRYPSL
FT                   HIRLLSEDREWFQETMKAYRQKYGHSQKRANWPARDEEYTEAVVAAAARLQRMDGAECP
FT                   TVSALLKEAALEFSYFSKGSIRHFPKTIATLTRLSGKPWSTFSPYLDGGKEAEG"
FT   gene            complement(311252..311470)
FT                   /locus_tag="Rmet_6624"
FT   CDS_pept        complement(311252..311470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6624"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45225"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY55"
FT                   /protein_id="ADC45225.1"
FT                   /translation="MQAGLGLDIKVLSKCMLGAPADPCSVPADFTHTSPYLQEDRNSAA
FT                   IQLLPGCSTLTPQKGRSHERPFPAAPA"
FT   gene            complement(311511..311786)
FT                   /locus_tag="Rmet_3775"
FT   CDS_pept        complement(311511..311786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10645"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT1"
FT                   /protein_id="ABF10645.1"
FT                   /translation="MLSNNSGDLANCAAPERKVWREGDTPARRALADTSSRQRSEVVPP
FT                   TNDGALRRATLVQGVRGRQVLVQTLMSPPIRLNLHIKALASAPLSH"
FT   gene            311904..313091
FT                   /locus_tag="Rmet_3776"
FT   CDS_pept        311904..313091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3776"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10646"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGT0"
FT                   /protein_id="ABF10646.1"
FT                   /translation="MDRPYQMVPYALGTADGQRTLGFLFSLTGKEKTVVSLMHPREMAI
FT                   THYLVPFVLDAGCACWVQGPRSIGNDLRLEHEIALFDVAAGMTHLRDLGYEKIVLLGNS
FT                   GGAGLYTFYNQQSLTPREMRIARTPGGRPTNLGELHMPEVDAFILVSPHPGQGKLLMSG
FT                   IDPSVADEDDPMQTDPRLDPFSKANGFDVESGKGRYAPDFIERYRAAQTERVARIDARA
FT                   RAMLRAKQEARQKVKAGAGTDSDRRLAAHAPIFEVWRTDADLRSWDISLDPSDRKTGSL
FT                   WGKDPFVSNWGSVGFGRVVTPESWLSTWSGLSSNAALDKTIGTLHQPTLLLEYTGDQCT
FT                   FPADIQAIYDQIPAAHKQHIRVRGNHHGMALSREEEPGQRIAGRHIVEWLRESMA"
FT   gene            313135..314838
FT                   /gene="entE"
FT                   /locus_tag="Rmet_3777"
FT   CDS_pept        313135..314838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="Rmet_3777"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase, Enterobactin
FT                   synthetase component E, AMP-dependent synthetase and
FT                   ligase"
FT                   /EC_number="2.7.7.58"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10647"
FT                   /db_xref="GOA:Q1LGS9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS9"
FT                   /protein_id="ABF10647.1"
FT                   /translation="MLQPTHVRPSVLLDGVRYPDEDRLRRYVGDGYLTGETLVGAFRQS
FT                   FRDHHDRLALVGPEGEFTYQELDERTDRLGAALLALGLRPLDRAVFQCGNSNELLFAFL
FT                   GCLKAGIIPLCSLQAFRKLEVSYLGNLCEARLHFVQGDDPKFDDVAFAEEMQAEVPSLQ
FT                   FILQARGERRGRAVLLADLIRDMPLARAQALLAEVDHEPFQAAVFQLSGGTTGVPKIIP
FT                   RFQNEYLYNMRAVAACNGYTAEDVLFFPTPYMHNLNMGCFFGPFLLCGAKVTVAPDIGE
FT                   ETLQSLVRNYEPTWFGVAGPILSRIAPELLRGTASDKARRNFIAPKNAANLTRLTGSPT
FT                   HHIFGMTEGVIMFTRPEDPSEIREQSIGYPVSDADEVRIVHPGTEDTVGDGEVGEALFR
FT                   GPYTIRGYYKSEKEDVTRFTADGFYRSGDLMSAQVVDGKRYYFFLGRIKDVVDRGGEKI
FT                   NAEELENVINQHPSILASAVVGMPDKVYGERVCAFVLLKPAAASGLTLPELAQYLQEVG
FT                   LAKFKWPERLEVIPEFPLTASGKLSKVLLRDRIVQMLRTEAENDTVHQAK"
FT   gene            314852..315730
FT                   /locus_tag="Rmet_3778"
FT   CDS_pept        314852..315730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3778"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10648"
FT                   /db_xref="GOA:Q1LGS8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS8"
FT                   /protein_id="ABF10648.1"
FT                   /translation="MNQSTQGAHVNVPVVALHGVHHTARPTWKLAETVHFYRDLLGLPL
FT                   VHAISAKGWGPDNHADFLHFFFDSGNGSTIAFFYYIGTERPDWLTVREHYQDRATHTAW
FT                   RVRDEAELLQWRQRVEAVGIPLRYQIRHEVIESIYFNDPNGYPIEITWQVRPFSDADKQ
FT                   DAAFTIDSAIELERAREKGAAFASIEPVWQRKAERIERAVPNGEKASVYVLDVPEFAPL
FT                   IDVARKTAGYQTTAIGNGYVRIDGNPTLQFRRKELGFKPAVWYGALTGGLAGSIRQFDM
FT                   DALVVAPGDTQ"
FT   gene            315727..316887
FT                   /locus_tag="Rmet_3779"
FT   CDS_pept        315727..316887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3779"
FT                   /product="putative monooxygenase, FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10649"
FT                   /db_xref="GOA:Q1LGS7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS7"
FT                   /protein_id="ABF10649.1"
FT                   /translation="MKVAIIGGGPSGLFLSILLKERMAQVDIDVFEQNPEDATFGFGVV
FT                   LADTGLSNLRAASPIVVDRLAKAMRFNDQHSIVSHEHPIVMRKPGAGGGAIPRISLLSV
FT                   LQQRAKELGVRVTYNKRIADFDALDADLVVGADGIGSQLRTANEAAFGTTRRTLTNHFA
FT                   WFGVAKPFASPALVFRKYEGGYFVAHYYPYSDSMSTFVAECDHQTWVDFGMEDMSAEAR
FT                   QALFETVFAPELTGHGLVSNNSIWRQFPVILNANWHVGKQVLIGDALTSAHFSIGSGTR
FT                   IAMEDAMALADAIVTHPDDVPAALEQYEAVRKPEKAKLISASEASYNWYERIREWMDLP
FT                   TPHEFVFRFMTRTGRIDAERLRAQFPALMAELAAGGVAAVAAEGQS"
FT   gene            316884..317333
FT                   /locus_tag="Rmet_3780"
FT   CDS_pept        316884..317333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3780"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10650"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS6"
FT                   /protein_id="ABF10650.1"
FT                   /translation="MMRATEYVLSESPFVVRRTVRWGDCDPAGVVYTGRFTDYLLGAVG
FT                   LYTAHMAGGDGRLGEVHGVGTPCKAMRFEFIGTLWPDDVIDITCAVEAIRTRSFDIRCV
FT                   ARRPDGAPVFDAMFSPICVRLDRREGTPIPDSLRAVLNRFLSPAL"
FT   gene            317354..318112
FT                   /locus_tag="Rmet_3781"
FT   CDS_pept        317354..318112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3781"
FT                   /product="Asp/Glu racemase"
FT                   /EC_number="5.1.1.3"
FT                   /EC_number="5.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10651"
FT                   /db_xref="GOA:Q1LGS5"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS5"
FT                   /protein_id="ABF10651.1"
FT                   /translation="MSTYRIGQIVPSSNITMEREVPAIFNARMQVLPEQFSFHASRVRM
FT                   HRVVAEELERMNRDMGRCALELADARVDVMSTACLVATMCMGNGYHRQVIEELGAAIGD
FT                   APYRPQIMTSAGALVEELKDFGARRISLMAPYSDALTKTVVEYIEHEGIEVKDVINFSI
FT                   LDNLEVGERDPLRLLEDVKRLDTKGVDTVVLSACVQMPSLAALEPAQQALGIPVTSTAA
FT                   CTVRQMLRRLGLEAKAPGAGAYLGSQTGLR"
FT   gene            318178..319425
FT                   /locus_tag="Rmet_3782"
FT   CDS_pept        318178..319425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3782"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10652"
FT                   /db_xref="GOA:Q1LGS4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS4"
FT                   /protein_id="ABF10652.1"
FT                   /translation="MHDAPQVLPRAAGWIYVSVILGAALGMLAGYAPLFNATAGVFVRP
FT                   LAAEFGWGRSQASLSYAASMFGLAVVSPIVGAMMDRFGIRRVIVCSAIVFGLATAAMSL
FT                   QNGSMLMWVALSVVVGVSGAATSVLGYLAVLPQWFDRRLGLALGIAMCGLGAGTVILPI
FT                   TAQFLVTTFGWRMAYVGLGVGSVVLSLVACGLLRERFSGSRGAKHVPQGVALAAAMRSY
FT                   RLWAIWLVFVLSSAATLSLGPHLPSLFADRGFDAAMAARSASMVGVGLLVGRLLTGLLI
FT                   DKIHAPLVASVFFIGGAVGVFLLRGTHDYAALLVATTLIGLTIGAEGDLISYLVRSYFG
FT                   LTSFGSLFGIAFSGYGLGAVIGPIGLGAWFDRHGSYDVPLLVLPWMLLAAAALVLSLGR
FT                   YRAGAEGKDATAVASA"
FT   gene            319439..320317
FT                   /locus_tag="Rmet_3783"
FT   CDS_pept        319439..320317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3783"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3783"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10653"
FT                   /db_xref="GOA:Q1LGS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS3"
FT                   /protein_id="ABF10653.1"
FT                   /translation="MACGAIGDRIGIPPISSRSDRPTPMPAARKSPAAKVAAQPSPNPV
FT                   PRRRGRPPKTESPIGAEPMLSRTTILQHAIKLTKTLPLDQISMVQLAKDFGVAPGLIHY
FT                   YLGGRDQLVSGVLNDYYRQRTLRIPPLTGDWRADVERIARLSFQVAVENPGVSNYVASH
FT                   NRYRLFQDVQPGETDYGLEFFNRMTSAIMQGGFSAEQVALGYHLLAQYLVAASMAEASR
FT                   QLPAYHQAFIQNKLDSVSAEQYPGARFVSRSFSQLSSDTAFEEGLRITLDGIAAWQRDV
FT                   KPAKKRSARSA"
FT   gene            320473..321429
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3784"
FT   CDS_pept        320473..321429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3784"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10654"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS2"
FT                   /protein_id="ABF10654.1"
FT                   /translation="MKRPFLALTLLALALPAVASTYPDKMVRILVPSIAGSAPDIIARQ
FT                   VAERLTSAWKQQVIVENKPGGNGIVAMSALKQAPADGYTLVLFHAAAAVTTPVMYKEAK
FT                   FDIQRDTEVAATLAYTPMMFVAGPATPYKSLGDVIKDAKARPDDVVIGSPTRGSVPHLT
FT                   AEMMGQLQKTKFRQVSFSGTTQAIQAVVKGDIPVYVDGIAPLVPLVRGGRLKALAVTSD
FT                   VNLPGMEGIPLAKDIAPGLVAKGWFTIFAPKGTPVPVLDRVNAAVNQSLTQQPFVDRLK
FT                   DLGTYPMPMSRPEGARFIEAEKLRWEKVISDAGVKPE"
FT   gene            321465..322646
FT                   /gene="rnz"
FT                   /locus_tag="Rmet_3785"
FT   CDS_pept        321465..322646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="Rmet_3785"
FT                   /product="zinc phosphodiesterase, putative tRNA 3'
FT                   processing RNase Z-like protein (beta-lactamase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10655"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS1"
FT                   /protein_id="ABF10655.1"
FT                   /translation="MRDLFSRAGAGPVNGFRLLCAGACAALAVLASTSHADSIGQPHST
FT                   SAEQSGANLVLLGTAGGRTSWRGSQSAGIASAVVVNGQVYLVDFGAGWLRRYFQAGLGA
FT                   PPPGQGLETLRAAFITHLHADHIVDYPSLVLFGASDGLAERRQKLKVIGPGSRGKLPPA
FT                   SGGNDGVADVVAPEQPMPGTVAMTEALYRAFAADINDNILDSRKPNPHSRVDVMDITLP
FT                   AGLDVDPDRDPAPPMAPFEIYRDENVRVTATLVNHAPVYPAFAFRFDTSTGSVVFSGDT
FT                   SPDRNLIRLAQGADVLVHEVIDTAWVDSLFPKPRSAAQEAKAHHLVHAHTAASDVGAVA
FT                   EAAHVKTLVLSHLAPADSDPHRWAAASQGFSGKVIVGRDLLWIPLVPAAPESK"
FT   gene            322787..323962
FT                   /locus_tag="Rmet_3786"
FT   CDS_pept        322787..323962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3786"
FT                   /product="putative outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10656"
FT                   /db_xref="GOA:Q1LGS0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGS0"
FT                   /protein_id="ABF10656.1"
FT                   /translation="MKLNRFAAVALAACSGSALAQSSVTLYGVVDANIEYVNHVGAVPT
FT                   AANGFNPGPGHDVVRMNSGGLSGSRWGIRGVEDLGAGTQAVFVLENGFSGDTGTMQQSS
FT                   RLFGRQAFVGIKNATYGQISLGRQYTSLFDSIVNFVPAYFATQYEPITLFAGANFREDN
FT                   TIKYTLNAGQFTGVAHYSFGTGLALPQTVQSGLAIGGNGEVPGQARRDSAYGASLSYAG
FT                   GSLWAAIAYDQFNPTIGTTTSASSGSFKKATAALSYSLPWGRIMGGYRWGQNKTPAGAT
FT                   IGRDDFFWVGGIYQVGPALSLTLEYDYDKVRNVFGNTSVANPWQVNLIADYSLSKRTDV
FT                   YLSAAYAKNAGLMLDSALIAYANSLSLGNSYVLGNGNSSMLGVSVGVRHKF"
FT   gene            324072..324281
FT                   /locus_tag="Rmet_6625"
FT   CDS_pept        324072..324281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6625"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45226"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY56"
FT                   /protein_id="ADC45226.1"
FT                   /translation="MRPSDGRWIAYGYTPRQTLDCFSLFGCSRLRSSALAVAGSCRPCG
FT                   ASGARSSRFEMECYGKVATMSSWT"
FT   gene            324335..324766
FT                   /locus_tag="Rmet_3787"
FT   CDS_pept        324335..324766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10657"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR9"
FT                   /protein_id="ABF10657.1"
FT                   /translation="MSDAKQDAQRALRADRVSISRALRLSVPPEARPAPVNMKDWIRQR
FT                   KEQLQAARAAAKQRRDLLKAEILSAAQDVAREERIAARQETVRRQAEARTARAYAREDA
FT                   RAIVEFERGQPTRPESKPKTLAQEKHKLVSYADLLRMRE"
FT   gene            324898..325086
FT                   /locus_tag="Rmet_6626"
FT   CDS_pept        324898..325086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6626"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45227"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY57"
FT                   /protein_id="ADC45227.1"
FT                   /translation="MQRFWHWPESGDGVEPWSRPIGRLFCSPAPHQASQAGGDTTGIFG
FT                   TNMIDMVPKWDLHCLQT"
FT   gene            325107..326678
FT                   /gene="fadD"
FT                   /locus_tag="Rmet_3788"
FT   CDS_pept        325107..326678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="Rmet_3788"
FT                   /product="acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II"
FT                   /EC_number="6.2.1.26"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10658"
FT                   /db_xref="GOA:Q1LGR8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR8"
FT                   /protein_id="ABF10658.1"
FT                   /translation="MAPQASARYGCATIAQLYTSAFRACPQALALVEDGVTLTYEALAR
FT                   RSYRMARLFHARGLQRQDVVAFLVGNRVEAVVAIIAAQLAGLKAVSLHPMASEEDHAFV
FT                   LADAGVKALVVDDARFAARAQVLLARVANVLMMPLDDGVLGAGLASQAAAMDDAELEPG
FT                   DDAAEISKISYTGGTTGRSKGILHTHRTVVTMLQAMLATYEWPQQIRYLVTTPISHASG
FT                   SLILPTLLRGGTVYLCDKFSPSDFVSRVAEQRINLTFLVPTQIYALLDHAGLAEADLSS
FT                   LELVLYGASPIAPSRLQEALNRIGPVFGQVYGQAEAPMTISYLSRRDHDLSRSHLLSSC
FT                   GKVMVGNQVKLLDSARREVPVGEVGELCVRGPLVMDGYLNRPEENEKVFAGDWLHTGDM
FT                   ARRDAAGYLYIVDRAKDMIITGGFNVYPSEVEHCLAQHPAIAMSAVFGVPDEKWGESVT
FT                   AIVVPKPGQTPDANELIEFVKSRKGVVNAPKTVIFAEQLPMTALGKIDRKAIRGSYWNG
FT                   KDRQVA"
FT   gene            326744..327724
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3789"
FT   CDS_pept        326744..327724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3789"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10659"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR7"
FT                   /protein_id="ABF10659.1"
FT                   /translation="MGLTRKLLGACALTLAFAGTTVHAQDSYPSKPIRFIVPFAPGGVT
FT                   DLTARTFAKYMGDALKQPLVTENKAGAGATIGANFVAHAAPDGYTMLLGTNVTHAINPR
FT                   LIAATPYDPLKDFQTVAIFGLNGNVLLVSNSFPAKTFAEFLAYVKARPGRVNYASGSVG
FT                   SSAHLAAELLKQDVKGLDYTHVPYGGPSEAMSALMGGHVDFLFANIGAAVTQIQSGKVR
FT                   ALAVTTAKRAPQLPDVPTVAESGVPGFEVVGWMAAFVPKGTPAPTIARLNQVINQAQKN
FT                   PDLRKTLDAAALIPIVESPEQSSRFVREEYEKWGRVIQAANIPPQ"
FT   gene            complement(327888..329678)
FT                   /locus_tag="Rmet_3790"
FT   CDS_pept        complement(327888..329678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3790"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3790"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10660"
FT                   /db_xref="GOA:Q1LGR6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR6"
FT                   /protein_id="ABF10660.1"
FT                   /translation="MSFEPDYADYVSPRPARSHQSSQHLAPDCAGLDFLALDRGLQDML
FT                   RLYLPADAHAHLLPHLERMGKLAGGRLNTLAIVADKHAPVLHVRTRWGEDADWIEYHPA
FT                   YQEMEHIAFGDFQFHAMSHRGGVLGWKEPLPAAAKYAFQYLFVQAEFGQMCPISVSDTS
FT                   IHLIRKYGSAALQEKLLPRLLSSDPGTMWKGTQFMTEKAGGSDVGAIETVAREEDGEWR
FT                   LYGEKWFCSHTDADIALLLARPEGAVDGTRGLALFALPRTLDDGSRNAYRIVRLKDKLG
FT                   TRSMASGEIRLDGAVAYLVGDPTQGLKQMMEQVNLSRLSHAVRAAAMMRRCLNEALVAA
FT                   RHRRAFGREVVGHALLRRQLLKVMVPTEAALSMVMATADIMARAGKGDKTAALALRLLT
FT                   PLLKLRTCRDNIEVATGAMEVRGGNGYIEDFVNARLVRDAHIGVLWEGTSNINALDAIQ
FT                   RAVRKDGAQHALLALMSARLEQATHLPADLRAVLQRSLSRAIALAETVAGDAALEAEVR
FT                   RAASALYYATAATILAWEATQPGVDGRRLLLAHAVLEHYLLPRDPLGSPESKGESEADR
FT                   LLLQGEPVSLEAAGVALTGR"
FT   gene            complement(329739..330962)
FT                   /locus_tag="Rmet_3791"
FT   CDS_pept        complement(329739..330962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3791"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F (CoA-transferase family)"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10661"
FT                   /db_xref="GOA:Q1LGR5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR5"
FT                   /protein_id="ABF10661.1"
FT                   /translation="MIKPLSHIRVLDLTRVLAGPWCTQNLADLGAEVIKVERPEVGDET
FT                   RGWGPPWLPAAEESERRDSSYYASANRGKKSITVNLASADGQAIIRRLAASADVLVENY
FT                   KVGTLARYGLGYDDLREANPGLVYCSVTGFGQTGPYRHLPGYDFVFQGMGGLMSITGER
FT                   DDLPGGGPQKVGIAVADITTGMYASLAIAAALTWRERSGQGQHIDMALLDCMLAFNSNQ
FT                   AVSYLVSGKLPKRQGNAHANAVPYQVFDSLDGKLIVAVGNDSQFAAYCRAVGKPELAID
FT                   TRFAKVTGRIVNREVLLPMLVDVMRTDSTASWLARLKAAGVPCGPVNDFSQTFEDPQVR
FT                   HRGIRVDLPLPDGGICPSIASPMRFSATPLEHSAAPPALGEHTDTVLTECLGLLPAELS
FT                   RLREAGAI"
FT   gene            complement(330978..331958)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3792"
FT   CDS_pept        complement(330978..331958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3792"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10662"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR4"
FT                   /protein_id="ABF10662.1"
FT                   /translation="MNLPRRAALAHSIAASLLFCVANAGAQEFPSQPIRIVVPYAAGGM
FT                   TDIVARVIGQKLGEHLGQPVVIDNRPGAATIVGAEVVAGAKPDGYTLLAATNTTLTINP
FT                   WLYPKLRYDAGKSFTPIALVASAPSVIVVNPLVPAKTLSELMQLAKARHGGLSYASYGN
FT                   GSTAHLAGEMLAARAGAELLHVPYKGSAPAKAAVIAGEVNMTFEPAFTGLPQISSGKLR
FT                   ALAVMSSKRSAVLPDVPTTAELGYPGMEMAAWVGLMAPAGTPTPIVKKLASEVEHALTD
FT                   PAVLETLLKNGAEPAGYYGGSFAAYLRDETARYGKVIADARIHAD"
FT   gene            332106..333020
FT                   /locus_tag="Rmet_3793"
FT   CDS_pept        332106..333020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3793"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10663"
FT                   /db_xref="GOA:Q1LGR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR3"
FT                   /protein_id="ABF10663.1"
FT                   /translation="MDLRQLRYFVALAEELHFGRAAARLAITQPPLSFNIAKLEASLGV
FT                   QLLQRTTREVALTAAGKEIYKEALKILALTANARELAGRAARGEIGAVHVGFVGSAVLT
FT                   PLGERIRAFGAIHPDVDVVLHELNSFEQIDALQARHIDIGIIHPRVIPNGIASHSLHGE
FT                   HFICLLPADHPLARDRTIDVRELRHDDFVLFPRHFSPEFHDQIVALCASVGFTPNIRHQ
FT                   VRHMLTIATLVAKRFGVSIVPRSVDVVTLPNLACRPLGKQATPSELVGIWRDDEQGSAV
FT                   LSMLHALGAPVQQRELANSPRLA"
FT   gene            complement(333032..333634)
FT                   /locus_tag="Rmet_3794"
FT   CDS_pept        complement(333032..333634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3794"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3794"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10664"
FT                   /db_xref="GOA:Q1LGR2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR2"
FT                   /protein_id="ABF10664.1"
FT                   /translation="MATRRTDEAFLEELTHLLITTGVSSLTIGEMAQRMRCSRRRLYEI
FT                   AETKEELFVHVCRNVLEANLEKGYAAARRAPDAARAISAYMHATLNATGLSKAALTDLD
FT                   AIETGRKVFDDYQLARVRGLESMIEEGVRQGLMAPHNPRLVSEAILGAAHRLRNQQFLQ
FT                   QTGMKIGDAFSEFYELILNGLLVRPSAPTRRAKPPRG"
FT   gene            complement(333825..334880)
FT                   /gene="lipB"
FT                   /locus_tag="Rmet_3795"
FT   CDS_pept        complement(333825..334880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="Rmet_3795"
FT                   /product="lipase chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3795"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10665"
FT                   /db_xref="GOA:Q1LGR1"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR1"
FT                   /protein_id="ABF10665.1"
FT                   /translation="MISSERRPGVTLVLVVAGLVGAAVYWATAPTEPAQGPLPARSRTD
FT                   ARPELSASPTDSMRARNITEMPSLAGVDIPPGPEADAQGNLRLTRALRTYFDYFLSASH
FT                   DAGDAAALDQLVRDDIRKHVPQPAEDQAWRLWQRYRAYLSEMQPKATDGPMTSVIGAPD
FT                   TSQVQRLRALIADRNAARARHLPDVAAIWFDDEQTYDDAMLARLEIATQPGLDDAERQR
FT                   RLSTLDATLPESVRAAREAEARPQAISKTIASMQTAGRSPQDIGASLAQAYGPEVAQRY
FT                   QQQAQAEQAWKQRYDDYAAQRSQIVSFAGLSEQDRAQQLETLRRQTFTNPSEALQAEVM
FT                   DKAVGGRRAAQ"
FT   gene            complement(334867..336000)
FT                   /gene="lipA"
FT                   /locus_tag="Rmet_3796"
FT   CDS_pept        complement(334867..336000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="Rmet_3796"
FT                   /product="triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10666"
FT                   /db_xref="GOA:Q1LGR0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGR0"
FT                   /protein_id="ABF10666.1"
FT                   /translation="MEHGNRRGPGRACAHQDTVTLKAGTRRSTSAIARTAAGTAAAIAA
FT                   AIAMAWPASATASSDYAKTRYPIVLVHGLTGAAKMGGVIDYWYGIPEVLRANGATVYVS
FT                   TVPSFNSDEERALALQAYVRAVKLETGADKVNLIGHSQGGPTSRMLAAMSPQDVASVTT
FT                   IGSPHRGSQLADVVLDVINGISSIPLAGPALVNVIQGVTNLLGWFNGLFNGQALNQDAI
FT                   ASARTLTSQGATEQNARLNATLAPGSQSALGPDCDTPGAVAEQRQGRDASGKLVTYTQA
FT                   AYSWTGRGGPINLLRSNLLDPSTAAMAAAAGVMGMKGAGPNDGMVSVCSAKWGRVLSTD
FT                   YYWNHLDEINQMLGMYQDVDPRTVILNHANRLRNDQL"
FT   gene            336029..336268
FT                   /locus_tag="Rmet_6627"
FT   CDS_pept        336029..336268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6627"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45228"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY58"
FT                   /protein_id="ADC45228.1"
FT                   /translation="MFETVKTPDFASTIKTLGGFLQTHAHVGVIPWKGSALSVAATGAG
FT                   PLSHPQSPPSTNANCRPSGSAAKSPPTHRTTNSR"
FT   gene            336315..337277
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3797"
FT   CDS_pept        336315..337277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3797"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3797"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10667"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ9"
FT                   /protein_id="ABF10667.1"
FT                   /translation="MLRIFLAAVMLVLANGSALADAYPSRPVRLLVGYAPGGPVDTAAR
FT                   IYADYLGRVLKQPVIVDNRAGASGAIAAGMTVSAKPDGYTLYFVASPTMTMTPLIQRSV
FT                   SFKPAQDFSYVGLITDYTNVLLINKDFPARNVDELVSYARKHPGEVSFGSAGVGASNHL
FT                   SAELLAQMTGVKMLHVPYKGNAPAMADVISGKVTFMFDITGTAIGHIRGGKVRALAVTS
FT                   KTRNPALPNVPTLVESGLKQYDLTGWYALVGPPGLPADVTDRLVKAQQAVVQDAAYRER
FT                   MVDGGYDLNVSGPAALQERIKKELALWGNVVKTANIEVE"
FT   gene            337482..339014
FT                   /locus_tag="Rmet_3798"
FT   CDS_pept        337482..339014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3798"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10668"
FT                   /db_xref="GOA:Q1LGQ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ8"
FT                   /protein_id="ABF10668.1"
FT                   /translation="MPQERPIAHRISDIPRHWATRTPHNVAVREGDRVVSYAQLWEGVE
FT                   LAQRYLEAQGVGTGDRVLIVAENSLAMITLIFALSELGAWPVVTNARLTAREIEEIRAH
FT                   CTPRLMLFTHAASPDALRHGLRYRAREISPPGLGPLMAADADAGSEREPAELARDVAAL
FT                   IYTSGTTGQPKGVMVTHRGLLHYARVTAEIRRMGPEDCAFAIMPMSHIFGLATLLLATF
FT                   QAGGSLYLVARFNVADACAALQRDEISILQGVPAMFSRILAYLGKSGVTTLHPKRLRYL
FT                   YTGGGPLDLALKRNVEAMFGQPLHHGYGMTEYAGSLFITRTDRPRSDSSAGEIVEGAEL
FT                   RVVGPGGEPVPEGSPGELWVRGPGVMRGYYRAPEQTAEALRPDGWLNTGDIGRIDQDGA
FT                   LFIVGRTRDLIIRSGFSVYPIEVESVINSHPSVRLSAVVGNPAEDGDEEIIAFVEIREG
FT                   ETFDERDLHAYLAERLSPYKRPARIVRVSAVPTTASGKLHKHRLRGMIAELV"
FT   gene            complement(339049..339951)
FT                   /locus_tag="Rmet_3799"
FT   CDS_pept        complement(339049..339951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3799"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10669"
FT                   /db_xref="GOA:Q1LGQ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ7"
FT                   /protein_id="ABF10669.1"
FT                   /translation="MRFDLVDLNLFTHIAEASSLTRGAERCHLSLPAASTRIKNLEEQV
FT                   GVKLLSRSSLGVKVTPAGATLLAHARRVLRQIEQLSGDLQEYSSGIKGHVRVFANTTAM
FT                   SEFLPGVLRTYLVNHPDVTVDIRERLSPDIVRAVQEGMVDIGIAASGVNMEGLEVMPYR
FT                   LDRLVLATALSHPFAQKKRVRFVETLDQDFIGLPEESAIHNFLKRAASDLQRNLRWRIQ
FT                   VSNFETAARMIEANVGIGVLPESTARRLSQTMALKIVPIEDEWAERKLQICVADLDALP
FT                   VFARKLVELLVEDGIGNPV"
FT   gene            340060..340923
FT                   /locus_tag="Rmet_3800"
FT   CDS_pept        340060..340923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3800"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10670"
FT                   /db_xref="GOA:Q1LGQ6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ6"
FT                   /protein_id="ABF10670.1"
FT                   /translation="MQMAGWPRIGQADRGRRKKETGMTEEDGLLVAISDGVATLTLNRP
FT                   KQKNALNGSMRDGLCDAVQRIRADRSVRAVVLRGAGEDFCSGGDIRAMNVTEADAGRAR
FT                   MDDMHGWIAMLLDLDRPVVAAVDGVAYGAGFSIALLADFIVASPRARFCMPFMKVGLVP
FT                   DCGALYTLPRVVGMAKARELVFSAREIGAEEARQIGAVFEIVPEDKLHARADELARGLA
FT                   GASPAAFAMAKRALNQSLGSDVRAMLEMESLGQGIAFTTSYHREAVRRFKEKEPPLFRW
FT                   PAAPRD"
FT   gene            complement(340987..341979)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3801"
FT   CDS_pept        complement(340987..341979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3801"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3801"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10671"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ5"
FT                   /protein_id="ABF10671.1"
FT                   /translation="MQSPRSFAMRRRLLAAGLLGAVAHPLSALAADTWPSKPVRMIVPF
FT                   PPGGPVDTTARIFGQKLGEMWKVPVVIDNRPGAGGVIGATVAAKEPADGYSLFVGAIHH
FT                   SVNPSLMGKLPYDIEKDFAPVSFATMYPIFVVVHPSVPANNIKEFIAYAKKSDKPLAFG
FT                   SSGNGGGTHLAGELFNMEAGTKLQHIPYKGSAPAMSDLLGGQVQVMFSDAPTALPHIKT
FT                   GRIKVLGVASRQRSAILPDVPTVAESGLPGYEAYSWSALFAPAHTPQPILNKLNADFNV
FT                   AMNDPAVRQRMVQAGADADPGTQEQMRQRLHSEIEKWKKVIQTAGITAG"
FT   gene            complement(341990..343627)
FT                   /locus_tag="Rmet_3802"
FT   CDS_pept        complement(341990..343627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3802"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10672"
FT                   /db_xref="GOA:Q1LGQ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ4"
FT                   /protein_id="ABF10672.1"
FT                   /translation="MHTADRFSASKPPLAIYEWRRPGFAAMLAGLSPATQRTAIPVTTR
FT                   IHHLLDRWLTESPDQPFIHLPDGRSLTFADLGALTTAAEAELLALGVLPGDRVLVVAEN
FT                   CPEHAALILACSRVGAWSCGVNARMAPAEIDAFAAKADARVIYFTAAASRAASAHARRF
FT                   DAVPSALNGMEHSHVRANAMPEGQPLQDQVAALIFTSGTTGEPKGVMLTHDALIHFARV
FT                   TCEARALSPVDRSYAFVPMTHIFGLGTVLLSSLLAGAQLVMRPQFDPADLLDALAHCGV
FT                   SQLQGPPTLYSRLLAHLQHEGITTPTAPALRYLYTGAGPLDLSLKQRVEATFGLTLHHG
FT                   YGLSEYAGSVHVTRLGDRRADTSAGYAVAEAEVQVTDPVTGTPLPLGERGELWLRGRGL
FT                   MPGYFRDPDATAKAMREGGWYASGDLGEMHADGALFVVGRLKEMIIRSGFNVYPAEVET
FT                   ALNTHPSIQRSAVVGCRESDGNEEIIAFVELRPGATLDVAALQNHLRERLAPYKRPARI
FT                   VALPELPTNNNGKILKRELQEQAASLLS"
FT   gene            343717..344910
FT                   /locus_tag="Rmet_3803"
FT   CDS_pept        343717..344910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3803"
FT                   /product="putative acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3803"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10673"
FT                   /db_xref="GOA:Q1LGQ3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ3"
FT                   /protein_id="ABF10673.1"
FT                   /translation="MDLRFTKEEEAFREEVRAFVQANLPTDIRDKVLGHRRVEKDDYVR
FT                   WHRILHAHGWGAPTWPKEWGGTGWNALQRLIFEIETLRAGAPRMLPFGLTMIGPVLMKY
FT                   ASAAHKERFLPRIPTVDEFWCQGYSEPGSGSDLASLRTSAVRRGDKYIVNGQKTWTTMA
FT                   HFADWIFCLVRTDPEAKAQEGISMLLIDMKSPGVTVRPIKTLDGGHDVNETWFEEVEVP
FT                   VENLLGEENKGWTYAKYLLGHERTGIAGIGHCYRELRLLRKYAAETTDGRGGRLIDDVR
FT                   MRDKIARLEMDLMALEMLLLRVATQAAGTPGPEASIVKIRGSELQQDIAMLQMEVAGPN
FT                   GWPYSTDWMELGAPQPVSGAEWAAPAASTYYDMRKTTIYGGSTEVQKNIISKMIIGF"
FT   gene            344928..346037
FT                   /locus_tag="Rmet_3804"
FT   CDS_pept        344928..346037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3804"
FT                   /product="putative acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10674"
FT                   /db_xref="GOA:Q1LGQ2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ2"
FT                   /protein_id="ABF10674.1"
FT                   /translation="MDFTYSEEQRMLADSLRRFVESEYSFEKRRRNAREHGSFDRGIWS
FT                   SLAEMGVLGLAVPADHGGFGHGPASQVVVQRELGRALVQEPVIPSGVIATAILAHHAPA
FT                   ALQAEWLPAIASGDKIFTLAYLEPDSRYRPEVARTTARKAGADGYVLNGRKSVVWHGAA
FT                   ADTYIVSAMLDGALALFLVSRDAKGLAVTGYPTMDRLSGAGLQLADVPATLVTTNGLEA
FT                   LELGLDHGVAAQCAAAAGAIERLIEITAEYLGTRKQFGKPLASFQALQHRVADMLLQKE
FT                   LALSMAYVAAQGLDATDAAERRRKVSAAKVVTAKAARFAGQQAVQLHGGMGMTDELEVG
FT                   DYFKALTMVDVLLGDTDLHLERYGEAMAA"
FT   gene            346064..347230
FT                   /locus_tag="Rmet_3805"
FT   CDS_pept        346064..347230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3805"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3805"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10675"
FT                   /db_xref="GOA:Q1LGQ1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ1"
FT                   /protein_id="ABF10675.1"
FT                   /translation="MTINSKAYIVGAYEHPTRKAPDKTVAQLHAESAKGALEDAGLSLA
FT                   DVDGYFCAGDAPGLGMVNMVDYLGLNVRHVDSTEMGGSSYIAHVSHAAQAIAAGKCNVA
FT                   LITLAGRPRSEGSSGTQARNWGANLPDQPFEAPFNPVTVNLYAMVAQRHMYEFGTTPEQ
FT                   LAWVKVAASHHAQYNPNAMLREVVTVEDVVNSPMISDPLHRLDCCVVSDGGGALIVARP
FT                   EIAAKLNRPKIKILGAGEHVKGLLGGQVDLSWSAARFSGAAAFEEARVTPADIKYASIY
FT                   DSFTITVLMQLEDLGFCKKGEGGKFVMDGNLISGVGKLPFNTDGGGLCNNHPANRGGIT
FT                   KVIEAVRQLRGEAHPAVQVKNCDLALAQGTGGYMGSRHGSATLILERE"
FT   gene            347245..347643
FT                   /locus_tag="Rmet_3806"
FT   CDS_pept        347245..347643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3806"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10676"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGQ0"
FT                   /protein_id="ABF10676.1"
FT                   /translation="MTTPYVPTPYKAPDEQPDNTAFWQAAREGRLLVRQCKSCGKPHWY
FT                   PRTLCPFCMGDTEWKTASGQGEIYSFSITRRAGPNPFCIAYVKLDDGVTMMTNIVDTDL
FT                   DTVHIGQRVKVRFAETDGGAPVPVFAPV"
FT   gene            347657..348550
FT                   /locus_tag="Rmet_3807"
FT   CDS_pept        347657..348550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3807"
FT                   /product="putative dehydratase (MaoC-like domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3807"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10677"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP9"
FT                   /protein_id="ABF10677.1"
FT                   /translation="MPISYQHLRNRPFAPVRQHYTARDTMLYALSLGLGNDPMNASALP
FT                   FVYEGAASGLRALPSQAVVLGYPGFWAREPDTGIDWVKLLHGEQRLRLHRPLPAEAEVV
FT                   GHNRITHLTDKGAGKGAIMVTERKLETAQGELLATVQQVSFLRGDGGYSQADGGQPSDD
FT                   PLPALRPTPEDRAPDFVDTQPTRPEAALLYRLMGDFNPLHADPAVAAAAGFERPILHGL
FT                   ASYGLVAHALLRQCAGHDPARLRAFDIRFASPVFPGETLVTEIWRDPAQPNQFQLRAKV
FT                   LERDKVVLSHGWAEIA"
FT   gene            348568..349860
FT                   /locus_tag="Rmet_3808"
FT   CDS_pept        348568..349860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3808"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F (CoA-transferase family)"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10678"
FT                   /db_xref="GOA:Q1LGP8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP8"
FT                   /protein_id="ABF10678.1"
FT                   /translation="MTTPSDSTTGLPLPSRQTGALSHIRVLDLSRVLAGPWCTQNLADM
FT                   GADVIKVEKPGAGDDTRHWGPPYLQDEDGPTSQASYFAACNRNKRSVTIDIAKPEGQKL
FT                   IRELAMQSDVVIENYKTGGLKRYGLDYDSLSALNPRLIYCSVTGFGQTGPYAARPGYDL
FT                   LIQAMSGLMSITGQADGEPGAGPVRVGVAVIDVFTGMYATTAILGALEARHFTGRGQHI
FT                   DVALLDVAMAVLANQGAGYLNAGVVPTRQGNTHPSVVPYQDFPTQDGDMLLAIGNDGQF
FT                   VRFCEAADVDWARDERFATNSARVTHRRTLIPMMSEVTRTRPTSEWIRLLEAASVPCGP
FT                   INDIAQAFADEHVQHRGLRVEQERYGEAGCPPSDSVNRICSTASPLRLSETPTTVRYAP
FT                   PGLGQHTDEVLRDNLKLGSDEVADLRAKGIL"
FT   gene            complement(349916..351106)
FT                   /locus_tag="Rmet_3809"
FT   CDS_pept        complement(349916..351106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3809"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F (CoA-transferase family)"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3809"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10679"
FT                   /db_xref="GOA:Q1LGP7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP7"
FT                   /protein_id="ABF10679.1"
FT                   /translation="MPPAVLPLEGVTVVALEHAVAAPFASRQLADLGARVVKIERPGVG
FT                   DFARGYDKTVHGMSSFFVWANRGKESLSLDLKHPDAADILQQLLDEADVLIQNLAPGAA
FT                   DRLGLGFDALHTRFPKLIVCDISGYGDHGPYRDKKAYDLLIQAAAGLISVTGGEDAPSR
FT                   AGISIADIAAGMYAYSGILSALLLRARTGVGERVEVTMLEALGEWMSYPLNFAHYGGTP
FT                   PARHGLAHPSIAPYGHYRTGDGGSVIFGLQNDREWQRFCLNVLDDAALANDPRFTTNLE
FT                   RVNHREALDVEIGKHLNRMTRDELIERLDQGGIANAPLNDMHDVWNHPQLAARQRWRDV
FT                   ATPAGSIQALLPPATLTNAPARMGDVPDLGEHTAAILGKLGYTAAQLEALRQQGAI"
FT   gene            complement(351213..352331)
FT                   /locus_tag="Rmet_3810"
FT   CDS_pept        complement(351213..352331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3810"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3810"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10680"
FT                   /db_xref="GOA:Q1LGP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP6"
FT                   /protein_id="ABF10680.1"
FT                   /translation="MRLSPSGSVVTGNVFAMSPCHGASDHYRIDSAARASRKVLSPLRR
FT                   IRTAMPEAPLAPRHRPAPWQQETTLRFELTDLRVFVAIAEAGSLTMGASDMHLTAPSAS
FT                   YRLKNLEQTVGVPLFNRTQKGMVLTAAGETMLQHARTILDNVEQLQIGMRRHTDGIEGH
FT                   IRVYANSSTMCNLPVALSRFLAAYPNVNVDLEEHLSADSVRAVQEQRADIGLVAGAIDL
FT                   HGLDSILYGADELLFVVPPRHPLGMRDSVSLVQALRHELVSIGSKSSNFLYLQDMATRA
FT                   GIVPHVRVHAPNFPAVIRCVQEGAGIALVPRSVAAPAIAQGLVEGVVLDEPWAMREQRV
FT                   VARSLQSLPDYTRAFIRFLTESSESFPDTVLR"
FT   gene            352330..353313
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3811"
FT   CDS_pept        352330..353313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3811"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3811"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10681"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP5"
FT                   /protein_id="ABF10681.1"
FT                   /translation="MIPSLYRLGAALICAGALLATATPAAADAGYPAKPIRLVVPYAAG
FT                   GPTDTFARALVAGWSRQLKAQIVIENRTGAGTLVGTEYVSKATPDGYTLLLTTVAHAVN
FT                   PSIHDALPYRTIEDFAPVGLAARAPLVLVVNKKLPVGNLKEFIAYLKAHPGQVNYSSAG
FT                   VGSAPHLGAELLNYMSDTKTVHVPYRGSAPAMADLIGGHVAFMFDSAPTGLAQVRAGTV
FT                   KLLATTMAARLPQTPDAPAVAEVVPGYEAYTWNAVFAPANTPPEVIRKLTDTLGATLKE
FT                   PALQAKAVDLGLQLEPNPTPQALAQFVRAEIAKWKPVAVAANMKAD"
FT   gene            353345..353815
FT                   /locus_tag="Rmet_3812"
FT   CDS_pept        353345..353815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3812"
FT                   /product="putative dehydratase (MaoC-like domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3812"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10682"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP4"
FT                   /protein_id="ABF10682.1"
FT                   /translation="MIRHELCAQRYFEDFEVGERMNLPSRTMTDALFAAFQLASGDNHP
FT                   VHYDVEYCRAHGMPHMLAHGFQVLIQTAAGAGLFPHMVEESLKGFIEQSSRFLAPVYVG
FT                   DTLYCSLTVSELIPGRTTGVLVMQSEIRNQNDVRVMEGTQKYLLRKRVPDAR"
FT   gene            353805..354782
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3813"
FT   CDS_pept        353805..354782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3813"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3813"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10683"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP3"
FT                   /protein_id="ABF10683.1"
FT                   /translation="MRVSTRSTRFIRPFALLALALCASAVAAEDKFPSGPVTLIVPYAP
FT                   GGTTDVVARQYAVALQTALGQSVVVENRPGVSGTLGAQALLRAKPDGYTLAMIPATVFR
FT                   QPFIQKTAYDPASDFTYLARISGYTFGIVVRADSPWQSWADFLKSARADPGKYSYGSPG
FT                   QFSTPHVTMLEIGAKTGISLNAVPYKSDAECIPALLGGHVSMCAAGSSAGTLVDSGKLR
FT                   WLNLWTERRSTRWPDVPTLRELGLDLVSASPYGIAGPKGMKEPVVRVLEDALHKAAVDP
FT                   VHLAALKRQDQALMYMDGAAYKRFVAEQISVERAMVQRLGLKAD"
FT   gene            complement(354797..354976)
FT                   /locus_tag="Rmet_6628"
FT   CDS_pept        complement(354797..354976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6628"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45229"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY59"
FT                   /protein_id="ADC45229.1"
FT                   /translation="MSTQVETVFLPYGAAFNKTPSSNQDKSSWWGSYWAGGWDLYLDNA
FT                   RVVGEAFKPAQQDR"
FT   gene            complement(355193..355804)
FT                   /locus_tag="Rmet_3814"
FT   CDS_pept        complement(355193..355804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3814"
FT                   /product="twin-arginine translocation (TAT) pathway signal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10684"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP2"
FT                   /protein_id="ABF10684.1"
FT                   /translation="MTQSKTPPRRRFLHRASGLILGTGIAALSTGVARANTPDNTPENT
FT                   PDSGPGNPPNARSLSFHHTHTGENISLVYAMGSEVLPQAQLALNRFLRDHYSGSVGAID
FT                   PQLFGLLFSLRRELETDTPFQVISGYRSPATNTRLRNTRGGGVAKHSLHMDGMAIDIRL
FT                   PGVSLADLRDAATSLKIGGVGFYQQEDFVHVDTGRVRHWG"
FT   gene            complement(355801..357423)
FT                   /locus_tag="Rmet_3815"
FT   CDS_pept        complement(355801..357423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3815"
FT                   /product="conserved hypothetical protein
FT                   (peptidoglycan-binding domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3815"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10685"
FT                   /db_xref="GOA:Q1LGP1"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP1"
FT                   /protein_id="ABF10685.1"
FT                   /translation="MPMTATAVISTRPSTPHPRRKRTWMRAALCAWFIGAATSAWAQPL
FT                   WFANGRPTQAAQQAVAALADAGADGLEPRDYDADGLKRAIAQADSGTALAPESLDRVDN
FT                   ALTVAMRQYLSDLHKGRIDPRQIHVNFSVADETPFDPDSYLHAAVAANRLPAAIHEAAP
FT                   SFPLYPTLRDALSRYRALATQPLWNTPLPTPPGNKLAIGQPYDGLAQMAQRLEALGDLP
FT                   QGTPVPKKYEGALVTAVESFQKRHGLDADGVIGQGTLAQLNTTPSERVKQIALTMERLR
FT                   WTPLTAGPRVIVVNIPEFMLRAYDYVDGKLDIKLEMKVIVGKALNTRTPMFREDMRYIE
FT                   FSPYWNVPPSIARSEVVPKSRRDPGYFTRQGFEFVSGGQAITTLSSANLDAVLNGQMRI
FT                   RQRPGPLNALGDIKFVFPNNQNIYLHHTPTPQLFQRGRRDFSHGCIRVEEPVQLAKFVL
FT                   QDMPEWTEERIRQAMSKGKSNTIALKQPLPVVLAYGTAIARADGRVYFLPDIYGQDKLL
FT                   EQALRQRNPPATARAGKLAQTTP"
FT   gene            complement(357538..358233)
FT                   /locus_tag="Rmet_3816"
FT   CDS_pept        complement(357538..358233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3816"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3816"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10686"
FT                   /db_xref="GOA:Q1LGP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGP0"
FT                   /protein_id="ABF10686.1"
FT                   /translation="MKAARPKAPTAPNPPSPSGARRRKPAQSRARATADAIRDAFFQLL
FT                   AEKPYDRISIRQVIGLAGVGIGSFYEYFSCKDALAAVCIHLRVKAIAATMRASIDAHRT
FT                   EPLPARVDALIDAQSAAPLAEPEHWAALFVVERKVSGIEAFRNMYAEFVQLWMETLSGG
FT                   PEWPTDAPLGPTAFAVHAMTYSLVSQTLMTATRPVDAVALRRAVGNAVHGYLSIQAPLA
FT                   YRMHRFEPG"
FT   gene            358331..359977
FT                   /gene="acd"
FT                   /locus_tag="Rmet_3817"
FT   CDS_pept        358331..359977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="Rmet_3817"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3817"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10687"
FT                   /db_xref="GOA:Q1LGN9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN9"
FT                   /protein_id="ABF10687.1"
FT                   /translation="MEWSTHEVTNVVTELQDYNVYTTDLPLQEAVRRAGAGAHEAELTA
FT                   YGARLGSAETIRMAEEANHFKPELHTFDRQGRRIDRVEFHPSWHGVMRMAREQNLVAQP
FT                   FADPRPGAWAAYAAGFSMHGQIEAGSQCPNSMTFACIPVLQREPELFAALAPKLYSRTY
FT                   DARDIPLEQKDSILVGMGMTEKQGGSDVRANTTRAEPLRGEGRGGEYLITGHKWFFSAP
FT                   MCDAHLVVARTESGPACFYVPRYRPDGTKNAVQIQRLKDKVGNRSNSSSEVEFRGAWGR
FT                   MIGEEGRGIPTIIEMATFTRLNCVMGSTGLIRQCLVQALHHTRHRSAFGKTLIDQPLMR
FT                   NVLADMALESEAATLMMMRLTEAFALADEDPLQRAYKRIVTPAAKFWLAKRSVELSGEA
FT                   MEVFGGNGYMDEGPMGRLYRETPVISIWEGSGNVMALDMIRAISREPQAMQALLEDLTP
FT                   FCRQDARLSDAATMLVAGLRTQGEATEWLARRHAQLLVLLVQARLLGEHAPAAVTDAFI
FT                   ASRFDAQWGRVFGMLPDGVAHAAILDRAWTQ"
FT   gene            360116..361621
FT                   /locus_tag="Rmet_3818"
FT   CDS_pept        360116..361621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3818"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10688"
FT                   /db_xref="GOA:Q1LGN8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN8"
FT                   /protein_id="ABF10688.1"
FT                   /translation="MNIVALLDSNVRKYPDKPFLRYAGQSITYAEFDALSRGAAIVLAD
FT                   HGVGAGDRVAVLCFNTPGMVAAMFGAWRLGAVAVPVNHKLQTPEVDYILEHAGVKVCVF
FT                   DGSLASVVSRLQTPVKLLATSTDAAGFDSFDAQLPAAGTYNALPPADDAIAQILYTSGT
FT                   TGRPKGCVLTHRAVCMAGMTAALALSMQRDERTLMAMPLWHSSPLNNWMLGTLYVGGTV
FT                   ILLREYHPLHFLQTAQDERATLYFGAPVSYLLPLQMKIDVTAFDLGSVRAWIYGGGPIG
FT                   ADTARQLAQLYRSDRFYQVFGMTETGPSGTVLYPEEQVAKAGSIGRVATPGLDMRVVRT
FT                   GGADAGPGEIGEIWIKADSNMLGYLDNEAATREVMRDGWYRSGDLARLDADGFLFVVDR
FT                   TKDMIITGGENVYSKEVEDVLGAHPDVQDVAVIGRPHDQWGETVVAVLVPRPGTQPDPE
FT                   GIKAFAAERLARYKVPREFLIRDTLPRTPTGKLMKHVLRADFT"
FT   gene            361745..362719
FT                   /gene="cysK"
FT                   /locus_tag="Rmet_3819"
FT   CDS_pept        361745..362719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="Rmet_3819"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3819"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10689"
FT                   /db_xref="GOA:Q1LGN7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN7"
FT                   /protein_id="ABF10689.1"
FT                   /translation="MATRNGFIGAVGNTPLIRLGKLSAETGCEILGKAEFLNPGGSVKD
FT                   RAALYIIADAERRGTLKPGGTVVEGTAGNTGIGLAHICAARGYRCVIVIPETQSKEKMD
FT                   LLRVLGAEVRTVPAVPYADPNNYQKVAGRLAQELDNAIWANQFDNTVNRQAHYETTGPE
FT                   IWRDTDGKIDAFVCATGTGGTLAGVARFLKAQNPAVRTVLADPHGSGLYSFVKTGQIRA
FT                   EGNSITEGIGSSRITANLADTPIDDAVRIDDQRCVTMVYRLLREEGLYVGGSTGINVAA
FT                   AVQIAQDLGPGHTIVTLLCDRGSLYSARLFNAEWLAQKGLVAG"
FT   gene            362839..363990
FT                   /locus_tag="Rmet_3820"
FT   CDS_pept        362839..363990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3820"
FT                   /product="putative cytochrome p450 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3820"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10690"
FT                   /db_xref="GOA:Q1LGN6"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN6"
FT                   /protein_id="ABF10690.1"
FT                   /translation="MPPNASLAPADPIAAVTHADPYPYYRDLASTRPFYFDPALKLWVA
FT                   ASAAAVAEVLDHADGRVRPAAQPVPPSLAGSAAGDLFGRLIRMNDGVAHAPLKAIVARQ
FT                   MAALDLSDARSRARALAAALPRVDHDDAHEANRWMFTLPVLAIADLLGLPLERDTDGHV
FT                   STRVAGFVATFAAAMSPLASPADVEAGVAAAQWLTRLAQTAEDRETADIGVLAALAQAG
FT                   GDSKMDPATLTANAIGLMIQSCEATAGLIGNTLVYLGRSDWQGADIGASVDRVARIDPP
FT                   VQNTRRFMAADAMLCGQQVKEGDAVLVLLAAAAHDPSSAAEERAWTFGAGRHGCPGDAL
FT                   ARVLATCTVDALLARDVHPDRLAAGVRYRPSVNARIPSFSSNN"
FT   gene            364006..364362
FT                   /locus_tag="Rmet_3821"
FT   CDS_pept        364006..364362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3821"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10691"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN5"
FT                   /protein_id="ABF10691.1"
FT                   /translation="MIAIIFEVEPAPGRQDAYLDIAAHLKSTLETIDGFISVERFQSLT
FT                   TPGKLLSLSFFRDEAAVIAWRNTLDHRKAQAAGRGGVFANYRLRVAQVVRDYGMNERDE
FT                   APADSRAVHDAAQP"
FT   gene            364381..365136
FT                   /locus_tag="Rmet_3822"
FT   CDS_pept        364381..365136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3822"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3822"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10692"
FT                   /db_xref="GOA:Q1LGN4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN4"
FT                   /protein_id="ABF10692.1"
FT                   /translation="MTLFDIGQEIAFIGLTFLLAGFVKGVVGLGLPTVAVGLLGLVMPP
FT                   AQAAALLVAPSMVTNVVQLFSGPRFGLLLQRLWPMLVAICAGTWICAALVPARVLGHAT
FT                   NALGVALVLYAIVGLAAVRLHVPPRAEGWLAPLIGLVTGAITAVTGVFVIPAVPYLQGL
FT                   GLDKESMVQALGLSFTVSTIALAVSLALDGALLHTPVLGASALALVPALGGMFFGQWLR
FT                   HRISAERFRRLFFCGLLLLGVDLALRGAF"
FT   gene            365240..366364
FT                   /gene="phaZ"
FT                   /locus_tag="Rmet_3823"
FT   CDS_pept        365240..366364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaZ"
FT                   /locus_tag="Rmet_3823"
FT                   /product="poly(3-hydroxybutyrate) (PHB) depolymerase"
FT                   /EC_number="3.1.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10693"
FT                   /db_xref="GOA:Q1LGN3"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN3"
FT                   /protein_id="ABF10693.1"
FT                   /translation="MKRRTGGTRLLATLGKQAARSARRLQRTVAQTVTDPVLRVARQQG
FT                   QAVSKAMGRAVGKAARQAFTGVVTPAPTPVSKGGGIWEEGLWGFSLGIGSMAQRRYRVF
FT                   VPPGVSAARPAPLLVLLHGCGQDAASFAACARVATVARDARWVVLMPEQSLQGNAQRCW
FT                   NWFRPAERGASEAALLMSMVDHACRRYAVLADRVCAFGLSAGGAMALMLGLRYPDRFAA
FT                   VGSHSGAAPLSASNASQASRAMRGERAPDIDAARLLLAGRRPPPLLLVHGDEDAMVSYD
FT                   NATATAAMWLDLVPHGVHAPAPLPPKHVRRGTRREMDVLDWQSGARPYLRLVKVEGLRH
FT                   AWSGGAPGQAFADPAGPDALKIALRFFSVNGRHD"
FT   gene            complement(366434..366742)
FT                   /locus_tag="Rmet_3824"
FT   CDS_pept        complement(366434..366742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3824"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3824"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10694"
FT                   /db_xref="GOA:Q1LGN2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN2"
FT                   /protein_id="ABF10694.1"
FT                   /translation="MTGDGNTFDDTEYTACVLPANTRFAAPASLSLLEAALLEGVSLPS
FT                   SCRNGTCRACISKLHAGSVRYRVEWPGLSLDEKEDGYILPCVACPTSDVVFEPVGAA"
FT   gene            complement(366739..367476)
FT                   /locus_tag="Rmet_3825"
FT   CDS_pept        complement(366739..367476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3825"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3825"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10695"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN1"
FT                   /protein_id="ABF10695.1"
FT                   /translation="MISTQHDSFLTVSKLSRDPVSVAAGRPALHSPPAQRPLHFPVLPT
FT                   YTLAAPVHADIEIRKSRFIALAVPVADRDAAMAVIQDLRAQHPTATHVCWALLAGGQSG
FT                   MSDDGEPSGTAGRPILEVLRHHDLDGVLAAVVRYYGGVKLGAGGLVRAYTDAIAGALKD
FT                   AERIERIAYTTFAIEVDYADESRVRRWLELSAAEGCTLVDTRYDALATLLIRLPATLRD
FT                   GAIATLRDATHGRARFPDTEEQA"
FT   gene            367549..369537
FT                   /locus_tag="Rmet_3826"
FT   CDS_pept        367549..369537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3826"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3826"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10696"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGN0"
FT                   /protein_id="ABF10696.1"
FT                   /translation="MSDQPLVARRRALKILGGAPMLPIGAAAASLAGGMTAMEAAFAAA
FT                   PRRKAGAAFTSATFTGMAAPSLDNPATMATTTVGSSIKVSYSDDSAQEYALAYQPFFVT
FT                   GDMLPDGKGGKVLAGGYYDIHNRAIMDTSVPGKTRQFFSDCPDGSSLLTVRGARVPGVK
FT                   GNTVFAVVQFEYTTRDQANGDMYGMLPSPIAVITLDQDPKTGKLTPVRYHNVDTSSVNG
FT                   LWITCGASLSPWNTHLSSEEYEPDAVKAATDKRLRGFSQNLYGDADRANPYHYGHLPEV
FT                   TVHADGTGSIRKHYCLGRISHELVQVMPDERTVLMGDDATNGGLFMFIADRPRDLSSGK
FT                   LYVAKWHQTSGTGPGAATLSWIALGSATSDEIRKLVDSGIKVSDIMDVKTKDPADSAYT
FT                   RILIDGKPNWVKVAPGQEKAAAFLETHRYAALVGGSLGFTKMEGTTVNIADRKAYSAIS
FT                   RIESSMLAGNAANAGDIRVEGPYSGAVYELNLRGAQTDHAGARIDSEWVPVDMAPVPAL
FT                   VSEDLGGGPRKAQDALGNFANPDKVATPDNLKFSESLRTLFVGEDSNTHVNNFLWAYNV
FT                   DTKQLSRVLSCPAGAESTGLHAVDEINGWTYIMSNFQHPGDWEAGLHDKVKAQLDPLVR
FT                   ANYKDRFGAAVGYLTATPAAIRLGKRA"
FT   gene            369618..370232
FT                   /locus_tag="Rmet_3827"
FT   CDS_pept        369618..370232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3827"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10697"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM9"
FT                   /protein_id="ABF10697.1"
FT                   /translation="MTADPTARRMAPATDRNREPILAVLRNVLPRSGTVLEIASGTGQH
FT                   AVHFAAALPGLTWQPSDLDATHRESIAAWTEHTQVQNVLPPLAIDVRQEPWGIDAVDAI
FT                   VCINMIHIAPWAAAEALFEGAGRRLAPGGVLYLYGPYRREGAHTAPSNEAFDRQLHSAD
FT                   SDWGVRDMEAVIALGTTHGLTCDAPIQMPANNFSLVFRKQA"
FT   gene            370229..370903
FT                   /locus_tag="Rmet_3828"
FT   CDS_pept        370229..370903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3828"
FT                   /product="metal-dependent phosphohydrolase, HD subdomain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10698"
FT                   /db_xref="GOA:Q1LGM8"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM8"
FT                   /protein_id="ABF10698.1"
FT                   /translation="MSDGRRTAPRGRGGLLNFTAKHCPSAFNVNLSNLERQLSFLREID
FT                   LLKSVVRMTPLINQSRRENSAEHSWHLAMYALVLSEHAAAPVDALRVVKMLLIHDIVEI
FT                   DAGDVPFHDPAARAGQAALEEQAAERIFSLLPAAQAAEFRSLWSEFEAGESDDARFAKS
FT                   LDRLQPLLHNAATGGGSWVECDVTEEQAMARYGPPIERGSPALWEEASRLVREHFQKPR
FT                   EG"
FT   gene            371075..371632
FT                   /locus_tag="Rmet_3829"
FT   CDS_pept        371075..371632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3829"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM7"
FT                   /protein_id="ABF10699.1"
FT                   /translation="MYLDPMAGLQPLPTAYTPSGLRQGSRPGHLPFSDSPCAVLGSSRL
FT                   PIGHLTVAEVSAQGLVNLTPCELHRAIEAGHFYAEGYDPAGMPTILPAWQFVPPAPSLI
FT                   MPIIMALRNEPSGEDPFFWMIAYEELNDLTPAEVLCGRLLCTQGSVSIGQVHHLRRSDA
FT                   ERQATVTAALELLPSRLLRAGP"
FT   gene            371629..372339
FT                   /locus_tag="Rmet_3830"
FT   CDS_pept        371629..372339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3830"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10700"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM6"
FT                   /protein_id="ABF10700.1"
FT                   /translation="MRCDPELSLGATDMPADVAAQMPPRGLVIDAMASSVCTLSRGTLL
FT                   TRAAWNAATALPDFVTHTHRWGPPVSCRQAAGRFPFHWLYVAEDTYTAIWEGRFCEKVE
FT                   RYPGAFRLNEAASDGLLVTMRLKSDLNFLEIGGTTAARLGIYDRLSDPDYQWCRHFGLE
FT                   MHHVLEALFNRTGAIGIRYPSRRLRNHAALAVHSRHLGRWRESVTIDAARFGDLPIYGE
FT                   LLDDPCRLTEALSK"
FT   gene            complement(372463..373296)
FT                   /locus_tag="Rmet_3831"
FT   CDS_pept        complement(372463..373296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3831"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10701"
FT                   /db_xref="GOA:Q1LGM5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM5"
FT                   /protein_id="ABF10701.1"
FT                   /translation="MSAYDRGLAFSEGRFSQPRPRFTMPDHSLLSALLIFGLGGLLGGV
FT                   GGLFGIGGGLIAIPALGLLYGMDQQLAQGTSLVMIAPNVLIGFWQYRKRADIELKTAIV
FT                   LGLSAVLATYASAKFATSIDAALLRRIFAVFMIGLALYFLWRLLPGRATTQPQARLSPS
FT                   WIPAVGVVGGAFSGFFSVGGGVVAAPALVGLFGMRQAAAQGLALALVTPGAVVALFTYA
FT                   NAGHVDWYSGIPLSLGGMLTISWGVALAHRMPERKLRAAFALCLIATAVVMLVRG"
FT   gene            complement(373377..374345)
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3832"
FT   CDS_pept        complement(373377..374345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_3832"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10702"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM4"
FT                   /protein_id="ABF10702.1"
FT                   /translation="MLRTIRAIAGIAMALSVVGHAQADTYPSKPIQMIVPQAPGGTNDI
FT                   VARLVAADLSQRLGQQVVVENRPGAGGNIGTQTAARSAPDGYTLLMTISSTQAINPSLY
FT                   RSIPFDPIKDFEPIAPVATVPNVLVVNPAFPAKSMSELIAMAKAKPDYYRFASAGNGTL
FT                   NHLLGEMLNSMAAIKLEHVPYKGVAPALNDVLGNQVPMAFASLPSVLAHIKAGKVRALG
FT                   VSSAKRSPFAPDIPAISETVPGYSGDLWVGLFAVRGTPKDVTQKLAATMQTALGDKTLR
FT                   DKLAAQGAEVLTGTPQQFSTMLRGDIDKWAKIVKQSGAQVD"
FT   gene            complement(374530..375468)
FT                   /locus_tag="Rmet_3833"
FT   CDS_pept        complement(374530..375468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3833"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3833"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10703"
FT                   /db_xref="GOA:Q1LGM3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM3"
FT                   /protein_id="ABF10703.1"
FT                   /translation="MDIRAMRYFVAIVDQGSLTRAAEVVCVAQPALSQQLATLEDEFGV
FT                   PLVHRSAKGVRPTEAGKTLYRHVRNILRQVEIAGADVRVAGAEVSGTVAIGLPTTAAAA
FT                   FGMALIRTVRQRYPQVRLQLFESMSGYISELLNQNRLDFAILFRDTPSRAVEPEPLASE
FT                   PLYLIGTPPVTAPRPGKRGSATADTVPLKALDGIPLVLPSGSQGLREVVERTFAKAGMN
FT                   LNVVADLDSLPFLLASAREGLACTILPASSLGDGDATVPRRLIVPELRRTLSLCWPRAL
FT                   PRSNAAEAVADVLREIVGERIALGGSLAPAG"
FT   gene            375611..376783
FT                   /locus_tag="Rmet_3834"
FT   CDS_pept        375611..376783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3834"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F (CoA-transferase family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3834"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10704"
FT                   /db_xref="GOA:Q1LGM2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM2"
FT                   /protein_id="ABF10704.1"
FT                   /translation="MSRPLEGITVVSLEQAIAAPFCTRQLADLGARVIKIERPGPGDFA
FT                   RAYDGRVRGLSSHFVWTNRSKESLTLDVKAPAAAPVLDSLLAKTDVLIQNLAPGASTRL
FT                   GLDYETLSKRFPRLIVCDISGYGGDGPYRDKKAYDLLVQSESGFVSVTGTPEEGVKAGA
FT                   SVADIAAGMYAYSNVLAALIERGQTGRGKHIDVSMLESMVEWMNFPMYYAFDGAEPPPR
FT                   AGASHATIYPYGPFPTGDGKTVMLGLQNEREWAAFCKVVLHEPDLATHAAFATNSLRSA
FT                   NRAQLRARIVEAFGRLTAAQVVERLEEAKIANANVNTMADVWAHPQLAARKRWRTVDTP
FT                   AGQIPALLPPGMTDARMDPVPAVGEHTDAILAEAGCTAEQIARLHADGVV"
FT   gene            376796..377626
FT                   /locus_tag="Rmet_3835"
FT   CDS_pept        376796..377626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3835"
FT                   /product="putative aldolase/citrate lyase (HpcH/HpaI
FT                   family)"
FT                   /EC_number="4.1.3.6"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3835"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10705"
FT                   /db_xref="GOA:Q1LGM1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM1"
FT                   /protein_id="ABF10705.1"
FT                   /translation="MTTTRVPRSYLFVPASRPERIGKAIAAGADAVIVDLEDAVAPDAK
FT                   AAARAGLAEPWRDLQAQADAAGLALLLRINGADTSYFAEDVGFCRTSGVREIVLPKADK
FT                   AALAALRAELPETPCGALLESAAGFADLAHVARAPGVSRLLFGSIDLMFDLDVGDDDAP
FT                   LHHFRSELVMHSRAAGLPAPVDGVCTAIGDADALAADTARARRFGFGAKLLIHPNQVGG
FT                   VHAALAPSADELAWARRVVEQAAAAQGAAIAVDGKMVDRPVLERAQRIVAAGAA"
FT   gene            377957..379294
FT                   /gene="hmvC"
FT                   /locus_tag="Rmet_3836"
FT   CDS_pept        377957..379294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmvC"
FT                   /locus_tag="Rmet_3836"
FT                   /product="heavy metal cation tricomponent efflux outer
FT                   membrane porin HmvC (CzcC-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3836"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10706"
FT                   /db_xref="GOA:Q1LGM0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGM0"
FT                   /protein_id="ABF10706.1"
FT                   /translation="MASVGSIAASAGQAASGPMPPDGPCMPPPAKAALTLAQARLDALR
FT                   CNRDIISARRGEEASQADIQIASQRPNPVLSLGVANINPHLGVGAGNWRSKTVDSTVRV
FT                   DQVIETANKGNLRTDAARKASAAAGEQTQAVVAQQVGAVEQAWYDAVASQSRVEVLTET
FT                   VGLYGKTQQANEARLKAGDVARADVTKLQLETLRAQSDLRSAQSDYATSKAALAATIGL
FT                   PGTLLDNRLVPDWPALDAPVPSVDPEVLQRRPDVTAAEARLAAAASARDLARAGRVPDV
FT                   TVGAQYEHYPVSEANTTGSGNSYGVFISIPLFVRHSFGGEARRAEVDYYAALDDRNRIL
FT                   LAAQNDIERLRSQLESARASLQQMQTAVLPAAETVAQSAEFAYTKGATGVLDLLDARRA
FT                   LRQTRLDAVDVQGNFAKAMAAYRAALQATTSDINKLPQVRTDASHP"
FT   gene            379278..380495
FT                   /gene="hmvB"
FT                   /locus_tag="Rmet_3837"
FT   CDS_pept        379278..380495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmvB"
FT                   /locus_tag="Rmet_3837"
FT                   /product="heavy metal cation tricomponent efflux, membrane
FT                   fusion protein HmvB (CzcB-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3837"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10707"
FT                   /db_xref="GOA:Q1LGL9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL9"
FT                   /protein_id="ABF10707.1"
FT                   /translation="MHRIPDMPLISRDSRFTRAGAARLAAVLSLCVLTLGACGKKEAPE
FT                   NDDEPKVAGQVIEYPASVRSLPGVVGQPVKSGGDRMLSMPGRLVWNEDKTVRVASPFAG
FT                   RVMEILVQPGATVKAGQPLAMLTSPDFGSAQADARKASADSAVASKALARQRELYEAGV
FT                   IAQKDLEQAQADNARAAADQQRTQAALRMYGASGSDGVNQRFALRSPIDGLVVERNINP
FT                   GMELRPDQPPTAPLYLITDPTTLWAQLDAAEADLGHFRPGVTVQLASAAYPGETFTGTV
FT                   VKIADYVDPSSRSVKVRLSVPNADRRLKAEMFVTAKMQAASFQGISVPSKAVFLADNKN
FT                   YVFVRTTPNRFERREVKLGVTIPGTTEVVEGLKEGDVVITDGNLYLQDILRDATAVNAA
FT                   RATAKH"
FT   gene            380509..383031
FT                   /pseudo
FT                   /gene="hmvA"
FT                   /locus_tag="Rmet_3838"
FT   CDS_pept        380509..383031
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmvA"
FT                   /locus_tag="Rmet_3838"
FT                   /note="heavy metal cation tricomponent efflux pump HmvA
FT                   (CzcA-like)"
FT   gene            383080..383634
FT                   /pseudo
FT                   /gene="hmvA"
FT                   /locus_tag="Rmet_6629"
FT   CDS_pept        383080..383634
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmvA"
FT                   /locus_tag="Rmet_6629"
FT                   /note="heavy metal cation tricomponent efflux pump HmvA
FT                   (CzcA-like)"
FT   gene            383852..384868
FT                   /locus_tag="Rmet_3840"
FT   CDS_pept        383852..384868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3840"
FT                   /product="putative diguanylate cyclase (GGDEF domain) with
FT                   GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3840"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10708"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL8"
FT                   /protein_id="ABF10708.1"
FT                   /translation="MELILERLSESVATAENLEQLTRPLLEMLELITGLESLYLTSIDE
FT                   EAGLQSVDFVRNAGELVIPEGLSVPWSDTLCKRCLEEGRRYTSNASEIWGDSQAARALG
FT                   IETYASAPIRASDGEIIGTLCGASKRSQPLGPQAFSALNIFSKLIGHHIERERLLEELR
FT                   RSNEYLANFALTDALTGLPNRRALHGELGRLLARATRDESHVVVGIIDLDDFKRINDSY
FT                   GHVVGDQFLSECSKRLSGIVRDTDMLARVGGDEFALVAPCPASATQAHSLADQLQKRAL
FT                   AATRGVYTLADVTIDYAGVSAGVVAVRPVSVEQALELADAAMYREKRQRKQSGPNGG"
FT   gene            385165..386979
FT                   /gene="tanA"
FT                   /locus_tag="Rmet_3841"
FT   CDS_pept        385165..386979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tanA"
FT                   /locus_tag="Rmet_3841"
FT                   /product="tannase and feruloyl esterase (alpha/beta
FT                   hydrolase family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3841"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10709"
FT                   /db_xref="GOA:Q1LGL7"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL7"
FT                   /protein_id="ABF10709.1"
FT                   /translation="MSSRHRSGLFAHAYSGAISFLTSFTIGVAAVSLAGCGGDGSSSAT
FT                   TGTSSGSTSTSTGSTTTATTLQVVAPVIDCSQLASVDITDIGGAGSKIASATITTTTIN
FT                   GATVQLCTVKGTLAPSNTFAVALPVSTWTQRFAELGCGGLCGNVSDPTKQSSFSFSYNC
FT                   PLVQQGGFVTAATDMGHTGSDATWSSDTQKQADFAYRGQHITTLAAKKLIKSYYGQAQK
FT                   YSYFVGCSDGGREALMAAQRYPNDYNGIVAGAPAAHFQTQNSLYHGWSVVSNSTTGDNT
FT                   GNVVLYADKAKVLHKAVVAACGGTSGAPDGLLADPRACNFNPVSIQCAAGATDTSNCLT
FT                   AAEVTTASRIYSGPTDTTTGKRMLAGSPQLGSEANWIGVEVPNSNSTDAPAPVTSLFSN
FT                   MIVTGAYNLIFTGSPTMPNINTFGYHDGNFYTDYLAANHPLNDATNPDLSAFQNAGGKL
FT                   ILWHGWADQHISPLFTIAYYEAMQNTMGTSAVDAFARLYLVPGVGHCGGGEGNPNIDLV
FT                   SRITAWVEQGTGPSSVMTYQTDTSSNVTASRPVYPYPAVAMYKGSGDWHDGANYVSGGP
FT                   LYNVATAAWAGSSFYTPYTAKVQGVAAP"
FT   gene            complement(385203..385382)
FT                   /locus_tag="Rmet_6630"
FT   CDS_pept        complement(385203..385382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6630"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45230"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY60"
FT                   /protein_id="ADC45230.1"
FT                   /translation="MTGATTCNVVAVVVEPVLVEVDPDDVPVVALELPSPPQPARLTAA
FT                   TPMVNDVRNEIAPE"
FT   gene            complement(387000..387530)
FT                   /locus_tag="Rmet_3842"
FT   CDS_pept        complement(387000..387530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3842"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10710"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL6"
FT                   /protein_id="ABF10710.1"
FT                   /translation="MKILITGAAGSGTSTLANAIAEATQTHALETDDYFWRPTNPPYQV
FT                   KFEPEERCARLLKDLRARPETVVAGAVMEWGEALEHAFDLVVFLYVPTPIRLARLKLRE
FT                   EHRFGKADTEFLEWAAQYDAGTAEGRSLEKHRQWLQNLRCPVLYLEGDGTVEARLQSVL
FT                   AARNAIIEGAGPK"
FT   gene            387646..388149
FT                   /locus_tag="Rmet_3843"
FT   CDS_pept        387646..388149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3843"
FT                   /product="putative peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3843"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10711"
FT                   /db_xref="GOA:Q1LGL5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL5"
FT                   /protein_id="ABF10711.1"
FT                   /translation="MSSSPTQGDETMTARLDPFAAAPVQMKSWMGTSIAIAGSLEPSLV
FT                   SLVEVRASQINGCANCINMHTTQARERGETEQRLYLLSAWREAPCYTDRERAALGWTEA
FT                   MTRLSEGHALDRASATLREHFTEEEQVKLTLMINVINGWNRLAVGFGLWVDPAAAKAAA
FT                   KAAA"
FT   gene            388149..389009
FT                   /gene="rpoT"
FT                   /locus_tag="Rmet_3844"
FT   CDS_pept        388149..389009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoT"
FT                   /locus_tag="Rmet_3844"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10712"
FT                   /db_xref="GOA:Q1LGL4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL4"
FT                   /protein_id="ABF10712.1"
FT                   /translation="MVADAGLSEAAASFEPLRPKLIRVAYRMLGSVADAEDVVQEAFIR
FT                   WMNAERAEVRVPEAFLRRMVMRMCLDELKSARHQRETYIGPWLPDPVIEEEEQDDVTLP
FT                   LMLALERLSPLERAAFLLHDVFGLAFDEVAATIQREPAACRQLAARARANVRESRPRFQ
FT                   VEKERGLALAKAFFDASRSGDMGTLSTMLAADVSLHADGGGQRPAIGHPVFGFDEVMRV
FT                   HEQLSKYFQKNGSTFVRAAFINGLPGIVTRESDGELQTTALEIEGGKIAAIYVVRNPDK
FT                   LRHLH"
FT   gene            complement(389042..389272)
FT                   /locus_tag="Rmet_6631"
FT   CDS_pept        complement(389042..389272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6631"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45231"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY61"
FT                   /protein_id="ADC45231.1"
FT                   /translation="MTVVARIVISGPLNGGWFVTPLHHDGTAGETRRFAAPEEARAFAA
FT                   ATYPGKPIRQANLHPPPMPKGSRVRFPVFPK"
FT   gene            389096..389434
FT                   /locus_tag="Rmet_3845"
FT   CDS_pept        389096..389434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10713"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL3"
FT                   /protein_id="ABF10713.1"
FT                   /translation="MQVRLPDGFAGVRRGSERACFLRRGEPPRFAGRPVVVQGRDEPAA
FT                   IERTTDDDASDHGHVPEMLNVRVSISSAVRRIERVAGWVDGWGQWVGRRGRGAELRADQ
FT                   ALALNTCA"
FT   gene            complement(389404..390222)
FT                   /locus_tag="Rmet_3846"
FT   CDS_pept        complement(389404..390222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3846"
FT                   /product="putative methyltransferase, ubiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3846"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10714"
FT                   /db_xref="GOA:Q1LGL2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL2"
FT                   /protein_id="ABF10714.1"
FT                   /translation="MTSHGTDTVFAGSVPELYDTLMVPLIFEPYAADLAARAAALAPTH
FT                   VLEVAAGTGALTRRLASDLPDGTSIVATDLNRPMLDRAAAIGTSRPLTWRQADAMQLPF
FT                   PDASFDLVICQFGAMFFPEKHKAFAEARRVLKPGGVLLFNVWDRIEENAFAHTVTQTLT
FT                   GMFPHKPPVFLARTPHGYHDPAVVAADLRLGGFSEASTCATVAAESRAVDANTPAIAFC
FT                   QGTPLRGELEAFGPDALVNATLACAKALTREFGPGPVSGKIQAHVFSARA"
FT   gene            complement(390292..390531)
FT                   /locus_tag="Rmet_3847"
FT   CDS_pept        complement(390292..390531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3847"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10715"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL1"
FT                   /protein_id="ABF10715.1"
FT                   /translation="MDAPFHQFSELFAQLGLPSDESDIRAFIAKHSPLPQNVELWDAAF
FT                   WTPAQASLLRDEIAEDADWAEAVDQLNLALRAPA"
FT   gene            390737..391222
FT                   /locus_tag="Rmet_3848"
FT   CDS_pept        390737..391222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3848"
FT                   /product="putative 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3848"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10716"
FT                   /db_xref="GOA:Q1LGL0"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGL0"
FT                   /protein_id="ABF10716.1"
FT                   /translation="MASKNTICLWYDGDALDAATFYAKTFPDSAVGAVFRAPGDYPDGK
FT                   QGDVLTVEFTVAGIPCVGLNGGPHFKHSEAFSFQIATDDQAETDRLWNAIVSHGGQESA
FT                   CGWCKDRWGLCWQITPRALLAAITDPDRAAAKRAFDAMMTMGKIDIAAIEAARAGRS"
FT   gene            complement(391231..392700)
FT                   /locus_tag="Rmet_3849"
FT   CDS_pept        complement(391231..392700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3849"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10717"
FT                   /db_xref="GOA:Q1LGK9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK9"
FT                   /protein_id="ABF10717.1"
FT                   /translation="MNNTLPVLDWTINLLIVQALMGAFDTLYHHELTQGLSHSPRARRE
FT                   LSIHAIRAVLYGVLFASMANLKFFGIWTFAIAGLVVVEVWLTLWDFVVEDRSRKLPATE
FT                   RVLHTLLAINGGALFGLYAVQLVEWFQAPTGLAIASFGWRGWLLSLAAAGVTVSGIRDG
FT                   LAARRMSRRGAAVNPFAGQSHLSVLVTGGTGFIGEALVTQLLDAGHTVTLLARDPLRAA
FT                   YQFTGRARSVTSLDQLHAQERFDAVINLAGAPVLGPRWSQRRRAQLLASRVGVTQALTR
FT                   WASHATHKPAIWIQASAIGFYGARDGDQLLDEHSAPGGGFMSELCRRWEESAEPLRDYG
FT                   LRMVVLRLGVVFGPGGALPPMMLPHYFGLGGRLGNGRQVMSWIHREDLLRILARALSDP
FT                   GMSGVYNATAPGCLTQAEFARTVGKVLRRPVWFHLPAAPLRWAAGEMSELLLAGQRVIP
FT                   ARLQREGFAFRFPAAESALRDLTGDRASLRH"
FT   gene            complement(392697..393578)
FT                   /locus_tag="Rmet_3850"
FT   CDS_pept        complement(392697..393578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3850"
FT                   /product="putative thiol-disulphide oxidoreductase DCC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3850"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10718"
FT                   /db_xref="GOA:Q1LGK8"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK8"
FT                   /protein_id="ABF10718.1"
FT                   /translation="MNALVLYFDGKCPFCAAEMRRLSEWDTQHQLAFVDIAQEGFDCSS
FT                   LNVDLAALNRELHGRTSDGRLLVGIDCMIAAYTLAGHGWLVLPLRVPGLRRVLANLYRA
FT                   FAGNRYTLSRWLGYGTATACDGDSCGTGNPFLSGKELTDAAEDRPARRDSRQLAVRWMY
FT                   AAAIAHLLVGAAMPWAADATLFGTYHRIVEQSFWSGAAPAQARAQQVWWIALFGATLQC
FT                   SAIWMLALVHLGNRTRHRMAWGWLLVGLLVWAPQDLLISLQAHVWPHVLVDAVALLTMI
FT                   PPLLYLWRKDAA"
FT   gene            complement(393627..394070)
FT                   /locus_tag="Rmet_3851"
FT   CDS_pept        complement(393627..394070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3851"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10719"
FT                   /db_xref="GOA:Q1LGK7"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK7"
FT                   /protein_id="ABF10719.1"
FT                   /translation="MIHIISSVVLVGTGFGTAFYLFFANRSGSTEAIAVVSRLVVRADW
FT                   WFTTPAVIVQPLSGAYMLHLAGYPLNSPWIVASAALYLFAGACWLPVVWYQIRMSRTAM
FT                   AAHERGTPLPASYWRDARRWEYLGYPAFAAMVAVFALMVFKPM"
FT   gene            complement(394067..395359)
FT                   /locus_tag="Rmet_3852"
FT   CDS_pept        complement(394067..395359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3852"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10720"
FT                   /db_xref="GOA:Q1LGK6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK6"
FT                   /protein_id="ABF10720.1"
FT                   /translation="MADHRRLRVLVCGASGLIGAVLCKRLEAQGHEVIRGVRTPTSARD
FT                   VAMDFGTDTTIEQWLPRVQGMHVVINAVGIIVETGTNRFEAVHHLAPAALFRACAKAGV
FT                   GRVIQISALGADRGDTPYFRSKRGADDVLRALPVQWQVLYPSLVYAQDGDSAAMFRTLA
FT                   SLPVIPVPELGDARFQPVHIDDLVDTVVTVIVPAIPPGQCIEVVGASRMSYRAMLDTYR
FT                   QGMQLPAPMWATIPAPCMTVAAYVARCVPGSKLTPDTWRMLRRGCHGDAAPLTRLLGHR
FT                   PRAIGTFIAPGEADCLRHRAVGAWRMPMLRIVMALVWLATALVTLFAYPLADSLALLGA
FT                   VGLHGTPAIVTLYAAVFVDAAMAVGCLRYPSRRLWALQAALVAGYSLIIAVALPQFLWH
FT                   PFGPVLKNLPILAILFILYAEQESWNTSPSR"
FT   gene            complement(395463..396008)
FT                   /locus_tag="Rmet_3853"
FT   CDS_pept        complement(395463..396008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3853"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3853"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10721"
FT                   /db_xref="GOA:Q1LGK5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK5"
FT                   /protein_id="ABF10721.1"
FT                   /translation="MNRMQRMELKPIAERFVLHWGEMGSRWGVNRTVAQVHALLYLAAR
FT                   PMDAEEITDTLGVARSNVSNSLKELQSWHLVKVVHIKGERRDFFETSTDIWELFKLIVA
FT                   GRRQREIDPTAVALRECLDNPAIGEEDTGTRERIEETLKFIETMSTLADEMLRLKPETL
FT                   MKTLGLTAKISNAVRKRS"
FT   gene            396066..397544
FT                   /locus_tag="Rmet_3854"
FT   CDS_pept        396066..397544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3854"
FT                   /product="putative monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10722"
FT                   /db_xref="GOA:Q1LGK4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK4"
FT                   /protein_id="ABF10722.1"
FT                   /translation="MFRAGGITILAFVRSFLPHASLCCHAKVSTHRAGARRRNARQQTA
FT                   TMTTPEAPRQLHLNLNALHAGFVPSAWRLPESDPRAFVDVQHYIRLAQVAEAGKFDAIF
FT                   LADNASIADQINFRPITALEPTVLLACVAAATTHIGLVATASTSYNEPYNIARRFATLD
FT                   HVSGGRAGWNVVTTADAGSARNFGRAAPPDHAQRYGRADEFTNVVKALWDSWEDDAFVG
FT                   DRATGRFVDTDKLQPIAHHGQYFNVHGPLNLPRTPQGYPVLFQAGGSSDGRELAARHAE
FT                   AVFSASQSFEESLAYRRDINQRAEALGRGPGAVKILPGLTTIIGATEAQARRRRDDLID
FT                   LIPWDYSLNRLAGTLGIAVDRLSLNAPLPNDLQLPANGNHTFFRATLALAQREGLTVRA
FT                   LIRELAGGGGHRVIVGTPEQIADDIEHWFRHGAADGFNLMPDVLPGGVEDFVDGVVPIL
FT                   QRRGLFRTEYTGRTLRDHMGLARPAGRTREQAAA"
FT   gene            397664..398485
FT                   /gene="metQ"
FT                   /locus_tag="Rmet_3855"
FT   CDS_pept        397664..398485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="Rmet_3855"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10723"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK3"
FT                   /protein_id="ABF10723.1"
FT                   /translation="MKRRSALASLAALAIALPAFSIGTVHAQTTGKPLKVGVRGGVDEE
FT                   IWEVVTREAAKNGLKVEPVIITGTASPNEALNNGDLDANSFQHIPFLRDQIRQRGYKIV
FT                   NVGTTLISPIAFYSRKVKSLEALPNGARIGIPNDPSNQTRALVILRDHGLVKLKDGFDP
FT                   STGTASLADITANPRKLDLVESASVVLPRALPDLDAAAIINTFAYQAGLISSRDGIAVE
FT                   KRENNPYVNVIAVREKDRNAPWVATLVKSYQSDAVRKFILTKYQGSIIPAF"
FT   gene            398501..399325
FT                   /gene="metN"
FT                   /locus_tag="Rmet_3856"
FT   CDS_pept        398501..399325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="Rmet_3856"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10724"
FT                   /db_xref="GOA:Q1LGK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK2"
FT                   /protein_id="ABF10724.1"
FT                   /translation="MHTVSQLHARDSHIVFEQVGKTYPGAATPALTDVSFSIGRGERFG
FT                   IIGRSGAGKSTLLRTINMLERPDEGHVRVDGVDIGTLDEKGLVALRRRIGMIFQHFNLM
FT                   SAKTVFENVALPLRVAGVGRAETASRVNELLALVGLADKANAYPAMLSGGQKQRVGIAR
FT                   ALVHRPEILLCDEATSALDPETTEQILALLRDINRQFALTIVLITHDMAVIDEACDRVL
FT                   VLDHGHAMEHGPVWRVFSEPKADATIALLRPLRKRLQAQAHSPEIVDRVANG"
FT   gene            399309..399962
FT                   /gene="metI"
FT                   /locus_tag="Rmet_3857"
FT   CDS_pept        399309..399962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="Rmet_3857"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3857"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10725"
FT                   /db_xref="GOA:Q1LGK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK1"
FT                   /protein_id="ABF10725.1"
FT                   /translation="MLPMAEKYLKALGETLIMTTSACAVVFVTGLALALVLTITAPAGL
FT                   APRPRVHRTLSVLVNMFRSVPFIILLVAMLPVTRMIVGTTMGIWAAVVPLSAHLIPFFA
FT                   RVSQVALNETDSGLVEAARAMGCRRWHIVRHVLLPEALPALIGGATVTVIAMIGASAMA
FT                   GAVGAGGLGDLAIRYGYERYETAVMFNVIVILVALVTLVQFSGERLARQFDHRR"
FT   gene            complement(400022..401377)
FT                   /locus_tag="Rmet_3858"
FT   CDS_pept        complement(400022..401377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3858"
FT                   /product="putative Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10726"
FT                   /db_xref="GOA:Q1LGK0"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGK0"
FT                   /protein_id="ABF10726.1"
FT                   /translation="MRNSRLVTRAGLVTLNGPEQPSPIGAEARTVTTEAALQIVAPAGA
FT                   TKSNHPHPAPPGNALPPAADVAILRQRAQALLPRIAEGAAIRELQRDLPYAFAREVANA
FT                   GLLTFRIPKVYGGPGGTLRDAIRFVIELAAVDSNLAQALRPNFGLVEGLLAAHDNEADR
FT                   KRWFGRLLAGHIIGNGGVERGGKQGAIQATIVRHGDHYLVNGTKYYSTGGLYADWVSSI
FT                   ALDEAGKETHFTVPRERAGMELVDDFDTIGQRLTASGTTRFTNMRVETDEVRGSFLPRD
FT                   RRNPVSPVFQLFLAATEAGIARNALNDAVWFARNKARPIKHSSAERSVDDPYVQETIGQ
FT                   ISAEVFAAEAATLRAADTIDAAWADNLSNASLTQASIDVAQAQVFTVAAALKASELALD
FT                   VGGASSCDRQYNLDRHWRNARTVANHNPRQWKAAAVGAWLLKDEPPPTTGLF"
FT   gene            complement(401419..402480)
FT                   /locus_tag="Rmet_3859"
FT   CDS_pept        complement(401419..402480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3859"
FT                   /product="putative sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3859"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10727"
FT                   /db_xref="GOA:Q1LGJ9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ9"
FT                   /protein_id="ABF10727.1"
FT                   /translation="MKPVVRVEDRHAFDTIIDARSPAEFEIDHIPGAINCPVLDNEERR
FT                   IVGTLYKQVGAFEARRVGGAMVAANLARHLREQFADRPSGWRPLVYCWRGGLRSGSMTT
FT                   WMRMVGWDAQQLAGGYKAWRRHVIDVLDTQAARAPLVVICGATGSGKTRVLHALAAQGE
FT                   QVLDLEGLARHKGSLLGALPDVAQPSQTAFETALADVIERVDLARPLYVEGEGARIGKL
FT                   NLPVPLVAHMRESACVEIDASPETRLAFLLHDYAYLGDRPAWLADQLGRLKELHGKTII
FT                   AAWQEMATTGNLRQLFGELATEHYDPSYARSQRKHFHKWDARRVVHADSLSAQGIEALA
FT                   RSIVQTVAEQQPA"
FT   gene            complement(402477..403550)
FT                   /gene="selD"
FT                   /locus_tag="Rmet_3860"
FT   CDS_pept        complement(402477..403550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="Rmet_3860"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3860"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10728"
FT                   /db_xref="GOA:Q1LGJ8"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ8"
FT                   /protein_id="ABF10728.1"
FT                   /translation="MNTNTPQVEATPPLRLTSFSHGGGCGCKIAPGVLSQILRSSAALP
FT                   VPKELLVGIETSDDAAVYQLNETQALIATTDFFMPIVDDPFDFGRIAATNAISDIYAMG
FT                   GRPIMALALVAMPVNQLPLEVIGRVIEGGQSVCQAAGIPIAGGHTIDSVEPIYGLVVMG
FT                   LAHPKKIRRNRDARAGDVLVLGKPLGVGVMSAALKKEKLDDAGYARLIDTTTKLNTPGI
FT                   ALAELDDVHAITDVTGFGIAGHTLELARGAGLRAVLEWPRIPLLPNVMSLAEQGFITGA
FT                   SRRNWEGYGSEVELAAGLPELAQPLVTDPQTSGGLLISCAPDAVGKVLAVFREQGFTEA
FT                   TVVGRMEAGEPGLTVTP"
FT   gene            complement(403659..405323)
FT                   /locus_tag="Rmet_3861"
FT   CDS_pept        complement(403659..405323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3861"
FT                   /product="putative intramembrane serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3861"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10729"
FT                   /db_xref="GOA:Q1LGJ7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ7"
FT                   /protein_id="ABF10729.1"
FT                   /translation="MEQSQRWRQRATPARPIGAFYVRQFGAALFMRLILWAIFGGLAAL
FT                   LLVSMRGNAGSVLMSLVLLGILILFEWGWGRHAPLGKPLLTIDASGIGSTAFPRKRRHL
FT                   RWRDIAGAAIRDVRGAGETLVIETVETKPGGRRKARRAYQVRLAMLRKSDQQLVQALVA
FT                   HHMRVAGITPSADVVAERAFVAQMQALPRTWGLYSMIAVNVLIWLIMLSRGAALDGAAP
FT                   KMLIDWGGNLGALTQDGQWWRLLTATFLHGSLKHLAANMVVLYLLGTHVERFFGTRSFL
FT                   LIYVGAGLLGSALSLYFAAQASVSVGASGAVFGIGGALLVAALLHRRELPQSIRNRLVS
FT                   DAVIMIGYSLAQGFLSTRVDNAAHVGGLIGGALLALCLPVRLSPETYRKKLRRGTLMAT
FT                   VTAIVAVVGVAAFAPPAPLTLRAQLAGSRQFEVAADRFMTALRATQADIEAMKAGKMPE
FT                   REVDARTRTIHAPAFEQALSGLVRVTLPPGDSRAPLLQDMTLLADAMHEYLRMDSVWDA
FT                   SANRHVPADAARGDALNANIERLTQRINTRLAEKRKK"
FT   gene            complement(405507..406157)
FT                   /locus_tag="Rmet_3862"
FT   CDS_pept        complement(405507..406157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3862"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3862"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10730"
FT                   /db_xref="GOA:Q1LGJ6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ6"
FT                   /protein_id="ABF10730.1"
FT                   /translation="MITALPAPSPAFSVSLQGMALSFGLIVAIGAQNAFVLRQGLRREH
FT                   VGSVVLFCAVADALLITAGVMGMAQALGESPGLARALAAVGAIFLAIYGWRALRRARES
FT                   HQLSTRTSGEGLGRSAALAQAAAFTLLNPHVYLDTVLLVGSIGAQQPAALRGWFVAGAS
FT                   SASVLWFGLLGFGARWLAPWFARPKAWQALDALIGITMLALSLMLVWRVVGNF"
FT   gene            406232..407128
FT                   /locus_tag="Rmet_3863"
FT   CDS_pept        406232..407128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3863"
FT                   /product="putative chromosome initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3863"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10731"
FT                   /db_xref="GOA:Q1LGJ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ5"
FT                   /protein_id="ABF10731.1"
FT                   /translation="MLDYAALSALAAVIREGSFERAARALNVTPSAISQRIRLLEERVG
FT                   CALVVRAQPCRATETGRRLCQHVDRVRLLEQELQGALPALAPEGVTRVALPVAVNADSL
FT                   ATWAAPAIATFAAAHPVLMEVAVDDQDHTTEWLRSGAVLAAVTGTGRPAAGCNSRPLGA
FT                   MRYLAAASPAFMQRYFVDGVGAGTLAEAPSLVFNTKDELQVRWARRLCHRHVELPRHTL
FT                   PSSQAFVTAALAGMGWGLHPQALVAPYLANGTLVELVPGAPLDVPLHWQYARAASGLLD
FT                   GLSREVLAAARVALLAP"
FT   gene            complement(407282..407740)
FT                   /gene="chrF2"
FT                   /locus_tag="Rmet_3864"
FT   CDS_pept        complement(407282..407740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrF2"
FT                   /locus_tag="Rmet_3864"
FT                   /product="chromate resistance regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3864"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10732"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ4"
FT                   /protein_id="ABF10732.1"
FT                   /translation="MQWITREHPKIDRIACPWLIARFIDETPEFLYVPPDDVTRIANES
FT                   GAIPYDVPGVELTHVGERCSFDAFLDKYHLGGDAALQQLAGIVRGADTSRLDLTPQSSG
FT                   LYAISLGLSRMFNDDLEMLEHGMVMYDALYAWCGHCQTETHNWPPKMG"
FT   gene            complement(407754..408926)
FT                   /gene="chrA2"
FT                   /locus_tag="Rmet_3865"
FT   CDS_pept        complement(407754..408926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA2"
FT                   /locus_tag="Rmet_3865"
FT                   /product="Chromate transporter (CHR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3865"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10733"
FT                   /db_xref="GOA:Q1LGJ3"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ3"
FT                   /protein_id="ABF10733.1"
FT                   /translation="MNAPHDRPAYTLRQLVMYFVRLGALGFGGPVALAGHMRRDLVEAR
FT                   QWITDGDYKEGLALAQLAPGPLAAQLAIYLGYVHYRILGATLVGIAFVLPSFLMVVALG
FT                   WAYVRFGGLTWMQSVFYGVGAAVIGIIAISAYKLTTRSVGKDKLLWAIYLLLCAVTVIT
FT                   ESEVAWLFLASGVLVWLWRAPPKWLGHGRANAIAAIPAPAASALLGTIDWPLLSQIGLF
FT                   FAKAGAFVFGSGLAIVPFLYGGVVTEYHWLNEKQFVDAVAVAMITPGPVVITVGFIGYL
FT                   VAGLPGACVAAAGTFLPCYLFTILPAPYFKKYGKLPAILAFVDGVTAAAVGAISGAVIV
FT                   LARRSIVDVPTVLLAVVTVALLLRFRKLPEPAIVAGAAALGLLIYPLLHH"
FT   gene            complement(408946..409953)
FT                   /gene="chrB2"
FT                   /locus_tag="Rmet_3866"
FT   CDS_pept        complement(408946..409953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrB2"
FT                   /locus_tag="Rmet_3866"
FT                   /product="chromate resistance regulator (putative
FT                   activator)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3866"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10734"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ2"
FT                   /protein_id="ABF10734.1"
FT                   /translation="MTATYAAFMTPALNVPNSAPNAWLLLIVSLPTSSATARMRIWRAV
FT                   RTLGCAALRDGAYLLPAHAEQAMQLRILADDALQEEGQAWLLRVQAGDAAEDSAYRALF
FT                   DRTPDYTRWLAELSEARKTLPDLVAAERSRLQRRHARAYDTIRKIDFFPNEATVRADAQ
FT                   WRDFAAAIEATQSPGEPHAAAGGIPRRDPSQYQGRLWATRRNLWVDRVASAWLIRRFID
FT                   PHAGFLWLANPADCPADALGFDFDGATFTHVGTRVSFEVLLASFGLDDNPGLVRLGAMV
FT                   HALDVGGSTVPEASGFEAILAGARKRLADDDALLTEVGTVLDSLYAHFSGNRKP"
FT   gene            complement(410053..410991)
FT                   /locus_tag="Rmet_3867"
FT   CDS_pept        complement(410053..410991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3867"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3867"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10735"
FT                   /db_xref="GOA:Q1LGJ1"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ1"
FT                   /protein_id="ABF10735.1"
FT                   /translation="MSSGPLSTPIQCPDPAARAPLASHGGRTPHARLYPAPPSLHGAIA
FT                   AIVCRDTRGFPLTDAQRLTHVPASPLVCLSWFPDPGTGLVERSSNGPLWRPFGATVTVS
FT                   GSQSSPLTSWAPTTGRGGMVCFTADVAKALFDLDLTAIHDRFRCAREVLGDGWRPLIES
FT                   LSDAESDAETLAALEQHLAPRWHALRHRSSPLASLRQTGRRWVESLAWQAREWQRTSSP
FT                   RQVERRIKAYSGRSLREWQAIVRTEGAFFTARDRYEAGQPFDWPGLALEEGFADQAHLV
FT                   RTTKRITGFSPTEFTQRFVEDESFWLYRLWV"
FT   gene            411078..412499
FT                   /locus_tag="Rmet_3868"
FT   CDS_pept        411078..412499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3868"
FT                   /product="putative cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3868"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10736"
FT                   /db_xref="GOA:Q1LGJ0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGJ0"
FT                   /protein_id="ABF10736.1"
FT                   /translation="MTTESQAQCPFQTAKSPPPAGSPLPHPYGTWPPGPAAGLTGWHLL
FT                   RRMSRDLLGTLGEWQQTYGDVVHLRMWPEHAVVVTDPQLVRELLVTHHDSLIRWERGTR
FT                   VFSRVHGHSVLTAEGDAWSRKRQALQPGFMPKAVHGFVPGIVEIVDKGLATWPTRVADW
FT                   PVESALTSLTMDVIVRMMFSDEIGEDARVAECAVRAISEAANADFYWPASLPDWVPWKR
FT                   ARRRALHTLRDLIERHLQARLRMRTDTWPDDLLSRLLCLHRDDATAWPLQAVRDECMTT
FT                   FLAGHETTAATLTWWAWCMASNPSAQDAARAEVTHVLRGQAPTADSRQALRQVVQTITE
FT                   SMRLYPVAPVLISRRAVRPITLGPWRLPARTLFMLPLQLMHHDPRLFPEPERFQPDRFS
FT                   TGSPQAPRGAYMPFGTGPRVCLGQHLATAEMTVIAAMLLQRYKLSVPEGAAHPRPLLNV
FT                   TLRPDQPLWLAVTPI"
FT   gene            complement(412577..413656)
FT                   /locus_tag="Rmet_3869"
FT   CDS_pept        complement(412577..413656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3869"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3869"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10737"
FT                   /db_xref="GOA:Q1LGI9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI9"
FT                   /protein_id="ABF10737.1"
FT                   /translation="MSALFTPVRVGRYTLKNHLVMAPMTRSRASLDGTPGELAAEYYAQ
FT                   RASVGLIVTEGTQPSDDGQGYLATPGIYTEAHVDGWKNVTAAVHERGGRIFIQLMHAGR
FT                   MSHPDNTPHHRQGVAPSAIAPGVPMFTLKGMQDIPAPRALTTAEVRQTVDDFRFAARQA
FT                   IAAGADGVEIHGANGYLVQQFFAPNANTRTDKYGGSIDNRARFAIEVATAIAGEIGADR
FT                   TAIRLSPGTPLWGIDEGAEGPALYRHLVTELDKLGLAYLHVSLQGNEPQLADIRERWRG
FT                   TLILNRPGRTREAVGADVASGLADLEAYGQMVLANPDFVTRLKLGAPMNDALPNAFFGG
FT                   DGRGYIDYPALALTDTVTS"
FT   gene            413830..414699
FT                   /locus_tag="Rmet_3870"
FT   CDS_pept        413830..414699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3870"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3870"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10738"
FT                   /db_xref="GOA:Q1LGI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI8"
FT                   /protein_id="ABF10738.1"
FT                   /translation="MELLNDMALFVEVVKAKGFRSAADVLDMPSSTLSRRISALEKAIG
FT                   LRLLHRTTRKIELTEAGRIYFERCKRIVGDARLAHEQLGTMLAEPVGVLRASFPVDFAV
FT                   TYLAPLIAEFAGRYPGLSFDFDLTPRRVDLVSEPFDVAIRAGEPEVSQLIARQLASFRT
FT                   YLYASPGYIKRAGEPRAPADLNHHECLGIQRGGAWTLHRGEDTTTIPVGSRFTLNSVGM
FT                   ARRLAALDMGIVLMAEAIVADDLATGQLRRLMPEWQGTPVPVYAMTETRLLPAKTQRFI
FT                   EFLRERFE"
FT   gene            complement(414851..415282)
FT                   /locus_tag="Rmet_3871"
FT   CDS_pept        complement(414851..415282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3871"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI7"
FT                   /protein_id="ABF10739.1"
FT                   /translation="MNHPAPNKPRHTFRRQPRIATWLAAAAVLALPGVAFSQQTASPPD
FT                   GGDNDAAMRNIQSNFARMTPAPRTIDTINQELKQTATKSHGGGGGGLGQRGGGRHGRQA
FT                   QQQDKSDSGNGNTSGTAGTPGGGTAPSESTGLSSGPSAQ"
FT   gene            complement(415422..416408)
FT                   /locus_tag="Rmet_3872"
FT   CDS_pept        complement(415422..416408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3872"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10740"
FT                   /db_xref="GOA:Q1LGI6"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI6"
FT                   /protein_id="ABF10740.1"
FT                   /translation="MASRLLSARSTLPGLLLVLALTVPATLLGKAVPLLGGAVFGMLLG
FT                   LLCRAFLKPSESCKPGIQFASKQLLQYSIVGLGFSLPLHEVVHTGLTSLPISLVTLTVA
FT                   FTVALVAGHLLRIPEKLKVLIGAGTAICGGSAIAAITPVLQPDDHDMTYALSTIFMFNV
FT                   VAVVIFPILGKMLGMSDAGFGLWAGTAINDTSSVVAAGYAWSSAAGEYATIVKLTRAMM
FT                   IVPVTLVIAMLFQRSQPGGSMRRVIPWFIVLFVLASAINEFLPAGVTHVIQQLAPFLVI
FT                   GALTGVGLSTDFNRLKRAGARPLLLGLIVWVSVALSSLVMQHMTGML"
FT   gene            complement(416687..417205)
FT                   /locus_tag="Rmet_3873"
FT   CDS_pept        complement(416687..417205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3873"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3873"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10741"
FT                   /db_xref="GOA:Q1LGI5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI5"
FT                   /protein_id="ABF10741.1"
FT                   /translation="MSSTTRSASVDTGTTDPWSNLDEAGTDLNVNDFLTTMLSQLVTAL
FT                   RSNVTEPYASRFELTVPEWRILALLAHGETMSFAELVRQSTSDKALVSRTLRLLEDRGL
FT                   VTLESEGGTRRRLTCRITPEGAALHAQVIPLARRGQASVIRMLSPEERRGLYSGLRKLH
FT                   GLCTTPNKP"
FT   gene            complement(417439..418209)
FT                   /locus_tag="Rmet_3874"
FT   CDS_pept        complement(417439..418209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3874"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3874"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10742"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI4"
FT                   /protein_id="ABF10742.1"
FT                   /translation="MNSTPTLTSASAALSNKVAFVTGGSRGIGAAVVRRLAREGAAVAF
FT                   TYQSSGAVAQALAESIQAAGGRARAYHADAADAAAVTRAIDAAAADFGKIDILVNNAGV
FT                   LFLGPVDTFPLEDFDKTLAVNVRAVFVAAKAALAHMGQGGRIINIGSTNADRMPFPGGA
FT                   AYAMSKSALKGLVQGMARDLGPKGITVNNVQPGPVNTDMNPEDSEFAASLHGLMALQRH
FT                   AHPDEIASMVAYLAGPEAGFVTGASLNVDGGFAA"
FT   gene            418322..419245
FT                   /locus_tag="Rmet_3875"
FT   CDS_pept        418322..419245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3875"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3875"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10743"
FT                   /db_xref="GOA:Q1LGI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI3"
FT                   /protein_id="ABF10743.1"
FT                   /translation="MEALNLLESFIQSAETGSFSAAARRLGLTPAAISKNVARLENHLG
FT                   LRLFQRSTRRLTLTMGGEQFLQQVSDPFSTLRDAFASAAQEDGKPAGVLRVSMGVAFGR
FT                   EYLVPLLGEFLARYPGIVPDWHFENRTVDLIAGGFDAAIGGGIELTEGVVARELARTYV
FT                   VVAASPAYMKDRAMPRHPSDLAGFDGIVRRSASTGRLRHWNLRNQIGEQALAEMRTRVI
FT                   LDDPEAMAHAAMSGLGIALLPMPHAAPWLESGALVRLLPGWYADNGPIVLYYPNRKLLP
FT                   PKTRVFIDFIAESFQKNALAHRFDGR"
FT   gene            419284..422205
FT                   /locus_tag="Rmet_3876"
FT   CDS_pept        419284..422205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3876"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3876"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10744"
FT                   /db_xref="GOA:Q1LGI2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI2"
FT                   /protein_id="ABF10744.1"
FT                   /translation="MPPATRRGFPLHAYIWAPFAVLVLLVGAVACGVNYLMTKSALEHA
FT                   MADANERISREMLEKVEDMVLPTQAAVTLVSHSSLGEATTLAQRMARVALVRDALGTSP
FT                   VLQSLFLGHADGSFFYVRRVRDDAERGPYQAPAGSAYVIQSIDHDAGAAFGQLIFLDTD
FT                   LNELARRPTPDFVKRYDPRKRPWYMEAIAAGKLVRTEPYMFFSDYQAGETIAVPTRAGS
FT                   AVAGGDFRLDTLGQALARDRTTPGSVLAVLNAQGQLVAIDRSPPEWMSAPDAMRTGLLG
FT                   KPEDYGLPVLSSLAAQVASGSEAAVRNELTTLGGKGWYTSIGRMSGGVGTLYLVMATPQ
FT                   DELLRDATRQASVGIFATALVVLLSLPLMWLVARAVARPLCQLTDEAEAIRRFDFDQPF
FT                   RFWSPVREVHRLGETMDKMRNTIQQLLIIMRAVTAESQLEKLLPLLLHKMQDAAAGQAG
FT                   VLYLIDGDTARPAAAFDAQGRDIVQEIGATPLPEALSLIGAAVRDGVSRTGYVTAAEAA
FT                   QAKLGPLASVMPCFVAAIPLINHRHECPGVVLVMRDTPLQTAQLAFVDTIAGLSAGALE
FT                   VRELSAAQRDLFDAFIRLLADAIDAKSPHTGGHCARVPELTKMLARAACEVTQGPYQSF
FT                   QLSEQQWEELHVAAWLHDCGKVTTPEFVIDKATKLETLYDRIHEVRMRFEVIKRDAEIQ
FT                   CLQSIAAGEPLPIAQARRDAEIVRLDNDFAFVAACNQGGESMSQEDMDRLRQIAARTWT
FT                   RTLDDRLGVSHEEFARKCRSPAHALPTQERLLADRDDHRIERGARDVMPPDNPWGFKRK
FT                   VPRYLYDHGEIHNLTIGRGTLSEEERYKVEDHIVQTQIMLSRLPFPKHLRNVPEIAGGH
FT                   HEKMDGTGYPRGLTRNQMSPLARMMAIADIFEALTAADRPYKKAKTLSESIGIMARLKA
FT                   QQHIDGELFDLFLTSGVYREYAQRYLDPAQIDEVDTEDYVDAA"
FT   gene            complement(422230..423036)
FT                   /locus_tag="Rmet_3877"
FT   CDS_pept        complement(422230..423036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3877"
FT                   /product="conserved hypothetical protein (membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3877"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10745"
FT                   /db_xref="GOA:Q1LGI1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI1"
FT                   /protein_id="ABF10745.1"
FT                   /translation="MPIGFLRSLTARHRNPVSNRRLARVLCFVAGAANAGGFLAVQQYT
FT                   SHMSGIVSAIADDLVLQRYGLVVHGIGALASFLAGAGTTAILVNWARRARLRSEYAIPL
FT                   LVEATLLLCFGLLGSHLNDMDWLFVPATVMLLCFMMGLQNALITKLSNAEIRTTHVTGM
FT                   VTDIGIELGKLFYWNAAVRPNSRPVMADRHKLRLLTVLVGMFLVGGIVGAQAFSTLGYA
FT                   ATLPLAALLLIVAIIPVADDLLTRLLLRVHRADSARRARRWGARGR"
FT   gene            complement(423142..424065)
FT                   /locus_tag="Rmet_3878"
FT   CDS_pept        complement(423142..424065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3878"
FT                   /product="putative sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3878"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10746"
FT                   /db_xref="GOA:Q1LGI0"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGI0"
FT                   /protein_id="ABF10746.1"
FT                   /translation="MVITGKFAMYVTAFVVTVSLIEAFVLWRKRRDGVKPFSWNEVWLS
FT                   LADLAGRKLSVLLPLSLAAPVFSFAWDHRLFTITLNSALAVFLLFVGQEFCYYWYHRAA
FT                   HRIRFFWATHAVHHSPNQLTLTSAYRLGWTGKLTGSAVFFAPLVLLGVRPEVVLATLSL
FT                   NLLYQFWLHNDWMPKLGWFEYVFNTPSAHRVHHASNIDYLDANYGGVLIIFDRLFGTYV
FT                   EERADEPCRYGLVHPTTTQNPIVNQFEHWVSLGRDMASASKLWHAAAYLIMPPGWAPNG
FT                   KGTTTEILRRQQEELRQAGWQRPGVV"
FT   gene            424317..425180
FT                   /locus_tag="Rmet_3879"
FT   CDS_pept        424317..425180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3879"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3879"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10747"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH9"
FT                   /protein_id="ABF10747.1"
FT                   /translation="MISRTRIAATGVLLLLASTSASAWTGHGTAYTPRGTYNGAHFGSC
FT                   GGGSCSHAGGVAGPYGGLATNTGTVTRTAPGQFSNAGTAVGPNGRSVQHDGSTSCASGT
FT                   CSHSGDMTGANGRSATTSGSVTREAPGQYSSSGNVTAGNGNTYNHAASTACAGGTCDRS
FT                   GTVSGSYGGTVTHAGSATRVSSGVVTTGGGATVVHGSAVSTGGTVVVGAAPVAYVPPPP
FT                   VAVVATVPVAPPPPPLAGPVYVAPPLPAVVVTAKAPPPVYVAPPRVAVWVPAHWVGRVY
FT                   VPAHWV"
FT   gene            425261..425590
FT                   /locus_tag="Rmet_3880"
FT   CDS_pept        425261..425590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3880"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10748"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH8"
FT                   /protein_id="ABF10748.1"
FT                   /translation="MMAVLILCIVSAGAHAQSRLMAMGAMGAMGAMGGAAGGDRIEHAE
FT                   AAAQQLQARFANANTTHDGKLTRAQAAAGMPMVAKHFDEIDTQRSGYVTLRQIEIFMAQ
FT                   RMSAR"
FT   gene            425609..426322
FT                   /gene="ompR"
FT                   /locus_tag="Rmet_3881"
FT   CDS_pept        425609..426322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="Rmet_3881"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3881"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10749"
FT                   /db_xref="GOA:Q1LGH7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH7"
FT                   /protein_id="ABF10749.1"
FT                   /translation="MEQVNRIIVLDDEAELRNMLQRFLTGHGFHVRAVADGKQLNRYLQ
FT                   REPYDLLVLDLMMEPEDGLSVCRRLRAEGQTLPILMLTAKGDPADRVIGLDTGADDYLA
FT                   KPFLPDELVARIRALLRRQKIAAGDPTVASQTLSFGEFRFDVGKQTLTRAGVPVEVHSA
FT                   QMLLLQALGASPNRPVSRENLLARARGRDHDALDRSIDVQILRLRQIVEEDPSKPRFIK
FT                   TVWGVGYMLVAGVEA"
FT   gene            426322..427635
FT                   /gene="envZ"
FT                   /locus_tag="Rmet_3882"
FT   CDS_pept        426322..427635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="Rmet_3882"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3882"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10750"
FT                   /db_xref="GOA:Q1LGH6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH6"
FT                   /protein_id="ABF10750.1"
FT                   /translation="MRIGLPRSLLARNIALLVALVAFTQVCSLMVLLHFAQRPRVERAA
FT                   TVFAHYVSMLDGVMAAMPAEEARVAVARLGGQTDAPAVDDVMEARALHPFRTWQRDVFM
FT                   DELHKALPPDMPVQWQDAGDNERLWIRIRAAGMPTWVALPMTADAQASGITAAIALSAA
FT                   LGLLAALTGYLIQRHINRPLQDLARAALHVSAGETPAPLPTDGPTEISQVSSAFNRMTE
FT                   ALQQTEKTRALMLAGISHDIRTPLTKLRLAMAMALPRGTDDAFVGSVEGYLDRIDTILQ
FT                   QFMDYAGSGEREAPQPGDLNALVRQLASDFAGLGHEFELDLGDLPPVSYRPTSMLRLLM
FT                   NLMQNAINYGRTGLMVRTWKEGGAAHVAVCDRGIGISVAELEQLRAPFSRGDNARGHSG
FT                   GTGLGLAIVERIARLHGGSLAFRPREGGGLEVVVSLPV"
FT   gene            427759..428514
FT                   /locus_tag="Rmet_3883"
FT   CDS_pept        427759..428514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3883"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3883"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10751"
FT                   /db_xref="InterPro:IPR025522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH5"
FT                   /protein_id="ABF10751.1"
FT                   /translation="MQTVFQSIQRNASRLTLAAFAATSMLMAGCASATTMISDASVPAT
FT                   LAHVSADVIYVRGFDVSASQVRVDDNVMHRVKAMATGDAGALSQDQTAVDARNAVADEI
FT                   VGDLRAKGLHAERIDGPVPTDVNALIVEGRFDKIDEGKSRRRMLIGLGAGKSDVSTSVQ
FT                   VFYQPAHGTPVPVELFQTSANSGHMPGIAETAGIGAAAGALTTAAAAGAGVHGVTEMKR
FT                   DSISAEARRVGDAVAKQVAGVVEKLSKTV"
FT   gene            428646..429179
FT                   /locus_tag="Rmet_3884"
FT   CDS_pept        428646..429179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3884"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3884"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10752"
FT                   /db_xref="GOA:Q1LGH4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH4"
FT                   /protein_id="ABF10752.1"
FT                   /translation="MDEAGTRQKAFLDLAHQIHWRFTNGSGCREAVKHYSSENFHLTQS
FT                   IGFHLNRARNILLMEMDAALRPLDITGQQMGILLSLTRGVATTPFEISKVLGIDTGLMT
FT                   RMLDKLESRGLLQRQRSIEDRRVIHLLLTDKGREVATRIPEIAPEVLNHRLRDFSTEEF
FT                   CEFLRLLRKFTDSD"
FT   gene            complement(429244..429981)
FT                   /locus_tag="Rmet_3885"
FT   CDS_pept        complement(429244..429981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3885"
FT                   /product="putative Asp/Glu racemase"
FT                   /EC_number="5.1.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3885"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10753"
FT                   /db_xref="GOA:Q1LGH3"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH3"
FT                   /protein_id="ABF10753.1"
FT                   /translation="MNLLIVNPNISESVTDLIHAEAQRTVSPDTRITMATAPFGVAYIE
FT                   TRFEALVGGYATACAAAEHAGQFDGLIVAAFGDPGLAGLKELFDVPVVGMTEAALASAC
FT                   LLGQRFSIIAISHRIQAWYRECVAANGLGDRLASIRSLQEPLRDIGSVQEDHSARLEEL
FT                   ALQAVREDGADVIIVAGAPLAGLARSLKGRIPVPVVDGVSSAVRHCESLVALQAGSARE
FT                   GSFARPPRKPNAGLPPALSRLLD"
FT   gene            complement(429988..431406)
FT                   /gene="hyuA"
FT                   /locus_tag="Rmet_3886"
FT   CDS_pept        complement(429988..431406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="Rmet_3886"
FT                   /product="D-hydantoinase"
FT                   /EC_number="3.5.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3886"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10754"
FT                   /db_xref="GOA:Q1LGH2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH2"
FT                   /protein_id="ABF10754.1"
FT                   /translation="MPADNNLDLVIRNADVVTASDRFRCDIGVRGGRIVALGHDLPPAA
FT                   SEIDATGLLALPGGVDGHCHLDQPMPDGMRMADDFFTGTRAAACGGTTTVIPFAAQEKG
FT                   ASLKAAVDDYHRRADGRAVIDYAFHLIVADPTPAVLQDELPSLIRQGYSSFKVYMTYDD
FT                   LKLSDREMLSVLDVARQNNALVMVHAENADCISWLTDKLVGQGRIAPRFHALARPDAVE
FT                   REATHRAITFAELVDVPILIVHVSGKEAIEQIRWAQGRGMKILAETCPQYLYLTAEDMG
FT                   MGGDDGYEGAKCVCSPPPRDPENQAAVWRALTNGVFSVFSSDHAPFNYDDPEGKKLGGT
FT                   AQPFDHIPNGVPGIETRLPLLFDGVARGKLSLHQFVELTSYRPAKIYGLYPRKGTIAVG
FT                   ADADIVLWDPTRKVRIANANLHHAVDYTPYEGIEVTGWPMTTFSRGELIVRNGEYLEPA
FT                   AGRGKFLEAGQPEI"
FT   gene            complement(431432..432160)
FT                   /locus_tag="Rmet_3887"
FT   CDS_pept        complement(431432..432160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3887"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3887"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10755"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH1"
FT                   /protein_id="ABF10755.1"
FT                   /translation="MTRQIRLGMLTPSSNTALEPITSAMVSGLPNVSAHFSRFTVTEIS
FT                   LRDQALGQFDLEKILAAARLLADARVDVIAWNGTSSGWLGFDKDEALCRQITEATGIPA
FT                   TTSVLALNEILEKTGARRFGLATPYLHDVQERIVANYQRSGFDCSAERHLGLHVNYSFA
FT                   EVDEDTVRKMVRELAAERPQAITTFCTNLHAAHLVEALEAENGIPVYDTIATVVWKSLR
FT                   LAGVDTRALQGWGRLFREVE"
FT   gene            complement(432256..433557)
FT                   /locus_tag="Rmet_3888"
FT   CDS_pept        complement(432256..433557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3888"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3888"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10756"
FT                   /db_xref="GOA:Q1LGH0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGH0"
FT                   /protein_id="ABF10756.1"
FT                   /translation="MQSTSPAAASLAVPRSSVRWKIFLMMLLLVAINYIDRASLSVAMP
FT                   LIAKEFDLSPAMQGLILSSFFWTYAVMQVPGGMLADKYKPRIVIATATVFWGAFQALAA
FT                   VCTNATSLLLTRLGLGAAEAPIYPAGGKLNAIWMTKNERGRGATLLDGGAPLGAALGSL
FT                   IIAGLISELGSWRLSFVVAGVGTVLAGFVAWWYIRNSPREHLGVNEQEARHIEDALALE
FT                   HSEEPTNLSGRSLDFFKYRSVWCMAISWMCFNAVFYGLLTWMPTYLSKARGFDLKQMGG
FT                   ASFIIFFAGFVGELIGGWIADKWKEAGGRPNVVMRTLFGIAAVVATVSIFSVAYVTDPV
FT                   AVVVLLSSTLFFLRWCGLFWSVPSMLGTRNKVGFLGGVMNLGGNIAGISVPIIVGLIVQ
FT                   ATGSYFLALMFFAACGIGLLLASTNIDYEKKIPV"
FT   gene            433745..434467
FT                   /locus_tag="Rmet_3889"
FT   CDS_pept        433745..434467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3889"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3889"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10757"
FT                   /db_xref="GOA:Q1LGG9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG9"
FT                   /protein_id="ABF10757.1"
FT                   /translation="MSVTQALPKTARLRTLGMSAEIAARLRTMIQEGELPPGVRIDEKA
FT                   FCEAFDVSKTPLREALKVLVAEGLVLHRQYIGYRVAPLDLDELRATFETLHGLEAHAGE
FT                   LAAQRLSDAAVTKIERRHQAMIDAHDAGRRTDYFRINQEIHQLIIDGAGNAVLAGIYAM
FT                   LMSKVHRARGAANADMLRWQESHTEHEEIIAALREPGRPRLADVLRRHSENTAKEVLRV
FT                   VEQTLAEPAARAAGGARR"
FT   gene            434648..435418
FT                   /locus_tag="Rmet_3890"
FT   CDS_pept        434648..435418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3890"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3890"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10758"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG8"
FT                   /protein_id="ABF10758.1"
FT                   /translation="MIRTWVGACAAVATLFASTVQAEDIRVMTSGGFTAAYKILGPQFA
FT                   GESGNTLETTLGPSMGQSPEAIPNRLARGEQADVVIMVGYALDDLIKKGVVDPKSRVEL
FT                   ADSRIGMVVRQGEVVPDIRTVDALRRALMQAKSIAYSDSASGVYVQRELFKRLGEPEVL
FT                   GAKAKKIEKTPVASVVANGEYEIGFQQVSELLPVSGVSFAGRIPEDVQSITRFAGGIPV
FT                   NAAHPALAKALLDYMAAPAAQTVVKETGLDSVPH"
FT   gene            complement(435471..435929)
FT                   /locus_tag="Rmet_3891"
FT   CDS_pept        complement(435471..435929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3891"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3891"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10759"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG7"
FT                   /protein_id="ABF10759.1"
FT                   /translation="MLQRLAARGLMLPDPPRPLGNYTAVSQAGDLLFVSGQLPLANGKV
FT                   VWQGQVGRDLTLEEGQRAAVLAALNVLAQIRAYLGGFDRLDHIVRVEGHIASAEGWLQQ
FT                   PAVIDGASDLLVDVLGARAGHARTISSHFQQPGNAAVILVVIAQIGAQ"
FT   gene            complement(436053..436787)
FT                   /locus_tag="Rmet_3892"
FT   CDS_pept        complement(436053..436787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3892"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3892"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10760"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG6"
FT                   /protein_id="ABF10760.1"
FT                   /translation="MSNTHPTVIITGATSGIGLGLAKAFLKEGYNVVGTGRSQERLQAT
FT                   AAQLDAGERFVGVAGDVALPDTAREVFAQAIARFGHVDVLVNNAGIFSAKPFVQFTPEE
FT                   IELQIATNLKGTLYPSQEAARHMSERRQGKIINITASIALQPHAGVPALLAVALKGGLN
FT                   QATRALALELAPFGVTVNAVAPGVTDTPMHAAETHDALGRLHPLGRIARIDEINAAVLY
FT                   LAKADFVSGTVLAVDGGYSAGR"
FT   gene            436925..437878
FT                   /locus_tag="Rmet_3893"
FT   CDS_pept        436925..437878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3893"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3893"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10761"
FT                   /db_xref="GOA:Q1LGG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG5"
FT                   /protein_id="ABF10761.1"
FT                   /translation="MHRHFDDVLLGSIELFCLAAEAGSFTAAANTAGVTPAAVSRSISR
FT                   LEKRLGVRLFVRSTRSIRLTEGGRSYFEQCRGALNQLIEAERKVTGEQVQPSGTLRISA
FT                   PTTYGHYRLLPLLPALRERFPLLRFEVQIGNRNIDFHEENFDVAIRFRAQPDSTMVSRH
FT                   LEDAELVVVASPGYLKRAGRPQALEDLQQHECIQFDLPSSGRPIAWLFMDGGREREVLA
FT                   TESHYLCAEDVLAGVTLARSGAGLFQTYRFIVERDLADGTLVEVLQPFAGRSRPVSLMY
FT                   PHGRLLPSRVRVFVDFLMEQAAALASARGAGKPARG"
FT   gene            438179..439204
FT                   /locus_tag="Rmet_3894"
FT   CDS_pept        438179..439204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3894"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3894"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10762"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG4"
FT                   /protein_id="ABF10762.1"
FT                   /translation="MHEPVSYLQGLVHARAGGLVDLYPAYYLRYLASVASISAFCYPAG
FT                   SRKWLTRRAKLIALSAVRAGSARSWLRAAAASPLLQRVVVARPLMLEKPFRPLGALGLG
FT                   FGDRARLVVDHYVLAESALPVCVCDRIYLSGGLRWMSEDGRYELRLADSGPNPKEGELA
FT                   FYWTDIETGVCLTQLSFYLRRGDHGPEIYVGGLQGPMGEQSREWIRLATKASEGLRPKD
FT                   VVMEALLAFAAHVGARRVVGVSRANHVSRQRNTPREILADYEGFWAEYHGTSLADGNVD
FT                   VPICQPQRDIAEIPSKKRSAWRRKQAFAEAVRATVADWLRADAVPAGNDPQLPVAAAVA
FT                   A"
FT   gene            439315..440064
FT                   /locus_tag="Rmet_3895"
FT   CDS_pept        439315..440064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3895"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3895"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10763"
FT                   /db_xref="GOA:Q1LGG3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG3"
FT                   /protein_id="ABF10763.1"
FT                   /translation="MPDANDLLSRSREPVYLQLATIFRRQIESGAWRPGEQIPSLEALC
FT                   RQYGVARMTMHNALSRLDEEGLVERSRGRGTFVKAGGRECRRMALPINWNQAVAVGDKL
FT                   STEAIVESTADVPLPDDLGMPCDGRRADAYHFLHRAHRTDGRPFAVGEVYIAADVFARD
FT                   PEAFRHGASVPVLDRFPGLKVNAARQRLSIVPAGAESASALELAVGAPVAELRRFACVD
FT                   DVIVYYARIEFPTEYVCLDFDLLAPHS"
FT   gene            440110..441651
FT                   /locus_tag="Rmet_3896"
FT   CDS_pept        440110..441651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3896"
FT                   /product="thiamine pyrophosphate(TPP)-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3896"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10764"
FT                   /db_xref="GOA:Q1LGG2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG2"
FT                   /protein_id="ABF10764.1"
FT                   /translation="MNGAESLVKTLLACGVDTCFANPGTSEMHFVAALDRIPGMKCVLG
FT                   LFEGVVTGAADGYARMADKPAATLLHCGPGLANGLANLHNARRAQTPIINIIGDQATYH
FT                   RPLDAPLTADTEGWARPVSVWTRTATHAASVGADAAAAVQAATSAPGGVASLILPSDVC
FT                   WDAGGKVAAPLPALAVPKVSPDAVQNAARVLRSGQPTLIVLAGNALRTGALADAHRIAA
FT                   ATDARLITPMSNSRVTRGRGHLAVDRIPYSGDVARQKLAGIRNVILVGAPAPVTFFAYP
FT                   GKSPRPYPEDAVIHVLARPEEDLGEALARLSDELGARNAPLPASAHITAEPAKGAVTSE
FT                   AVAQTLTALLPDQAVVVEESVSFGRAFYPGTVHAAPHDWLQLTGGAIGAGLPLATGAAI
FT                   AAPDRRVVALQADGSGMYTLQSLWTMAREKLDVTIVLLANRKYAILLGELAGVGANPGK
FT                   TALDMLDLGNPDLDWVKMANGMGVEAARAENMETFADLFRMANQRKGPFLIELVI"
FT   gene            complement(441718..442578)
FT                   /locus_tag="Rmet_3897"
FT   CDS_pept        complement(441718..442578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3897"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3897"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10765"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG1"
FT                   /protein_id="ABF10765.1"
FT                   /translation="MTTPTLEQLREWIGRTESRTETLAAEPVQGLAATFDLDGDALVSQ
FT                   PLPPLWHWLYFLPRAPQHEIGVDGHPALGGFLPPVPLPRRMWAGSEVTFKRGLRVGETV
FT                   TKTSTITDVQHKSGRTGELWFVTVDHELSVNGETALNERHDIVYRAMPERGQPQPPRPR
FT                   LAHTAQFGRSLKADPVLLFRYSALTFNGHRIHYDLDYVRDVEGYPGLIVHGPMQAMLML
FT                   ELLRHERPDARVKRFGFRGLAPLFHLDTVTVGGMDDAETPGKVILWTGDDAGGQAMAGW
FT                   AEVEG"
FT   gene            complement(442605..443984)
FT                   /locus_tag="Rmet_3898"
FT   CDS_pept        complement(442605..443984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3898"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3898"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10766"
FT                   /db_xref="GOA:Q1LGG0"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGG0"
FT                   /protein_id="ABF10766.1"
FT                   /translation="MSDIDTRYPTRQLCEFLARFTLADVPSPVVERTKDLFLDWIASAI
FT                   AGKDAPAVRRIQEFAAAMGPATGQAEVFVDRRRTSPYFAALINGASSHVVEQDDVHNGS
FT                   VLHPAAVVFPAVVAAAQAEGKTGAEVLLASIAGYEAGIRIGEFMGRSHYRVFHTTGTVG
FT                   TLAAAAAVAKLYGLDAEGINQALGSAGTQAAGLWEFLRDAADSKQLHTAKAAADGLQSA
FT                   WLARAGFTGARQILEGAQGMAAGMSSDANPAALTDGLGTRWATAETSFKFFASCRHTHP
FT                   AADALKALMLREGLQADQIAAVTAHVHQGAIDVLGPVVNPATIHQAKFSMGTVLGLVAV
FT                   HAHAGLGEFEQHSLKDAQVSAFRDKVTMELDEEINAAYPRQWIGRVTVRTTDGRTLQAR
FT                   VDVPKGDPDNTLSRPELEAKAIQLGAFRHGATEAEMRAIIARVWQLDREANVNDWLPAA
FT                   R"
FT   gene            complement(443993..445162)
FT                   /locus_tag="Rmet_3899"
FT   CDS_pept        complement(443993..445162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3899"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3899"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10767"
FT                   /db_xref="GOA:Q1LGF9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF9"
FT                   /protein_id="ABF10767.1"
FT                   /translation="MHAAQDQDLIYPEIREAVRDLCKQFDSAYWQRIEEHSAFPEEFVQ
FT                   ALTHAGWLSALIPEAYGGSGLPLTAASVIMEEINRNGGNSGACHGQMYVMGCLLRHGSE
FT                   AQKQRWLPGIASGELRMQSMAVTEPTTGTDTTKLKTTAVRRGDKYVINGQKVWISRVQH
FT                   SDLMLLLARTTPLDQVKKKSEGLSVFVVDLREAIGNGLTVQPIRNMVNHETNELFFDNL
FT                   EIPAENLIGEEGKGLKYILDGLNAERILIAAECIGDGYWFVERASSYARERIVFDRPIG
FT                   QNQGVQFPIARSFVNVEAASLMRYKAAQLFDAGKPCGKEANMAKLLAADASWEAANVCL
FT                   QTHGGFGFAAEYDIERKFRETRLYQVAPISTNLILSFVAEHVLELPRSF"
FT   gene            445274..446470
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3900"
FT   CDS_pept        445274..446470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3900"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3900"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10768"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF8"
FT                   /protein_id="ABF10768.1"
FT                   /translation="MTGGADWRGCGLSRDFFMPSPPLRQSRIVPPGQWIHAARYSNPRN
FT                   QTRMTRAFRRQRMTTFPQLPAIGTGKWRGMTWAALALAAVAVAVPGQGRANDAYPSKPI
FT                   VMVVPFAAGGPTDVVARSVAAAMSKTLGQSVVVENRLGAGGTVSAAYVAKAAPDGYTIL
FT                   IHHNGMATAPALYSKLPYKPLTDFSFVGQVADVPMTLLGRHDLPPNNLPELVTYIQKNQ
FT                   NKVNLANAGLGAVSQLCGMLFQKAIGVDVQTIPYQGTAPAMTALLGGQVDVLCDQTTQT
FT                   LTHIKADKVKLYGVTTAERIPALPNAPTLREGGLKGFEVKVWHGIYAPKGTPPAVINKL
FT                   NGALRAALKDPAVAARMQDLGAVIVPEDKQTPEGLRTWLASEIDKWSPIIKAAGVKAD"
FT   gene            complement(446493..447395)
FT                   /locus_tag="Rmet_3901"
FT   CDS_pept        complement(446493..447395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3901"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3901"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10769"
FT                   /db_xref="GOA:Q1LGF7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF7"
FT                   /protein_id="ABF10769.1"
FT                   /translation="MHYDLTDLRLFLNVGETENITRAAERSFLSLPAASARIKQLEEAF
FT                   QTQLLIRQVKGVRLTPAGDALLRHAREVFRELECLHSDLRPYAKGVKGRVRLLANTTAT
FT                   NSFLAHALSRFLSENPDVDIELEEHLSADIVSAIGTGAADLGIVAGEVATADLDTMQLC
FT                   SDELIVIAPVNHPLPAFKTLRFAELLDSCRFVGLNQSSAIQSFLDRIASGMGKRISLRI
FT                   QVGSFDAVCRMVEAGAGIAIVPNSCARRYASRKVLRFIRLEDDWARRELQLVRRPGREL
FT                   PQFAETLIQYLVDAAREPV"
FT   gene            447394..448446
FT                   /locus_tag="Rmet_3902"
FT   CDS_pept        447394..448446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3902"
FT                   /product="putative short-chain dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3902"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10770"
FT                   /db_xref="GOA:Q1LGF6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF6"
FT                   /protein_id="ABF10770.1"
FT                   /translation="MASAGTKPTFVIHEFQSFGRQFIVSSSAIKRAGFPVRADSKPMED
FT                   TMSGMMEGKVVVVTGAGGGIGRGIALGMAAAGARVVVNDLGVSMSGEGGDAGPAQRVVE
FT                   EIRAAGGQAVANTDSVSTWAGGNAIVQCALDTFGRIDAVVNNAGNLRDRMFFKMNEEEW
FT                   RSVIDVHLHGTFFVSRAAANYFKDQESGAYVNMTSTSGLIGNLGQANYSAAKLGIAALS
FT                   KSIALDMARFNVRSNCIAPFAWSRMTSSIPAETPAEKERVARLQKMEAGKIAPVAVFLA
FT                   SDAAKDVNAQIFAVRANEIMLMSQSRPVRSVHTGEGWTPETVAEIAMPAMRGSFFKLDR
FT                   SPDVINWDPI"
FT   gene            complement(448727..449173)
FT                   /locus_tag="Rmet_3903"
FT   CDS_pept        complement(448727..449173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3903"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3903"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10771"
FT                   /db_xref="GOA:Q1LGF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF5"
FT                   /protein_id="ABF10771.1"
FT                   /translation="MDRELTIDIVCPVMALHVIVMLTITGHLVVLFRSDGPLTMLVTHL
FT                   TPFPHYVHDAVCNSPTQYRYDQYLRATRSVSTQQRLRAPSCNAPIARVRHIASNDCAHS
FT                   KIMSTRPAGSRSSPPHNALTTIAATYRRVFRSTFSALALSNDEC"
FT   gene            449324..451246
FT                   /gene="yeaG"
FT                   /locus_tag="Rmet_3904"
FT   CDS_pept        449324..451246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaG"
FT                   /locus_tag="Rmet_3904"
FT                   /product="putative serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3904"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10772"
FT                   /db_xref="GOA:Q1LGF4"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF4"
FT                   /protein_id="ABF10772.1"
FT                   /translation="MDIFGHYATRFEARKEEEYSIQEYLEICKKDPTAYATAAERMLSA
FT                   IGQPELVDTHHDPRLSRLFFNKVIRVYPAFRDFYGMEDTIEQIVSFFKHAAQGLEERKQ
FT                   ILYLLGPPGGGKSSLAEKLKALMEEIPIYALKGSPIHESPLGLFSADEDGKIMEEDYGI
FT                   PVRYLNTIPSPWAVKRLNEFNGDITKFRVVKLRPSVLAQIAISKTEPGDENNQDISSLV
FT                   GKVDIRKLEDFPQDDPDAYSYSGGLCLANRGLLEFVEMFKAPIKVLHPLLTATQEGNYK
FT                   GTEGFGAIPFDGVILAHSNEAEWTTFKADKNNEAFLDRIYIVKVPYCLRVSDEVKIYDK
FT                   LLRSSSLSAAPCSPNTLKMMAQFAVLTRIKEPENSNIFSKMRVYDGESLKDVDPKAKSY
FT                   QEYRDYAGIDEGMNGLSTRFAFKVLSKVFNFDNTEVAANPVHLLYVLEQQIEREQFPPE
FT                   QEAKLMSYIKEYLTTPYVEFIGKEIQTAYLESYSEYGQNIFDRYVVFADLWIQDQEYRD
FT                   PNTGEILDRNALNDELEKVEKPAGISNPKDFRNEIVNFVLRARANNGGKNPVWTSYEKL
FT                   RMVIEKRMFSTTEDLLPVISFNAKSSREDQDKHENFINRMVEKGYTPKQVRLLVEWYLR
FT                   VRKSS"
FT   gene            451343..452614
FT                   /locus_tag="Rmet_3905"
FT   CDS_pept        451343..452614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3905"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3905"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10773"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF3"
FT                   /protein_id="ABF10773.1"
FT                   /translation="MATVIDRRENGGNKSAVNQQRFIKRYREQIRQAVAKAVSGRKIMD
FT                   IEQSGQVSIPVKDISEPIFHHGQGGRREWIHPGNKKFVRGDSFDRQQQGGGGGGSRASD
FT                   SGEGEDDFVFTLSREDFLNFFFEDMALPDLAKRHLAKIAEVRKVRAGFSIDGTPSNLSI
FT                   LRTMRSSLGRRIALSSPYLKRLRELELEYNDEVEKDPYSEKAEALMERMRHLRAQVDRV
FT                   PFIEKLDLRYNNRVLKKRPQAQAVMFCLMDVSGSMDESRKDLAKRFFMLLYLFLKRNYE
FT                   RIDVVFIRHHTVAKEVDEEDFFHSRESGGTVVSSALKLMVEVIHDRYPPSQWNIYCAQA
FT                   SDGDNWAGDSELCGRLLRESILPLVQYYAYVEVASEEPQNLWEEYLTVKGEFEHFAMQR
FT                   IIGADEIYPVLHDLFQKRAAWPGR"
FT   gene            452652..454190
FT                   /locus_tag="Rmet_3906"
FT   CDS_pept        452652..454190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3906"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3906"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10774"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF2"
FT                   /protein_id="ABF10774.1"
FT                   /translation="MAYLSTGSEWTFELIQRYDREIARIAGDFGLDTYPNQIEIITAEQ
FT                   MLDAYASSGLPVGYNHWSYGKHFLASERGYQRGYMGLAYEIVINSNPCIAYLMEENTMP
FT                   MQALTIAHACYGHNSFFKGNYLFRTWTNADAIIDYLLFAKNYVAECEQRYGEQEVELLL
FT                   DSCHALQNYGVDRYKRPKKLSITEEQARQAERESYLQMQVNDLWRTLPKHRPHALRQEE
FT                   EALELEAIFPPEPQENLLYFIEKNAPKLQPWQREIVRIVRKIAQYFYPQRQTKVMNEGW
FT                   ATFWHYTIIHQLYEEKLVNDAFMLELLQAHTNVIYQPPYHSQYYSGLNPYTLGFLMFQD
FT                   IRRMCENPTEEDRRWAPEIAGSDWRQTLDFAMRNFKDESFLLQFLSPRVIRELKLFSVL
FT                   DDDREGKLRVTAIHDDEGYREIRHLLANQYDLSNMEPNIQVTNVDIGGDRSLTLRHLQN
FT                   DRRPLAQNFDEVVRHVTRLWGFTVRLEVAYEDGRRELKYECKPERRHQPQRRAA"
FT   gene            complement(454212..455390)
FT                   /locus_tag="Rmet_3907"
FT   CDS_pept        complement(454212..455390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3907"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3907"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10775"
FT                   /db_xref="GOA:Q1LGF1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF1"
FT                   /protein_id="ABF10775.1"
FT                   /translation="MGEHPSTDDVFHRLVDCIYESAMDVAAMPAALDLFSRYTGTGSPS
FT                   YLIWDKLAARARLGVTPHGCFTSAGSMPDNMRALPPHLTTTGATRACATMSVDGATAML
FT                   AEPEAAAATSIYDCSGLAQGIRLFDTSDVCVLMSATPASCDAFAHCQQRVAQVMPHWAR
FT                   AARMQHRNFELSGLASLGLASLDTLDFGVMVLQADMRVRYANSWAEALVQADTNLALDN
FT                   GVLRARAESMQSVLAGLLESAVHGGRNGTVAGSWMHITSGGQPVPIIVMPLVSRQPVEG
FT                   PWQLPMAMMLLGNSESRSVLDAGVLTSLFGLSRKESIIAIRLAAGETLTEIAEREFLSP
FT                   HTVRVHIRDTLRKTGTHRQSELVRLLHLLPGVDLERAGVSSTARPRDTRRRH"
FT   gene            complement(455765..458080)
FT                   /locus_tag="Rmet_3908"
FT   CDS_pept        complement(455765..458080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3908"
FT                   /product="putative small-conductance mechanosensitive
FT                   channel transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3908"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10776"
FT                   /db_xref="GOA:Q1LGF0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGF0"
FT                   /protein_id="ABF10776.1"
FT                   /translation="MQRSRLRVPVFTWLVGILMAMFLAGAAQSAGLSLAAMTQKANAQP
FT                   ASAPPASAPLAQSLDQVINTLQNEGERQALVKQLQAVRTGLDASAAGAAGAASAAGASA
FT                   PSPGLIGAVAQAIQEMDNAPHKNSGAMHYWKWRMEFAREELHDALTIKNTRKAIVSWTE
FT                   FGTVFAGWAITGWLLRELARRLRQNRLRRPRDHQLPKIPSWIDVSLYFVRGIGPWIVAF
FT                   GLTVLLAYQVFGRTPASVGAVLVAYAILAGAVMSAVCQVIFTLFQSAHRAHAVRDLITH
FT                   SPILLFITGSLAALGEVNSDPRVIAALGLNLTALISTLSNILAAILIGVFAVRFRRAIG
FT                   QLISFRPFAIRQEYPAMMDLLRLAGDAWYLPVLAVVAASVIGTIMATGHADEFLRRAVI
FT                   TVALFVTATLLTLVVGRSPKATVRAPRLRDRRRSAYVQRFGRFGAALIRVVIWITFLEL
FT                   NARIWQTSLIRIAQSTAAGRHITESLLGVVGVVLLAWLAWLLIDTAITQTLSPTHGRAA
FT                   QPSLRAKTILPLVRNASFVSVLVVAMIAVLANLGVNVTPLLAGAGVVGLAIGFGAQTLV
FT                   QDLITGLFIVVEDTIAIGDSIELPDHVGVVEAMTIRTVRLRDGKGAVHTLPYSQIKAVK
FT                   NLSRGYAFAVFNISIAYQSDFERALELVRETGAEVARDHRYSRNLLSGLDILGLDRFDP
FT                   TGQVVLAQFKTRPLTQYEITRAFNIRLKRNFDANGIRLAVPFVTVQVDGSGTEEEIATA
FT                   AAAGAGADLVTRKAGKPA"
FT   gene            458363..458683
FT                   /locus_tag="Rmet_3909"
FT   CDS_pept        458363..458683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3909"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3909"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10777"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE9"
FT                   /protein_id="ABF10777.1"
FT                   /translation="MTRTIALKLASSLVLSLAALGAAQAGTVPADKYGYEFRTGESAGT
FT                   RVPADKYGYEFRTHDTFTDGARAGKFDAFTDGARKVAGLDKAGVSAEPARSFDPYLDGA
FT                   RA"
FT   gene            complement(458711..458929)
FT                   /locus_tag="Rmet_6632"
FT   CDS_pept        complement(458711..458929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6632"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45232"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY62"
FT                   /protein_id="ADC45232.1"
FT                   /translation="MFEARLRSPFCKPRANLRPDRVDANPRFNRPAWMPREMDVPGFAT
FT                   LLQSGGRCPSRDPRLAAVPTKKALRVT"
FT   gene            458890..459240
FT                   /locus_tag="Rmet_3910"
FT   CDS_pept        458890..459240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3910"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10778"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE8"
FT                   /protein_id="ABF10778.1"
FT                   /translation="MVCRKESADALQTQRPDVKQEIAMFQNTFAQADAVIVHDAAIAAA
FT                   IDAAMLRRRDEYAGQPMAWKVFCEASHVATLCEPLRMAFINRVASERGADIALRLKTKA
FT                   EAIRAAAIAELV"
FT   gene            459280..459906
FT                   /locus_tag="Rmet_3911"
FT   CDS_pept        459280..459906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3911"
FT                   /product="putative amino acid (threonine) efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3911"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10779"
FT                   /db_xref="GOA:Q1LGE7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE7"
FT                   /protein_id="ABF10779.1"
FT                   /translation="MPPFDTLLPFLGIAVLLSLAPGPDNIFVLLLSAMHGTRAGLTVVL
FT                   GLCTGLLVHTAVVAVGLAALLAASTVAFTVLKIAGALYLVYLAWQAFRAPVGELSSSQM
FT                   QVKTGKHMYLRGVIMNLTNPKVVIFFLAFLPQFVSPDRGPVAPQIMVLGFVFILATLLV
FT                   FGSIAWFSGAFGRVLMRSARMQRAVNWFAGSVFLALAGRLALSQR"
FT   gene            complement(459934..460608)
FT                   /locus_tag="Rmet_3912"
FT   CDS_pept        complement(459934..460608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3912"
FT                   /product="putative phosphoglycerate / bisphosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3912"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10780"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE6"
FT                   /protein_id="ABF10780.1"
FT                   /translation="MATLFLVRHGQASFGAANYDCLSDTGRQQSRWLGEYFRDRGVQFR
FT                   RVVAGTLVRQQDTASEILAGMGISDLPVASHPGLNEYDGESLYRSFTKGADHRAHQNGD
FT                   YQDYWRTFRAAFAAWTQDQLTGMPETWGEFGQRMQAALAHATEGASREDALLVVSSGGA
FT                   IGRAVADLLGAPTQTAIELNLQFRNTGFCELIVGRGTQRLLSFNNVPHLELPERRPAIT
FT                   FA"
FT   gene            complement(460795..461793)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3913"
FT   CDS_pept        complement(460795..461793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3913"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3913"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10781"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE5"
FT                   /protein_id="ABF10781.1"
FT                   /translation="MKQTIPPRRRWVMRAACAAVALLPLATFAQGSYPSKPIRMVVPYP
FT                   AGGLTDTVARQLAEGLGKRLGQPVVVENRGGAGGIIGTDFVAKSPADGYTLLMTIPGPI
FT                   TANIALYKKLPYDPRTELRPISDVAMARTVLTVNSAVPVKTVTELIAYAKKEPGKLRMG
FT                   SWGPGTQPHTIQAYMDKTYGVDILHVPYRGEGPMVTDLLAGQVNLTIGSVTTLRQYIAV
FT                   GKLRPLAVAGTTRAKALPDVPTFTEAGYSDAAYKIVGPTTLLAPAKTPDAIIERLGREV
FT                   SALVKSPELSAKIDELGAEPIGNTPAEAERAYKAYLPVVLKLTADTGVTLD"
FT   gene            complement(461908..462612)
FT                   /locus_tag="Rmet_3914"
FT   CDS_pept        complement(461908..462612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3914"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3914"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10782"
FT                   /db_xref="GOA:Q1LGE4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE4"
FT                   /protein_id="ABF10782.1"
FT                   /translation="MRIRIRKSAMQSPITSAPSTSSPFPRVDTTSILQPPRQRRARETE
FT                   QALLAAGRKLLAERDFAAVSVAQIAAACQVSVGAFYGRFRDKMAFFDALRTLVMEESDA
FT                   SVARYMAEHRWGEVPARQIVEKTMRFLVNGCHNNRGVIRASLKHSSTRPEEWLPHQKNG
FT                   EEIVERLVALLTPRLPGPAEANEVRVRFAMQMVFGMLVNAVLNNPGPLRLDDERLSGEM
FT                   TRMVACYLGLES"
FT   gene            462744..463556
FT                   /locus_tag="Rmet_3915"
FT   CDS_pept        462744..463556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3915"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3915"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10783"
FT                   /db_xref="GOA:Q1LGE3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE3"
FT                   /protein_id="ABF10783.1"
FT                   /translation="MQMNTPVEQFIAERRREDPSFGGLLAKGFALLRCFIDDPRPLGNG
FT                   ELAQRLQLPRATVSRICRTLFELGYLDWEPKLDKYFVSAQVLALGYPYMAGLQVRHLAR
FT                   PLMQALANQIEGAVSMGVAYRLDVTYLESCTHMEGTPARPAIGAVRSVLTSAMGRAYLC
FT                   TLSKTEFEKLMTTARAERPDEYAACYETLCHCIAHYPKRGFTLNEGDAGADVHGVGVYS
FT                   RVVYMNRPLLFNCAIPGMRVKRGSMEKRVAPLLREMVRSIENMAGVGR"
FT   gene            463639..465750
FT                   /locus_tag="Rmet_3916"
FT   CDS_pept        463639..465750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3916"
FT                   /product="putative acetyl-CoA synthetase"
FT                   /EC_number="6.2.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3916"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10784"
FT                   /db_xref="GOA:Q1LGE2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE2"
FT                   /protein_id="ABF10784.1"
FT                   /translation="MQDLQPLLRPRSIAVIGASTQPEKVGGMPIRLLGELGYAGRVFPV
FT                   NPGADTVQGLRAFPTVEAIGEPVDLAIVAVPALAAPDVMAQLGRAGTRAAVVFTSGFAE
FT                   VANGSGLQHALATQAKTHGVQLLGPNCLGAMNLGERMFATFSPIPLTGVPPVGGVGLVS
FT                   QSGAFGAYAFALAREAGLGLSHWVTTGNEAGLQVADVIEWLAHDPQTQVILAYIEGARD
FT                   GMRLRQALAAARAAGKPVVIAKVGTTVAGASAAQSHTASLAGEDAVYQAVFDEYGVHRA
FT                   HTLEAFFRLGYTLARGRRPARWHSPTGMAADAVAPVAIVTVSGGVGIMMADSAESQGLP
FT                   RPPMPDAAAAALREAVPFASTSNPIDVTGQVVAQPKVLADALAGVARSGAYGSVAAFLA
FT                   GGGNAPRVWSLLEQTVDDLASDPQAAPLMIAGVISDEKRAWLEARGCLVFREPAHTIEA
FT                   VAALAKAAAMTESAQSPVAPAQLLSVPELPADAKALSEADAMALLLQAGVPVAPHGLAR
FT                   DADEAVRVAESIGYPVVVKLCSPDILHKSDVGGVVLNLSDADAVRAAFERVRRAAGTAR
FT                   FDGALVARMVRGWGEIMVGVRRDPVFGLVALAGIGGTAVEIFRQMSFGLAPVSRERARA
FT                   MLTQSRAAALCAGHRGHPPLDLDAVADVIVNVSRAADAIGDRLDTLEINPFIVSADGLV
FT                   AADAVITLR"
FT   gene            465793..466779
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3917"
FT   CDS_pept        465793..466779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3917"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3917"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10785"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE1"
FT                   /protein_id="ABF10785.1"
FT                   /translation="MRSKLRRALLGMTLVLAGVCMTTGAVNAARVYPDRPIRLVVPFPA
FT                   GGGTDVIGRMLAARLSNTLKTTVVVDNVVGATGTIGTAQVARAAPDGYTLVLGISATHA
FT                   IAPSIFPKLPYDPLRDFVPIGRIAIGGNVLVANPSFPAHDLRALIAMAKQPNADLTYGS
FT                   WGQGSGGHLAGESLNVSAGIHLRHIPYKGVAPMLTDVMGGTLPVAMSDLAGTLPLIRSG
FT                   KVRALAVSGSERSVALPDVPTFAESGVRFRLDSWFALFAPSRTPAPIVEQLDRAMQEAM
FT                   QDSGLQAQIASLGMRYAPVSRAQFTNQMREDTRTWAALVKSSGAALE"
FT   gene            466807..468120
FT                   /locus_tag="Rmet_3918"
FT   CDS_pept        466807..468120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3918"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3918"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10786"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGE0"
FT                   /protein_id="ABF10786.1"
FT                   /translation="MNHPASPMFPAPVHTSPQEAMVAAAALPLVIYGYPLIETLRTCRL
FT                   QTSVDAPTRYGRAPMNMLSASARQWTHEDRDIVTPANDLLYFCGWLNLADGPATIRVPA
FT                   LPDADRYYVIELLDAHTNNFANLGPRNVPKEGADIEIVGPGQRGSGGQTVESPTSLVWI
FT                   IGRVLVTGADDLARAYAFEQGFQMVKSAGPAQPPSVAQWQESDDEAVDFFQNLYRAMRD
FT                   FPPTQQELGLFTLLRKVGLRLEDDPDIGSMRPSIVNGLRSAYAQAMALIEAHTRSQGHK
FT                   AWGYSLRLGTYGDDWLLRACTAMKGLGALRADEAVYAMADFDADGERLHGNQAYELRFP
FT                   PGMLPPADAFWSVSLYGEDRFFTANELGRYAVGDRTPGLRKEPDGTLVIPIGHARPAED
FT                   ANWLPAPSSHFYLILRLYHPSEAFRAGQYTIPAVRRVG"
FT   gene            468160..469476
FT                   /locus_tag="Rmet_3919"
FT   CDS_pept        468160..469476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3919"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3919"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10787"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD9"
FT                   /protein_id="ABF10787.1"
FT                   /translation="MTQQENTAQQRARDAVIHTLPLYEMARMRAATCPRRDHTGRFAGD
FT                   GPESTLRWVNHVIRPRQLLGPQHRQVVTPNNDTLYTNAWIDLSRGPVVLEVPDFNGRYY
FT                   VLGLLDFYTNPFGYIGSRTTGTSAGRFLLHGPDWLGTVPAGMRAVACPTNAVWMIGRLL
FT                   VDGEADLPVVHALQDAIALRQLDGSLAAFAFDVAMQPEEHLGDARRFAEVVNRVVGENP
FT                   PLGAEAAEIAAFAEVGIGHGIVPTPQQIDLLDAALRGVLADLAEPQPSDMGGGWAMSVD
FT                   VRESFGSNYLQRALVARNYIGALGVQEAMYVMADRGGDGEPLDGRHAYRLDFAADNLPD
FT                   VGAFWSLTMYDKGDCMLVPNDISRYSLGDRSPSLTRGADGSLSLYLSATPPRDEALRGN
FT                   WLPAPPGPFYVALRLYVPQPSHLNRTYRYPAIQLLEVPA"
FT   gene            469473..470450
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3920"
FT   CDS_pept        469473..470450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3920"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3920"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10788"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD8"
FT                   /protein_id="ABF10788.1"
FT                   /translation="MNPSQLTRRRLLGAMALAGLVPPAFGNAYPSKAVRFVSPYGPGGS
FT                   NDTSARILAEVLSRKYGQQVVVENKPGAGTRVASESVAHAAADGYTLLWAAAPFAINTG
FT                   AGLSQRFDIHKDFVAVGPRVLGPLFLIVNANSSVKTVADFVKLAKQKPDGVNFASPGIG
FT                   SGPHLTAELFAWQAGFKVVNVHYRGDATAYTELLAGRVDATLTAITTALPFIQAGKLRV
FT                   IAVAAEQRTPVYQDAPTFAEQGVPGVVGYGWFGIVAPAGTPAPIVRQLNQDASQALSDA
FT                   QVRQKLLALGLQPEPGSSADFAAFIDSEVKKWGTLVRTRGLVLE"
FT   gene            complement(470504..470932)
FT                   /locus_tag="Rmet_3921"
FT   CDS_pept        complement(470504..470932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3921"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3921"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD7"
FT                   /protein_id="ABF10789.1"
FT                   /translation="MPAPPRRSPGRTGMIAAAAIALTTACANLEAGTMQRIFESWKGAP
FT                   VEQAKAQWGPPQTVQAAPDGTAYVWTDEMPTAHPPGSGPRDAQLEPPPTVAYCQRKLIA
FT                   GADGKISRGEWSGSACCAQTLIGQCAGLARKPSATSNS"
FT   gene            complement(471045..472637)
FT                   /gene="ydjQ"
FT                   /locus_tag="Rmet_3922"
FT   CDS_pept        complement(471045..472637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjQ"
FT                   /locus_tag="Rmet_3922"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="3.1.25.-"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3922"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10790"
FT                   /db_xref="GOA:Q1LGD6"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD6"
FT                   /protein_id="ABF10790.1"
FT                   /translation="MTLQEPPTYLPEKLTSREPGMLDAQALAAALARPIVFVDLETTGA
FT                   DAQRDRITEIGVVEVGPDGIQEWDTLVDPLTSIPPFVQGLTGITDEMVRGQPTFALIAE
FT                   ALAEKLQGRLFVAHNARFDYGFLKNEFRRAGVTFRADVLCTLRLSRSLFPSVERHGLDA
FT                   LIARFGLTPKGRHRALADAELLWQFWQKIHEIYSVDLVESAVTSLVKHASLPAGLEEAA
FT                   LDDVPDRPGVYLFYGDDDVPLYVGKSIHLRQRIRAHFAGDHSNAREMRLSRSVRRVEWR
FT                   ETGGEIGALLSEAHLVKTLRPLHNHLLRQNTELFSWEMLDGLPAPRLRSDRHVDFSRHA
FT                   ALYGAFPSRASAQARLRSLADEHRLCLATLMLEGTTRRGSPCFARQLHRCAGACTGEES
FT                   QTAHRERTVEAMASMAIQRWPFAGAIAWREASGDRFPWHIIEDWCYLGSAPTLEDAARQ
FT                   LVAPARFDIDTYQILAPRIEELKASAVPLLSTREFVLTPPVLPEPRAARVPRTAGKRTA
FT                   NASEHSQTPGLFS"
FT   gene            complement(473016..473081)
FT                   /locus_tag="Rmet_6633"
FT   CDS_pept        complement(473016..473081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6633"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45233"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY21"
FT                   /protein_id="ADC45233.1"
FT                   /translation="MTGQAPKNPTNMFYCASTDNF"
FT   gene            473145..474671
FT                   /locus_tag="Rmet_R0075"
FT   rRNA            473145..474671
FT                   /locus_tag="Rmet_R0075"
FT                   /product="16S ribosomal RNA"
FT   gene            474736..474812
FT                   /locus_tag="Rmet_R0076"
FT   tRNA            474736..474812
FT                   /locus_tag="Rmet_R0076"
FT                   /product="tRNA-Ile"
FT   gene            474824..474899
FT                   /locus_tag="Rmet_R0077"
FT   tRNA            474824..474899
FT                   /locus_tag="Rmet_R0077"
FT                   /product="tRNA-Ala"
FT   gene            475182..477999
FT                   /locus_tag="Rmet_R0078"
FT   rRNA            475182..477999
FT                   /locus_tag="Rmet_R0078"
FT                   /product="23S ribosomal RNA"
FT   gene            478179..478292
FT                   /locus_tag="Rmet_R0079"
FT   rRNA            478179..478292
FT                   /locus_tag="Rmet_R0079"
FT                   /product="5S ribosomal RNA"
FT   gene            478647..479051
FT                   /locus_tag="Rmet_6634"
FT   CDS_pept        478647..479051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6634"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45234"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY64"
FT                   /protein_id="ADC45234.1"
FT                   /translation="MLIELIQRHAAQMLHCRSGVTKGSEEDLVSAQSVLGDTRPASVTV
FT                   EVIASNLWDPISGLGLLLRSARRCSLRFGHELARMTVTAITEDCARQSEYGERGGHLSH
FT                   PASRTRARPALCISRPAIWRKQGRMAMTVR"
FT   gene            479175..480338
FT                   /gene="acrA"
FT                   /locus_tag="Rmet_3923"
FT   CDS_pept        479175..480338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="Rmet_3923"
FT                   /product="multidrug efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3923"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10791"
FT                   /db_xref="GOA:Q1LGD5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD5"
FT                   /protein_id="ABF10791.1"
FT                   /translation="MQAMRARRALIPGILAVAVTVLSACGKDNKPPAAQTPEVKVVTLK
FT                   DENVTLDSSLPGRTMPYRIAEVRPQVNGILQKRLFVEGSDVKQGQQLYQIDPSTYEATA
FT                   KSAEANLESARLLAERYGKLVGEEAVSKQQYAEAQASYLQAKAAVDQAHINLRYTKVLS
FT                   PISGRISRSLVTEGALVTNGQANALATIQQLDPIYVDVTQPSSAILRLRRELANGQLQG
FT                   AGANAAKVTLQLEDGSIYSEPGRLEFSEVAVDQGTGSVTLRAVFPNPRNELLPGMFVHA
FT                   RLAEGVKTAAILAPQRGVTRDLKGQATSLVVNANNEVEQRILSTDRTVGDKWLVTAGLK
FT                   AGDRVIVEGLQFVRPGVKVKAAEADAATAGPVEASAPSAASAPAAKS"
FT   gene            480365..483511
FT                   /gene="acrB"
FT                   /locus_tag="Rmet_3924"
FT   CDS_pept        480365..483511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="Rmet_3924"
FT                   /product="multidrug efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3924"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10792"
FT                   /db_xref="GOA:Q1LGD4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD4"
FT                   /protein_id="ABF10792.1"
FT                   /translation="MSNFFIERPIFAWVIALVIMLAGVLSIRTLPINQYPAIAPPTIAI
FT                   SVTYPGASAQTVQDTVVQVIEQQLNGLDRLRYISSESNSDGSMTITVTFEQGTNPDIAQ
FT                   VQVQNKLALATPLLPQEVQQQGIRVTKSVRNFLLIVGLISTDPNMTREDLSNYIVSNIQ
FT                   DPLSRTAGVGDFQVFGSQYAMRIWLDPAKLNSYQLAPLDVSNAIKAQNVQVASGQLGGL
FT                   PAVRGQQLNATVIGKTRLQTAEQFGDILLKVNPDGSQVRLKDVADVALGGQDYTINAQY
FT                   NGRPASGIAIRLASGANALETVKNIHNTLAQLEPTFPPGIKVVFPYDTTPVISDSIHEV
FT                   IKTLLEAIVLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGYSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEDGLGPKEAARKSMGQIQGALVGIALVLSAVFLPMAF
FT                   FGGSTGVIYRQFSITIVSAMVLSVLVALVLTPALCATMLQPIEKGDHGEHKQGFFGWFN
FT                   RSFIRSTQSYERGVSGILKRRAPFLLIYLAIVVVMGFLFTRIPTSFLPEEDQGVLYAQV
FT                   QTPAGSSAERTQAVLDQMRNYLLNDEGKIVESLFTVNGFNFAGRGQSSGLAFILLKPFK
FT                   DREGDATSVFDLTKRAQAKFSTFRDSLAFAFAPPAVQELGNATGFDFYMQDQAGLGHDA
FT                   LMNARNKFLSLAAKNPALQRVRPNGLNDEPQYVLEIDDERARALGLSLADINSTVSIAW
FT                   GSSYVNDFIDRGRVKRVYLQGRPNSRMSPEDLNKWFVRNDKGDMVPFSSFATGKWGFGS
FT                   PKLQRYNGVPAVEILGEPAAGKSSGEAMAAVEEIMKQMPAGISYSWTGLSYEERLSGSQ
FT                   APALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLATLARGLSNDVFFQVGL
FT                   LTTVGLSAKNAILIVEFAKELHDHGKGLVEAAVEACRMRLRPIIMTSMAFMLGVFPLAV
FT                   SQGAGAGSQHAIGTGVIGGMITATVLAIFWVPLFFVVVSALKERRGKSDSSSLEKGAQA
FT                   "
FT   gene            483508..485007
FT                   /locus_tag="Rmet_3925"
FT   CDS_pept        483508..485007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3925"
FT                   /product="multidrug efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3925"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10793"
FT                   /db_xref="GOA:Q1LGD3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD3"
FT                   /protein_id="ABF10793.1"
FT                   /translation="MRKTLLCLAAVAALSGCSLIPNYQRPAAPVDATFPQGEAYPKTAA
FT                   VDASVTAVDLGWRDYFTDPRLRELIQVSLDNNRDLRVAVLNVEAYRAQYRIQRADLFPQ
FT                   VDAAAQGTRQRVPADLSATGQRVISSQYGVSLGTTAWELDLFGRLRSLSEAAFEQYLAG
FT                   DEARRSTQIALVASVANAYLTLRADEEQLKVTRDTLTTYERTYNLTRRRFEEGIASRLE
FT                   LRQSETQVETARASLAAYTRALAQDTNALTLLVGSGMPADLPQGLGLEEKLVAEVPVGL
FT                   PSDLLQNRPDILSAEHRLKAANADIGAARAAFFPRITLTASAGTASRQLSDLFAAGQGT
FT                   WLFSPQIVLPIFTAGSLQASLDYAKIQKDINVAAYERTIQGAFREVADGLAARGTFSDQ
FT                   VQAQVRLVRASQDYFTLAEHRYSTGVDSYLTLLDAQRQLYNAQQTLITDRLNQLTSEVN
FT                   LYKALGGGWTDVTHRPENGAPADGAGSSTTGSTGGGAGSAS"
FT   gene            complement(485101..486009)
FT                   /locus_tag="Rmet_3926"
FT   CDS_pept        complement(485101..486009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3926"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3926"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10794"
FT                   /db_xref="GOA:Q1LGD2"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD2"
FT                   /protein_id="ABF10794.1"
FT                   /translation="MKPVTLIGAPTDVGASIRGASMGPEALRVADIAGALVRNGLDVTD
FT                   LGNLVGPGNPNLPPTDGVRHLPEVVAWNRLVMDATYQALATGQLPLLMGGDHCLAIGSV
FT                   NAAARYCREQGKKLLVLWLDAHADANTGSTSPTGNTHGMPVACLCGDGPAPLVSLGGVT
FT                   PATSPRNIRQIGIRSVDAEEKKRLRELGLTVYDMRYIDENGMRATMEQALAGIDGDTHL
FT                   HVSFDVDFLDSQIAPGVGTAVRGGPTYREAHLALEMIEDTGALGSIDVVELNPARDVHN
FT                   QTAELVVELLESLFGKSTLLR"
FT   gene            complement(486107..487096)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3927"
FT   CDS_pept        complement(486107..487096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3927"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3927"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10795"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGD1"
FT                   /protein_id="ABF10795.1"
FT                   /translation="MSQFDSSRRRVLGATGALAAAAMLPSLSRAQTWPSKTIRFVVPFA
FT                   PGGSSEIIARSVAAELTSQLGVSVFVENKPGGAGNVAMGEVARADDQHTIILGHIGTLA
FT                   VNPFIFPKLPYDVNKDFTPVSLLAKVPSLYVVHPDVPAKNLKEFVALAKSKPGKLNYGS
FT                   AGNGSAGHLAFEYLKEAAGIFVLHVPYRGSGPQITDLLSGRLEAAAVGAPAILPFIKSG
FT                   KLRCIATGSAQRIPQLPDVPTVAEQGYPGFEMTQWYGILAPSSMSKAAVDKLAAASAKS
FT                   VRSPAASSRMTADAAIVVGDTPAEFASFIAQEQKRWKPIIARASIKPD"
FT   gene            complement(487178..487414)
FT                   /pseudo
FT                   /locus_tag="Rmet_3928"
FT   CDS_pept        complement(487178..487414)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3928"
FT                   /note="hypothetical protein"
FT   mobile_element  487267..490783
FT                   /mobile_element_type="transposon:Tn6049"
FT   gene            complement(487454..487669)
FT                   /gene="tnmC"
FT                   /locus_tag="Rmet_3929"
FT   CDS_pept        complement(487454..487669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnmC"
FT                   /locus_tag="Rmet_3929"
FT                   /product="conserved hypothetical protein Tn6049"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3929"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10797"
FT                   /db_xref="GOA:Q58AJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q58AJ2"
FT                   /protein_id="ABF10797.1"
FT                   /translation="MTFHQPSGIAQGLPLLIDANWTPAQAWAVIELLDDLRDRLHAHYQ
FT                   LALAQWLAEDRQEHPDGLGDLADNDF"
FT   gene            complement(487723..488556)
FT                   /gene="gspA"
FT                   /locus_tag="Rmet_3930"
FT   CDS_pept        complement(487723..488556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspA"
FT                   /locus_tag="Rmet_3930"
FT                   /product="ATPase (type II general secretion pathway)
FT                   Tn6049"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3930"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10798"
FT                   /db_xref="GOA:Q5NUU5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NUU5"
FT                   /protein_id="ABF10798.1"
FT                   /translation="MNQPNLLALYGLKFNPFAQDIPVEAVFVPPKLDHFCWRIENGMAR
FT                   EGGFAMVHGDPGCGKSVTLRLLHQRLMRVPDLMVGSIAHPQSNLADFYRELSDIFTVPL
FT                   KPHNRWGGFKALRERWLTHMEASRRRCVLLIDEAQEMAVPALSELRLLAQARFDSQLLL
FT                   CVVLAGDARLPEKFSREDLIPLGSRIRCRLALESASIDELQACLDHLLAAAGNATLMTM
FT                   PLRQTLCEHAAGNYRILMNLAGELLAQAAQRELPQIDEKLYLETYSATLNRRARR"
FT   gene            complement(488553..489992)
FT                   /gene="tnmA"
FT                   /locus_tag="Rmet_3931"
FT   CDS_pept        complement(488553..489992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnmA"
FT                   /locus_tag="Rmet_3931"
FT                   /product="transposase Tn6049"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3931"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10799"
FT                   /db_xref="GOA:Q5NUU4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NUU4"
FT                   /protein_id="ABF10799.1"
FT                   /translation="MSLSIDHRNRWARLRFSVIGPLLASPPAKGELQQAFQALAAKVWR
FT                   HPITGADVQFGASSIERWYYRARHVQDPVDQLKNRLRDDCGHFVSLSPAIIEALVEQYR
FT                   QHPGWTMQLHYDNLRVATKDGPDTLPSYTTVCRYLKAQGLVRKPTPRSSTDGAIAAAAR
FT                   REAREVRSYEVDHVAALWHLDFHHGSRKVLTPDGQWHKPLLLCIMDDHSRLVCHLQWFL
FT                   DETTASLVHGVSQAIMKRGLPRAIMTDNGAAMMADEFVEGLASLGILHQTTLPYSPYQN
FT                   AKQERFWGQLESRLMAMLEGESHLTLEQLNLATQAWVEQEYHHKEHAELEATPLQRYLS
FT                   CADVSRPSPEALALRRAFRIRQHRRQRRTDGTFTLDGVRFEIPGAYRHLEQVCLSYARW
FT                   DLSQVDLIDARIGAILAAVFPLDKSANADARRAHLTAKGASPANEEPAQAGTAPLLRQL
FT                   LAEHAATGLPPAYLPPAPTKL"
FT   gene            complement(490104..490673)
FT                   /gene="tnmB"
FT                   /locus_tag="Rmet_3932"
FT   CDS_pept        complement(490104..490673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnmB"
FT                   /locus_tag="Rmet_3932"
FT                   /product="protein involved in mobility of Tn6049"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3932"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10800"
FT                   /db_xref="UniProtKB/TrEMBL:Q1L9I3"
FT                   /protein_id="ABF10800.1"
FT                   /translation="MSPLLCRAMKETSAVCHALLQTPAFFALLRRIDEDLMKVARDRGC
FT                   CHCGSVLHSANYPRKPRGCPPAAHPDCNTRLSLCCAGCRKRMTPDSVRFLGRRVWLAIV
FT                   LVLRSSRATGACLDGLPAISWATLKRWRQWWTETFPKTPVGRWLRGLIPPTPEPFIYPD
FT                   CLLQSVEHDSEDERLAAVLLLLLGPA"
FT   gene            complement(490740..491675)
FT                   /gene="tctC"
FT                   /locus_tag="Rmet_3933"
FT   CDS_pept        complement(490740..491675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tctC"
FT                   /locus_tag="Rmet_3933"
FT                   /product="extra-cytoplasmic solute receptor protein
FT                   involved in tricarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3933"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10801"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGC5"
FT                   /protein_id="ABF10801.1"
FT                   /translation="MRTLYLFALLLIGGVQTAHAAQAEMPQPRCIAPARPGGGYDLTCR
FT                   IAKLGLDEARALPARLQIDYRPGGIGAVMFDAVVEQSPDDANTIVAFSSGALLNLASGK
FT                   FSKYGPDSVKWLVAIGVDHGMIAVDARSPYLTLKDLVTAMKADPRKVLFGIGGSAGSQD
FT                   WMKATLLARQAGLDRNAMRYVAFEGGGEAMTALMTGHVQAVPGDIGEAVDLIETHRIRV
FT                   LAVLSDQRLPGRFASIPTAKEQGLDVQWPIVRGFYMGPKVAEHDLRRWGNALQRAAGTR
FT                   AYVQALETHGIVPTPMLCISSFRDAESVGI"
FT   gene            491819..492490
FT                   /locus_tag="Rmet_3934"
FT   CDS_pept        491819..492490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3934"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3934"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10802"
FT                   /db_xref="GOA:Q1LGC4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGC4"
FT                   /protein_id="ABF10802.1"
FT                   /translation="MRLLLVEDHPDLAALVIKSLGDSGFVIDHAVDGEAALLMIATASY
FT                   DLILLDLSLGKVDGLDVLRSIRTQGVTTPVLILTARSEIADRILGLDLGADDYIAKPFD
FT                   LGELEARIKAQLRRRQGGQPVTTYGGLSFDSVERSFYCEGTALTLSRRELAVLEALFLR
FT                   AGRVATRDVLFQCVFSIDDEVNPETIELYVSRVRKKLKPSGLVITAVRGVGYLLEQRQD
FT                   G"
FT   gene            492483..493910
FT                   /locus_tag="Rmet_3935"
FT   CDS_pept        492483..493910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3935"
FT                   /product="sensor protein in two-component regulatory
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3935"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10803"
FT                   /db_xref="GOA:Q1LGC3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGC3"
FT                   /protein_id="ABF10803.1"
FT                   /translation="MARQPSATSLRRTLLWRLALALLTVGIVSAFASYRTALKEANQAH
FT                   DRTLLASTRSIAERIHVTNGRVTVNVPYGALDTFQIDARGRIFYRVLDPAGHFVSGEKD
FT                   FPAMPANVPRSEDYPALVHFYDDAYAGTPLRVAALWQPVTEGGQQGVALVQVGESLEMR
FT                   DDMARRLLFTMLWQQAAMIGVSMTLLALTVAATLRPLKRLQDRIQARRASDLAPVEGDD
FT                   LPREIQPLLQTLNQYLERLRVIVENQKRFLDDAAHQLRTSLTLVRGHVDQRIRASDHGG
FT                   DLAEVKAAIDRTVRLTNQLLTLARTGDGDVLAPDGDAMQRIELGNLCRDICAEWYLHAR
FT                   ERRQDLSVGECPAGAWVVGNEAMLREMLANLLHNAVSYTPAGGSISVTVERSDSTLCIL
FT                   VDDSGPGIPSADRERVFERFVRIAGTLGAGSGLGLAIVRQICEAHQGSVQLESGDKGGL
FT                   RVRVTLPAAPAAPPAVA"
FT   gene            494024..495670
FT                   /locus_tag="Rmet_3936"
FT   CDS_pept        494024..495670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3936"
FT                   /product="putative drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3936"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10804"
FT                   /db_xref="GOA:Q1LGC2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGC2"
FT                   /protein_id="ABF10804.1"
FT                   /translation="MTSEFRPEQDVSPGRAVAGSPANQSVRKGQVLPFRESLLAMTGIA
FT                   FVVMLVALDQTVVSTALPTVVAELQGFEFYAWVATAYLLTSVITVPIFGRLGDYYGRKP
FT                   FVLASIVVFVAASALCGMATNMPFLVAARALQGIGGGMLVGTAFACVPDLFPDPHVRLR
FT                   WQVMMSTAFGLANAIGPSLGGVLTEWFGWRAVFYINLPVGLLGLLIAWRFLPHLRHQSH
FT                   TEPIRIDWAGAALIAAGLGSLQLSVEWLPERGLGVVTIGLMVFSIAAFVALWHWSRKSA
FT                   NPILPFDMFRNPSLASLFVLSVLAGFTMFGLLLYAPLLFQGGFGYSPKEAGLLVTPLVV
FT                   CITIGSIVNGRIITRIPRPNAMLYAGFTMLALALLGLSQATRGMHHNLLLSIMLLAGLG
FT                   LGFVLPNLTVFAQQTAGRAHLGIATAMLQSLRMVGGMVGTALVGTLVTRSYTSGVTSAL
FT                   AAANATDWTARMTDPQILIDKAAQAELLTNLQQAGHNGALLLEQARVSLVGAIHLGLLL
FT                   AAIAALFGVWRARRVPPIKLMRVNEPVMAAD"
FT   gene            495718..496179
FT                   /locus_tag="Rmet_3937"
FT   CDS_pept        495718..496179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3937"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3937"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10805"
FT                   /db_xref="GOA:Q1LGC1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGC1"
FT                   /protein_id="ABF10805.1"
FT                   /translation="MELERQSLAVLQQFGRTYRAYAAAFEQRIGHPLPRWRILFALYGH
FT                   EGPIAQKPLADRVGMDPGALTRQLKTLQEMGWVDRMTSERDNRMTNVTLSALGREIVDQ
FT                   AMPRRSAFLQDVLANVTETTMHNLSKGLVQLEAGIADAVARTQAERDAA"
FT   gene            complement(496205..497626)
FT                   /gene="cobB"
FT                   /locus_tag="Rmet_3938"
FT   CDS_pept        complement(496205..497626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="Rmet_3938"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /EC_number="6.3.5.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3938"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10806"
FT                   /db_xref="GOA:Q1LGC0"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGC0"
FT                   /protein_id="ABF10806.1"
FT                   /translation="MSARYNPSHRMALPPCIATSEMPPLPIQSSPLGTTTRTGTRPVPA
FT                   LLVAAPASGQGKTTVTAALARLHARQGRTVRVFKIGPDFLDPTLLAAASGAPVQSIDLW
FT                   MTGEVDARQRLALAAQTADLILVEGVMGLHDGTPSSADVARCFRLPVLAVIQAGAMAQT
FT                   FGAVAHGLATYGEPFHAMHVLANGVGSARHAEMLRDSLPHDIHWAGALARDDAAALPER
FT                   HLGLFSADELPDLTARLDRMADALAALPLSHLPEPIVFPDTPTQQLPRLLEGRRIAIAR
FT                   DDAFRFIYPANVETLNALGAHITWFSPLRDAALPHCDALWLPGGYPELHAAALAANVPM
FT                   HNAIRAAHAHGLPMLAECGGMMALFDNLVDKEGQTHRMAGLLPGTVTMQKRLAAIGHQA
FT                   IELPTREGMVGQPVRGHTFHYSTTDTPLTPLLHARSPRDDGTGEAVYRSGSLTASYVHL
FT                   YFPSNPTAIAALFGG"
FT   gene            complement(497635..498537)
FT                   /locus_tag="Rmet_3939"
FT   CDS_pept        complement(497635..498537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3939"
FT                   /product="two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3939"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10807"
FT                   /db_xref="GOA:Q1LGB9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGB9"
FT                   /protein_id="ABF10807.1"
FT                   /translation="MSPTQGNAIRFLRILLLPSRDPGINLAVHRGALRVVSRLIRGSAC
FT                   AQLLRVRAVRHSRVRRFFDASVQPYPTHMFRSHWMTLRILLADDHPVITAAIRARVQSS
FT                   QTGWEVCGEATSATELQQQVDLLQPDVVVTDYHMPGPTELDGVRLITSLRRRHPSISVV
FT                   VLTMITNPLVLRTILDVRVHGLLIKDSPLAEIMTAIGRAQRGFTYIGKSALRALAPTEL
FT                   RTMLPCGRDGEQRPSAREMEVLRLYLTGRTVTEIATTLCRSVKTISRQKNCAMQKLGVT
FT                   NDRELFECVALQGMVLPRR"
FT   gene            complement(498603..499556)
FT                   /locus_tag="Rmet_3940"
FT   CDS_pept        complement(498603..499556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3940"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3940"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10808"
FT                   /db_xref="GOA:Q1LGB8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGB8"
FT                   /protein_id="ABF10808.1"
FT                   /translation="MRHVSTKLLHVFVLLMEYRDLNAVAACTQGRVPTVAYSLARLREI
FT                   TGDALFVKRNGALEPTPHALRLEQTARQILAKWNQLVQPSGEHAAQATRGRRISIGFSS
FT                   SIGDPVITEILTALGERFPQDSFITRPVIADAALADSLDSGDLDCAFVVDGANVPDSVI
FT                   PHSIMATPRRLISVTRTGSMDEVESDWILLQEDCDAASPLRGFLERQALAPGHRETVVP
FT                   SWHTQITLLHAAGGICPVLDFNVPLVTRDRKARLLAPPSSFPAWAALHFWMPQESDDRN
FT                   TLRDIMDVGASVLRDPLKAIDGRRQARQPARPLAVA"
FT   gene            complement(500136..500309)
FT                   /locus_tag="Rmet_6635"
FT   CDS_pept        complement(500136..500309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6635"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45235"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY65"
FT                   /protein_id="ADC45235.1"
FT                   /translation="MSSRHELSKLNNASTGLSGYTHNYSAQSVHSHLQFKFCYSNLEKF
FT                   LPLPFSTASPEC"
FT   gene            500242..500538
FT                   /pseudo
FT                   /locus_tag="Rmet_3941"
FT   CDS_pept        500242..500538
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3941"
FT                   /note="Transposase IS3/IS911 (fragment)"
FT   gene            complement(500535..501428)
FT                   /gene="tnpB"
FT                   /locus_tag="Rmet_3942"
FT   CDS_pept        complement(500535..501428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpB"
FT                   /locus_tag="Rmet_3942"
FT                   /product="transposase catalytic site ISRme3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3942"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10810"
FT                   /db_xref="GOA:Q1LA93"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LA93"
FT                   /protein_id="ABF10810.1"
FT                   /translation="MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRG
FT                   RLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRK
FT                   YIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVV
FT                   GWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMS
FT                   RRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSP
FT                   MTFEKNWSAAQQHRAA"
FT   gene            complement(501425..501721)
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_3943"
FT   CDS_pept        complement(501425..501721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_3943"
FT                   /product="transposase DNA binding site ISRme3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3943"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10811"
FT                   /db_xref="GOA:Q58AB8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q58AB8"
FT                   /protein_id="ABF10811.1"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
FT   gene            501783..502013
FT                   /pseudo
FT                   /locus_tag="Rmet_3944"
FT   CDS_pept        501783..502013
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3944"
FT                   /note="Transposase IS3/IS911 (fragment)"
FT   gene            502136..502453
FT                   /locus_tag="Rmet_3945"
FT   CDS_pept        502136..502453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3945"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3945"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10813"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGB3"
FT                   /protein_id="ABF10813.1"
FT                   /translation="MSVAQVHAAPPQDPGTPIVAPLPPRMLDPATSTVEDTGGTLSASQ
FT                   VERCRQLLDQINALPSGPQWGQGKSSVTTADGRTYSTLERAPDRKRLEEAYRQECAQSR
FT                   K"
FT   gene            502545..503957
FT                   /locus_tag="Rmet_3946"
FT   CDS_pept        502545..503957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3946"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3946"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10814"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGB2"
FT                   /protein_id="ABF10814.1"
FT                   /translation="MFHLRRFLAWSFGLMLLAGASSALAQAKLDKPQLDQLLAPVALYP
FT                   DALLSQVLMASTYPADVASAAEWSKSNQSLSGDAATKAVEGEPWDPSVKSLTAFPSVMD
FT                   MMGRQPQWVESVGDAFLAQPDDVMDSVQRLRVQAQKAGTLKSNEQQKVVTQQSGGTTIV
FT                   QIEPASPQVVYVPSYNPTVVYGAWPYPAYPPAYYPPPPGSVFATSLVAGIGFGLGVAAV
FT                   NSMWGGFNWGSHDVNINVNRYNNINVNQRLDVNRSNVNWQHNPANRGNVPYRNQNVANR
FT                   YDAQRQQGLANRPQGGQQRLGQAGGGVQNQQRLGQGGGGVQNQRDAERQRAAQSFQGRT
FT                   GQSIPGHSAPNVNRQAGGQNPRPAGADRQRADQADARNRARDSNRNNAFSDAGNGDRMR
FT                   QQANRGDRSGFQHNAGQVQQHSAPARSGGGIHGGGGGGGSGFHGGGGGGFQGGGHAGGA
FT                   GAGGGHLGHGRR"
FT   gene            503960..504805
FT                   /locus_tag="Rmet_3947"
FT   CDS_pept        503960..504805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3947"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3947"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10815"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGB1"
FT                   /protein_id="ABF10815.1"
FT                   /translation="MKRQSRFESMLRAGALAMLLSMSVPVLAQHVYPTPDAAADAFGDA
FT                   VARSDPDALKQVLGANYEKLVPPGLSQNDIYDFLAAWASHHAVQPDGDKAARIEVGGSG
FT                   WTFPVPLAKRKTGWQFDLAAGEQEMRRRRIGRNELVAMDTLLQLADAQQRYAEQIGNGK
FT                   YAHQLVSTPGKTNGLYWPSASAENDSPLGPDALAMGPEVPPEEAFYGYRYRIIAPPKGS
FT                   DAKFAFIAWPARYGDSGIHSFMVDSERRFYERDLGKSTGTRAGAMRAFSPEGWERAADR
FT                   "
FT   gene            complement(504836..505495)
FT                   /locus_tag="Rmet_3948"
FT   CDS_pept        complement(504836..505495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3948"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3948"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10816"
FT                   /db_xref="GOA:Q1LGB0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGB0"
FT                   /protein_id="ABF10816.1"
FT                   /translation="MLPDRPALSPERKHLQAGEALFRQDQPVRAVYPLRHGGIKRMYES
FT                   ALGWRQLTGFMLPGDVAGLEPNDAPQFGTSAIALQASECCVVPLETAKRCEEDPAVHAA
FT                   LLALLHRDALRQRELLVTIGSMKAAQRLAMLLLDQAAEHRRRGTDGGEVMLAMTRNDIA
FT                   SYLGLTLETVSRLLSRFASVGLITVRHRQLRIVDEKGLSDVHAEADRITLRGPDPA"
FT   gene            505863..506936
FT                   /gene="phaZ3"
FT                   /locus_tag="Rmet_3949"
FT   CDS_pept        505863..506936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaZ3"
FT                   /locus_tag="Rmet_3949"
FT                   /product="poly(3-hydroxybutyrate) (PHB) depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3949"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10817"
FT                   /db_xref="GOA:Q1LGA9"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA9"
FT                   /protein_id="ABF10817.1"
FT                   /translation="MAKSLSPDWDAQLRQIRRAQFQPAKQIRTWLERLELAPPATHRQR
FT                   HTAPGEAGPAELPGNWQSLNLGLTPLPGELVPQLSYRLYIPSGAKGALPVVVMLHGCQQ
FT                   TPEALAAGTRMNALAEREGFMVAYPQQPLRRSVHRCWQWFDLAAGQGGREAQALALLID
FT                   ELATRPDVRIGEIYLAGLSAGAAMAALVALRYPDKVAAVGLHSGVVIGAADSPRAGLRA
FT                   MHEGSAIEPALLLDAAGVTPGGPAMPAIVLHGMADEAVHPINGRLLTQQFLAYNGLGGS
FT                   LGGQIESANDAPLGKDGEVREARFGRWNRDLVRLVEVGGLGHAWSGGDATVPYHSSIGP
FT                   DASWLIWQFLRQHKRAA"
FT   gene            complement(507040..508350)
FT                   /locus_tag="Rmet_3950"
FT   CDS_pept        complement(507040..508350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3950"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3950"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10818"
FT                   /db_xref="GOA:Q1LGA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA8"
FT                   /protein_id="ABF10818.1"
FT                   /translation="MSTSSSTAGASGAQGGHAARPLTGQDYKTLALAALGGALEFYDFI
FT                   IFVFFAKVIGQLFFPASVPDWLRMLQTFGIFAAGYLARPLGGIIMAHFGDLLGRKKMFT
FT                   LSILLMSVPTLLMGLLPTYASVGLLAPMALLVLRILQGAAVGGEVPGAWVFVSEHVPRR
FT                   HVGYACGTLTAGLTAGILLGSLVATGINAVFDPQELVDHGWRVPFVLGGVFGVGSMYLR
FT                   RWLHETPVFAELQQRKALAAELPLKTVVRDHRGAVVISMLLTWMLSAGIVVVILLTPTY
FT                   LQTLYGFDARTALVANSAATLCLSIGCVVAGILADRIGARLTLSIGGALLAATACVLYT
FT                   TIGTRPDLLLPLYALAGFFVGTIGAVPYVLVHAFPAQVRFSGLSFSYNVSYAIFGGLTP
FT                   VIVSLMLKNDSLAPAHYVVGVCIMGIVTALFVRKRHA"
FT   gene            complement(508373..508600)
FT                   /locus_tag="Rmet_6636"
FT   CDS_pept        complement(508373..508600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6636"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45236"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY66"
FT                   /protein_id="ADC45236.1"
FT                   /translation="MFFIMETDYGSAKDDLVIRFIQNQGCDRPIWYRYAFAKRPLPASL
FT                   LTPPASGSLSSCCYPFGRPPPRHPCCALRM"
FT   gene            508632..512645
FT                   /locus_tag="Rmet_3951"
FT   CDS_pept        508632..512645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3951"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3951"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10819"
FT                   /db_xref="GOA:Q1LGA7"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA7"
FT                   /protein_id="ABF10819.1"
FT                   /translation="MGLSLRGVELLWGDMAFKDSIQAATGAAMATPRRRVAVRVAGGVV
FT                   AALAVFGLAGYFGGPPLIKYLVEKNATEALGRKVTLGEAHVRPFSLSATINNLTIYEPD
FT                   GKTPTVTLGEAEAKTSAASVWHLAPVIDSLHVDALSVHVLRDANGRMNFADVQERFAAL
FT                   PPKPADAKPARFSVSNIAVTNTSFVYEDKLLNTVQRVENFTLTLPFLSNLPHDVTLNTA
FT                   PSLFAKINGSPLALAGTMQPFADSREANLNINLDGLEVAKYMAFAPKLKDAEVKSGLVD
FT                   TRLNVGFRQEKDKQDLYVSGTIALRDADVVTHAGAPLVKAGRLAVDLDRVEPLAHKAHV
FT                   KSIELDGFGLLATRGADGALDLATAFLPEGMKSAPAKAPAAAPVTATPAPASVVAASGV
FT                   QVPPKAEEVPWSYAVDRIAIKDAKLGFVDAMAPSGPGKLDIGPVNVDIANLASTGDKPA
FT                   KLDATVTIADGQTIKQSGELDLKKGTLNGTLETAGVRPQGFAAWWPHELRSQFGDTGIN
FT                   AELNYKMAWSQPVFQFTLEKSRLELSPLYVATREPVNLPASAGNDDRATKAASPAPKGR
FT                   AGRAQRGNRASQRVADTEGANLPLLRADKLVLDDIQLDLAKQTFEAGQVSLAKPQIAAT
FT                   RDHSGQLLEMARIWAVESAESAGKRARAPAAATAATNGGGAGGPGWKVRVGKMAVDGGS
FT                   ARLADYEPAEANRGRPVIHQFRNIGFTSGTVTWPLSPGAVPMKLHAESGRKGVMNIDGQ
FT                   VTPTGPAAQLQLDLRELDIAPLQPYMADRFNAALRSGALTLKGKVAYEAPAGKPIAVRF
FT                   NGNVMAGNVRTVDRVTGDDFLRWRSLAVSGVDFNMNDAKGPLQLGVNNVALSDFYARVI
FT                   LNANGRLNLQDVMAGGAAKGEPAPSTSLTQANPASAPEAKPEAKPETAAAPAQAAGPKP
FT                   VIRLGGVSIDKGNINFSDFFIKPNYSANLTGMKGSISKVSTGDPTPADLVLDGRLDDDA
FT                   PVNISGKINPLGEQLFLDIAAKADGVELTRLTPYAAKYAGYPITKGKLNVDVAYKIENG
FT                   KLDAKNHLYLDQLTFGDKVDSPDAVKVPVLLAVSLLKDRNGVIDINLPVSGSLSDPEFS
FT                   IGGVILRVIVNLLAKAITSPFALIAHAFGGNAEELGYIEFAPGSSTLTDDAHKKIETIG
FT                   KALADRPSLNLEISGRIDPDTDADGARRVWLNQRVAEAKQRDLRRSAQAGAQAEEGEGG
FT                   EQGATVTVSPQEYPKYLEAVYKRESFKKPRNFIGLTKSLPPAEMEKLLLEHAPVTDTEL
FT                   RALAEQRALTVKQALERDGKVPNARLFLTAPKLNAEGIKDKGKPNRVDFSIRQ"
FT   gene            512756..512941
FT                   /locus_tag="Rmet_3952"
FT   CDS_pept        512756..512941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3952"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3952"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10820"
FT                   /db_xref="GOA:Q1LGA6"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA6"
FT                   /protein_id="ABF10820.1"
FT                   /translation="MQQEAVAYKTWVCLICGWVYDEELGLPEEGIAAGTRWEDIPDDWR
FT                   CPECDVGKGDFSMIEI"
FT   gene            complement(512949..513104)
FT                   /locus_tag="Rmet_6637"
FT   CDS_pept        complement(512949..513104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6637"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45237"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY67"
FT                   /protein_id="ADC45237.1"
FT                   /translation="MLATVMVALLVVTVGTALWRCSHPYRMRYTRCAQKRRRAGICRSA
FT                   TQREAP"
FT   gene            complement(513204..513392)
FT                   /locus_tag="Rmet_3953"
FT   CDS_pept        complement(513204..513392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3953"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3953"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10821"
FT                   /db_xref="GOA:Q1LGA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA5"
FT                   /protein_id="ABF10821.1"
FT                   /translation="MLHLQLQAHDLVFLIPMALVGLLAMGAIPVAAKALRISCRCAGAI
FT                   LGVLLGVLVLEALPLLI"
FT   gene            513669..514172
FT                   /locus_tag="Rmet_3954"
FT   CDS_pept        513669..514172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3954"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3954"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10822"
FT                   /db_xref="GOA:Q1LGA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA4"
FT                   /protein_id="ABF10822.1"
FT                   /translation="MELHMHSHHYMRRLPDWTAAAVSGLAAGALLIVVEMFWSTMVAGV
FT                   HPWGTTRMVAAIVLGRDVLQNSFFSVSTVAAALIIHFVLGAILGCVLCAIIAPFQLDSS
FT                   VGMSLLVGAVFGLVVYMFNFYVMTSAFPWFVDQRGWHTLVGHLIFGMAIAICYWKLESR
FT                   GVSR"
FT   gene            514448..515623
FT                   /locus_tag="Rmet_3955"
FT   CDS_pept        514448..515623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3955"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3955"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10823"
FT                   /db_xref="GOA:Q1LGA3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA3"
FT                   /protein_id="ABF10823.1"
FT                   /translation="MAIAIALVIIVVASVLFHFLSPWWATPLASNWKQMDDTLTITLVI
FT                   TGLFFVVINLLVGYIVWRFRHRAGHRAAYAPENPKLERWLIGLTAVCIIALLAPGLIVY
FT                   AEYVRPPRDAMVMEVVGQQWQWAFRFPGKSGQLGTTDPRFVSGTNPLGLNPDDPNGQDN
FT                   ILVMGPEVHLPLNRPIKVLLRSKDVLHDFYVPPFRARMNMVPGMVTSFWFTPTKTGRFD
FT                   ILCAQLCGLGHYNMRGHVVVEEQAAFDTWLAKQQTFAMTLAKVAAPTAAPAEGPAVAGA
FT                   SAGAADLVAQGRALAQSKGCVGCHSVDGSVGVGPSWKGLYGSTQTFSNGSSATVNDAFL
FT                   KTEIEDPQARIVKGFGPVMPKLPVTDADVVALSAYIRSLGAGATGTPQAGK"
FT   gene            515661..517418
FT                   /locus_tag="Rmet_3956"
FT   CDS_pept        515661..517418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3956"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3956"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10824"
FT                   /db_xref="GOA:Q1LGA2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA2"
FT                   /protein_id="ABF10824.1"
FT                   /translation="MAYADDAAHHGPQSFWTRYIWSQDHKVIAVQYTLVAIVVGLIGVT
FT                   LSNLMRMQLGFPGRFDFIDANRYYQFVTMHGMIMVIYLLTALFLGGFGNYLIPLMVGAR
FT                   DMVFPFLNMLSFWVYFLSVLVLLASFFVPGGPTGAGWTLYPPQAILPGTPGHDWGIILM
FT                   LVSLLIFIVAATMGGLNYVTTVLQARTEGMTMLRMPLAVWGIFMATILALLAFPALFVS
FT                   GVMMLLDKTLSTSFFMPAVVSMGQQLNYKGGSPLLFQHLFWFFGHPEVYIVALPAFGIV
FT                   SDLISVHSRKSIFGYRTMVWAILAIGVLSVVVWAHHMFVSGMNPYFGFFFATTTLIIAV
FT                   PTAIKVYNWVITLWQGDIHFSVPMLFAIAFISTFVIGGLTGLFLGNVSVDIPLSNTYFV
FT                   VAHFHMVMGVSPILVVFGGIYHWYPKVTGRMLNDTLGRIHFWITFVGTYAIFFPMHYLG
FT                   ILGMPRRYYAWQGYDFIPESAHTLNMYISIAAFIVAAAQLLFIFNLAWSVRRGQPAGAN
FT                   PWRAASLEWQTPQTPPAHGNWGAHLPVVYRWAYAYSVPGAKEDFIAQNAPPDAGGSEPE
FT                   PHARRGAVA"
FT   gene            517415..518083
FT                   /locus_tag="Rmet_3957"
FT   CDS_pept        517415..518083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3957"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3957"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10825"
FT                   /db_xref="GOA:Q1LGA1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA1"
FT                   /protein_id="ABF10825.1"
FT                   /translation="MKAESFAVDTGGGVFRASREAPGGSPAGGDALHGHGARTPGSLGL
FT                   WVFMGVVTALFTLFLAAYIMRMDSPDWQRIALPWQVWLSTAVLAAACVAMEIARRAAHS
FT                   GRMVRARHAFRLGGMGAVAFVGVQLWAWQALYALHVVPANNPAGSFFYLLTAMHGLHML
FT                   GGLVAFAFVAVDRGSGTRTVTRIGLCARYWHFLLAVWVVLLGALGWLTPELVAYICGRS
FT                   "
FT   gene            518096..518800
FT                   /locus_tag="Rmet_3958"
FT   CDS_pept        518096..518800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3958"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3958"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10826"
FT                   /db_xref="GOA:Q1LGA0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LGA0"
FT                   /protein_id="ABF10826.1"
FT                   /translation="MHSQVPSSAGSHPEAWNPPGGFRGLVADWSSDQRAFKVSWGKAMM
FT                   WIFLLSDTFIFSCFLIGYMTVRISTTVPWPDTSKAFAENIGGHTLPLILIAIMTFVLIT
FT                   SSGTMAMAVNFAYRRERRPCGLLMLATAALGATFVGLQAFEWTTLIVHEGVRPWGNPMG
FT                   AAQFGSTFFMITGFHGFHVTCGVIYLLTIASKVVRGHYEPGGNYQVVEIAGLYWHFVDL
FT                   VWVFIFALFYLW"
FT   gene            518809..519162
FT                   /locus_tag="Rmet_3959"
FT   CDS_pept        518809..519162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3959"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3959"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10827"
FT                   /db_xref="GOA:Q1LG99"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG99"
FT                   /protein_id="ABF10827.1"
FT                   /translation="MASTPITPAPEAAHGGHGKQEHPIGLYLKVWGLLFVLSTMSYLVD
FT                   YFGFTGYLRWFLILLLMILKAGLIVSVFMHMAWERMALICAILIPPLCLLVLVFLMAAE
FT                   ADYTFLTRGVFFH"
FT   gene            519222..520421
FT                   /locus_tag="Rmet_3960"
FT   CDS_pept        519222..520421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3960"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10828"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG98"
FT                   /protein_id="ABF10828.1"
FT                   /translation="MHAATESILIYNHGRDPERLTMKLAAIAADPFAFFRGTNHLYAAS
FT                   LEREAGLLDAPSTYVCGDLHVENFGTFKGDNGLVYFDLNDFDDAMLAPLTVDVIRMLSS
FT                   VLVAGESIGLSEADARTACAQMLSVYTAMLRAGKPRWLERATASGLVAMLLRQVKRRKR
FT                   GALLNARTEMRGGRRRLKFDGHALRADKMQRERASEILGIYSKQEHHGHRFVAEDSARR
FT                   VAGVGSLGLERYVVLAHERDMPASQRLIDIKRAAPSAWTGMRTRGQPRWGSDAQRVATI
FT                   QQIMQAASPALLSYVPLGKASYLVKSLQPSTDRVNLEHCRDKTVLQDVFATMARAAASA
FT                   HLRGCGHQAADRVEQLQDFAAGGRWQSTVLRLAKHGRDVSLAQWKQFREDYAKARGKGA
FT                   "
FT   gene            complement(520510..521937)
FT                   /gene="gabD"
FT                   /locus_tag="Rmet_3961"
FT   CDS_pept        complement(520510..521937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="Rmet_3961"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3961"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10829"
FT                   /db_xref="GOA:Q1LG97"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG97"
FT                   /protein_id="ABF10829.1"
FT                   /translation="MYQDLALYIDGEFIKGGDRREQDVINPATQELLGKLPHATTADLD
FT                   RALSAAQRAFETWKKTSPLERSQILRRVAELTRTRAKEIGRDITLDQGKPLAEAVGEVM
FT                   ICAEHAEWHAEECRRIYGRVIPPRNPAVRQIVVREPIGVCAAFTPWNFPFNQAIRKIVA
FT                   ALGAGCTLILKGPEDSPSAVVALARLFHDAGLPPGVLNIVWGVPSEVSTYLIESPIVRK
FT                   ISFTGSVPVGKQLAAMAGAHMKRVTMELGGHSPVLVFGDADIEPAAEMLARFKLRNAGQ
FT                   VCVSPTRFYVQEKAYDKFLARFTEVIGSIKVGNGLDDGTQMGPLAHERRIASMEQFLDD
FT                   ASHRGGKIVAGGSRIGDKGFFFAPTVVTDLPDDAKLMVDEPFGPVAPVTRFKDAEEVLR
FT                   RANSLPFGLASYVFTNSLKTANLVSNGLEAGMVNINHFGMALAETPFGGIKDSGIGSEG
FT                   GQETFDGYLVTKFITQV"
FT   gene            522170..523648
FT                   /locus_tag="Rmet_3962"
FT   CDS_pept        522170..523648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3962"
FT                   /product="multi antimicrobial extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3962"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10830"
FT                   /db_xref="GOA:Q1LG96"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG96"
FT                   /protein_id="ABF10830.1"
FT                   /translation="MKPDARLTTGPIGRTLLMFSLPVLGSNILQSLNASINSVWVGRYL
FT                   GEAALTATSNANIILFFLLGVVFGISMANTIMIGQAVGGRDIEEARRVVGTSTTFFVGL
FT                   SVLAAVLGFVFTPHILAAMHTPDDATPLAIIYLRIIFIALPFMYFYNFVMMTLRGAGDS
FT                   RTPFYFMLLSVVLDVVLNPVLIFGVGPIPPLGIAGSALATLIAQLTSLAAMIGLLYRRR
FT                   HFLLLHREQLALLRPDMAILRALVMKGLPMGLQMVVISSSAIVMMSLVNTYGSRTTAAY
FT                   GVASQLWTYVQMPALAVGASVSSMVAQNVGAGLWVRVARVTQVGMLFNMLMTGALVALV
FT                   YVFNRHSLGLFLGEDSVAIEIAQHINNVVLWSFILFGFTIVVFGAVRATGAVMAPLVIL
FT                   FVSMWLIRLPFAWLLGPHIGAESIWWSFPLGSVVSVLLSFGYYRYGNWRRSHILPVAPH
FT                   PEAVGNAPDTSMGVPCEDADAGAEADEGVARQPS"
FT   gene            524029..524523
FT                   /locus_tag="Rmet_3963"
FT   CDS_pept        524029..524523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3963"
FT                   /product="conserved hypothetical protein; putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3963"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10831"
FT                   /db_xref="GOA:Q1LG95"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG95"
FT                   /protein_id="ABF10831.1"
FT                   /translation="MPQFTTLRRIVLRIRSQKDFASGLMFILVGLGFSFVARGYSMGTA
FT                   AKMGPGYFPFLLGLVLAILGALVLMGSLSSKGEEDQLARWDLKTLLWILGSVVLFGLLL
FT                   KPLGMVLSVFVLVMVSSMASHEFSWKGALLNSVVLVLIALGAFVYGINLQMPVWPAFIT
FT                   G"
FT   gene            524537..526039
FT                   /locus_tag="Rmet_3964"
FT   CDS_pept        524537..526039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3964"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3964"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10832"
FT                   /db_xref="GOA:Q1LG94"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG94"
FT                   /protein_id="ABF10832.1"
FT                   /translation="MELFDHLALGFSTALSLQNLAYAFLGCVLGTLIGVLPGLGPLATI
FT                   AMLLPVTYSLPPVAALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTTIDGYQMARRG
FT                   RAGVALATAGLGSFFAGCVATLILAAFATPLSELAFKFGPAEYFSLMVLGLIGAVVLAS
FT                   GSLPKAVAMIVLGLLMGLIGTDVNSGAARFSFDVPELTDGIDFVALAMGMFGFAEIIAN
FT                   LEQKEARETFTNKVTNLWPTKEDFRRMIPAVLRGTALGSALGILPGGGAALASFAAYSL
FT                   EKKTSKYAHEFGKGAIEGVAGPESANNAAAQTSFIPLLTLGIPPNAVMALMVGAMTIHN
FT                   IQPGPQVMSSNPALFWGLIASMWIGNLMLIILNLPMIGVWVKLLTVPYRFLYPAILVFC
FT                   CIGVYSVNNQTFDVFMAAAFGVIGYLFLKLKCEPAPLLLGFVLGPMMEENFRRSLLLSR
FT                   GDFTVFVTRPLSMGLLIAAAALVAVVALPSIKAKREEAFQEE"
FT   gene            526169..526510
FT                   /locus_tag="Rmet_3965"
FT   CDS_pept        526169..526510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3965"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3965"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10833"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG93"
FT                   /protein_id="ABF10833.1"
FT                   /translation="MIRFSAPLVALPAPMKTPSLDRIVSRLYILRLVQASPSTVFNLME
FT                   RLRERGIDKNIRALRPILRSLMMARSITAELVEGNGRVYSITDAGRAELDAYLAHLNVL
FT                   QDDMSETAE"
FT   gene            complement(526733..529198)
FT                   /locus_tag="Rmet_3966"
FT   CDS_pept        complement(526733..529198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3966"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10834"
FT                   /db_xref="InterPro:IPR022218"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG92"
FT                   /protein_id="ABF10834.1"
FT                   /translation="MTNNHRSQYFASASPVFRASMLRRPRMELLRIAAASALALATMAG
FT                   CGDGGDSSPSSSSAQPTPTPTPTPTPTPTPTPTPAPEYPRTTFALAGSVEYGQTSVVRQ
FT                   NETRIAPRLVEGRSTLLLFTPTNPISKDQEVFVEATLNGVSMGRLRLKKPAGLVGYAED
FT                   RITQDTLPRYSTQAWSTQMPTGWMKADVQLAVGYDEVRHDEKRIYAYRITNGLPPLAGP
FT                   SELTYTRTKVLFWEDADSNADTLDSDKLADEIHARMPVSRISVVDYLPARWNSVIMMAP
FT                   PRRFDSLRQIPAPRISPTSNTAWAANIMVDKANTGRGLQAIYVYSMFNQSSPLAYGATL
FT                   SQGRYKDLDGNLQDAFPIDIAFSGWAQTQWNRECAPQMNEALGSVIGLSPVFRGEPWKF
FT                   GSEYPDGLVWTASHPQPFDTARGVFRTWYAATDGFTMRSSDKPRGRIDPQFYGDKEPAD
FT                   SQSCFSPYTNYNTRAIQLRLDSTPTLRTVAGSPGYYRWDNTTRTFAPVAPDWEGAALQL
FT                   KPDRMGIPVVTVIGSLTSSENPGASMLFPPLFAASGNTFVMEEAGTTSNNYRGARYAAR
FT                   VRYADGNQRIFIIPKEMAGKDRAYYFSFNLPIADKPVEVSLYRLQLPYTANSFHALSSV
FT                   DTLLSTQAITIPASMPSPVTRGGDSLQESRTAMVSKLCTTQTCETESIDIAWHPDDESQ
FT                   LYFVAGRPSLGLTTPVGNPKGAPMRLEVLMNGPDGNQRVVVFRASRAVNTTSDGYRLSP
FT                   ANYWTAPELLKDKLQRLSIWVHADDNTALPAGRYTMTDAVKLLDVHAVSSAGDRIVDRV
FT                   KLNAAFEKL"
FT   gene            complement(529677..530684)
FT                   /locus_tag="Rmet_3967"
FT   CDS_pept        complement(529677..530684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3967"
FT                   /product="putative response regulator of a two-component
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3967"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10835"
FT                   /db_xref="GOA:Q1LG91"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG91"
FT                   /protein_id="ABF10835.1"
FT                   /translation="MPRQLNSADAAATHEYPAMVLLVDDQAIIGEAIRRALASESDIDF
FT                   HYCSQPEEAVTVAERTKPTVILQDLVMPGTDGLTLVRRYRENATTRDIPIIVLSTKEEP
FT                   TMKSAAFAAGANDYLVKLPDSIELIARIRYHSRSYLNLLQRDEAYRALRQSQQQLLETN
FT                   LELQRLTNSDGLTSLSNRRYFDEYLGAEWKRAQREQTQLALLMIDVDAFKGYNDTYGHV
FT                   AGDEVLRRVAAVIRENCARPADLPARFGGEEFSMILPATSPGGARLLAEKVRRAIETLR
FT                   IPHACSPTGGFVTVSIGGAVIVPGGDADFSRLIEAADAGLYQAKRNGRNQVVMA"
FT   gene            complement(530708..531724)
FT                   /locus_tag="Rmet_3968"
FT   CDS_pept        complement(530708..531724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3968"
FT                   /product="putative response regulator"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3968"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10836"
FT                   /db_xref="GOA:Q1LG90"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LG90"
FT                   /protein_id="ABF10836.1"
FT                   /translation="MRIGIVNDSALAVAALRRALALDTTLEIAWIAGDGEEAVRMAATQ
FT                   TPDLILMDLLMPVMDGVEATRRIMAESPCAIVVVTMDLGRNANQVFDAMGHGAIDAVDT
FT                   PTLTDSDTKLAAGPLLRKIRNIARLLGGRGQAPHPLAAATPTPTAPRLVAIGASAGGPA
FT                   ALATLLGALPADFGAAVVAVQHVDEAFAQGMAEWLDAQCQLPVRLARAGEVPQAGAVVL
FT                   AGTNDHLRLTSAGRLIYTPDPCDYLYRPSIDVFFESVVEHWRGEAIGVLLTGMGRDGAQ
FT                   GLKAMRERGFQTIAQDQATSAVYGMPKAAATLGAASEILPLQKIAPRLVMTCGGGRR"
FT   gene            complement(531721..534027)
FT                   /locus_tag="Rmet_3969"
FT   CDS_pept        complement(531721..534027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3969"
FT                   /product="signal transduction histidine kinase (cheA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3969"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10837"
FT                   /db_xref="GOA:Q1LG89"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG89"
FT                   /protein_id="ABF10837.1"
FT                   /translation="MNPEQLRDASLLDLFALEADAQADVLNAGLLALERDPTAAVQLEA
FT                   CMRAAHSLKGAARIVGLEGGVRVAHVMEDCLVAAQRGGLLLSASHIDALLQGTDLLQRI
FT                   GHPPDGNANWPELGGKAEIDAFVARLEALLDGGADVAALAAPTVLPPAAEPAPPEPPLP
FT                   TVNHPSTSTVVPAQPQEYTGSNQERILRVNAERLDRLLAMAGESMVETHWLRPFGVAIQ
FT                   QARRQQMRVMQALDGVQALLDSPDSTVPRLRAALMETRQLLEDSHGQLTQRVEEFDQYD
FT                   HRQSGLSRRLYDTALSCRMRPLADGITGYSRMVRDLGRSLGKRVRLELSGEQTQVDRDI
FT                   LEHLDAPLAHLLRNAVDHGIEAPDTRRAAGKPEEGRVSLHAWHNAGRLVIEIFDDGAGV
FT                   DLEALRAAIVRRGLAQADTVARLSQAELLEFLLLPGFSMRETVSEVSGRGVGLDAVQDM
FT                   VRAVRGSLRLSQQPGSGLHFHLELPLTLSIVRALLVEISGEAYAFPLGHVLRAVAVRRE
FT                   DIEQTEQHQHFRHDGKPVGLISAAQVLQRPERGQDGDTVPVVVIGEQDRVYGIAVDRLI
FT                   GERLLVVQPLAQALGKIKDIAAGSLTDDGMPVLIFDVEDMLRSVEKLVSDGRIERVRHG
FT                   GEEATQTRRKRVLVVDDSLTVRELERKLLSGRGYDVAVAVDGMDGWNVLRAESFDLVIT
FT                   DVDMPRMDGIELVSRIRGDTRLTHLPVMIVSYKDREQDRERGLQAGADYYLAKGSFHDT
FT                   ALLDAVRDLIGEARS"
FT   gene            complement(534024..534776)
FT                   /locus_tag="Rmet_3970"
FT   CDS_pept        complement(534024..534776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3970"
FT                   /product="putative chemotaxis signal transduction protein
FT                   (cheW)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3970"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10838"
FT                   /db_xref="GOA:Q1LG88"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG88"
FT                   /protein_id="ABF10838.1"
FT                   /translation="MAEPNSLLPHAAPAGAIDDCWRRIGVTGDRTCPLLATHITCRNCP
FT                   VYAQAALVLLDTLAIDPIVQPASDSDTPIDQSSADRLAGESYMVFRVGDEWLALPTATL
FT                   GEVTAPALVHSLPHRRHAALIGVAAVRGALLTCISLALLFGESAEPTESTESTESTEST
FT                   ESNGRGGQDAQRAARFLILGQGRNAIALPVAEVAGVERVTQDVLLPLPATLARASARYS
FT                   RALFDFNGHSVGLLDADLLRQALTRSLS"
FT   gene            complement(534769..536058)
FT                   /locus_tag="Rmet_3971"
FT   CDS_pept        complement(534769..536058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3971"
FT                   /product="putative chemotaxis MCP methyltransferase,
FT                   CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3971"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10839"
FT                   /db_xref="GOA:Q1LG87"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG87"
FT                   /protein_id="ABF10839.1"
FT                   /translation="MTDAPHPSTLIEALLKERIGLDAASVGRGTIERAVEERRQAMGAD
FT                   DPATYWNLLHAVPDELQALIESVVVPETWFFRHREALLALARFAAQRVFGAGEPMLRIL
FT                   SLPCSTGEEPYSIAMALLDAGIPGDRFRIDAIDISARALERARAAVYGDNAFRSQPLDF
FT                   RDRYFMSVTGTQATYQLLPKVRNQVRLLCGNLVDPDLLRHEAPYHFAFCRNLMIYFDPA
FT                   TQCEAIRTLRRLTRPDGMIFVGPAEASLLTREGLAGAGVPLGFAFHAQPASPSSHASAA
FT                   HTVMPPQPMIARARSAATAPAKHAARAPDVAASNPSAQPASAPSRDAALAAIAAMADRG
FT                   ELDRALAACQLFLTEHGTSADGWCLLGVLHDASGRATEAHAAYRKAVYLDPGHEEALYH
FT                   LAALLDSAGDAAGAHRLRERAQRHARMSHG"
FT   gene            complement(536055..536528)
FT                   /locus_tag="Rmet_3972"
FT   CDS_pept        complement(536055..536528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3972"
FT                   /product="putative chemotaxis signal transduction protein
FT                   (cheW)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3972"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10840"
FT                   /db_xref="GOA:Q1LG86"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG86"
FT                   /protein_id="ABF10840.1"
FT                   /translation="MALFLLFRIGADRYALDSAEVAEVLPLGPVKQIPGAPEWVCGLMT
FT                   RHGQPVPVIDITALATGTPATARASTRTALVHYRRARDSGTQPRVLGLRLEHANETLRC
FT                   DPASFIDGGIDPTHARYLGPVRHDPRGLIQWVHVGALLPDAVHAILFPASSPA"
FT   gene            complement(536556..538376)
FT                   /locus_tag="Rmet_3973"
FT   CDS_pept        complement(536556..538376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3973"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3973"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10841"
FT                   /db_xref="GOA:Q1LG85"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG85"
FT                   /protein_id="ABF10841.1"
FT                   /translation="MQALPISGATAQRPGHRVEMAWALQYPTPQKATTQTRDTPNWVTA
FT                   PPPQSMTQPAPTPAASPETILIVTHWTIRTRILASFTIILLVMALMSGVAYRRLSAIEH
FT                   ETTVMRTDALPGLNFSAGMRGVWGEIYVLAWQTVTAADAPQRARLLAQTQDAMQRLDRL
FT                   EQQYDATIVRDDDRARFHNYQAVRARYQQAAQPYLDPAQWKDAATAQAALRGSAHDLWS
FT                   DGRKLLQDIVDDNGKVNERASTGIVDSVVTAKVSIEVAFGIAVLAALIAGYQLLRAITV
FT                   PMGKIVSLLKTMRGGDLRQRMVLHRRDEFQAVEEGFNQMADELTSLVGQAQRSAIQVTT
FT                   SVNEIAATARQQQATATETAATTTQIGATSREISATARDLVRTMSEVSHAADQTAGLAG
FT                   TGQVGLSRMEATMNHVMEAAGSVNARLATLNEKAGNINQVVTTIARVADQTNLLSLNAA
FT                   IEAEKAGEYGRGFSVVATEIRRLADQTAVATYDIEQIVREIQSAVAAGVMGMDKFSEEV
FT                   RRGMSEVTQVGDQLSQIIGQVQSLAPRVQMVNEGMQAQAGGAEQINQALIQLSEAAQQT
FT                   VESLRQSSQAIDELTLVSNELRSGVSRFKV"
FT   gene            complement(538247..538417)
FT                   /locus_tag="Rmet_6638"
FT   CDS_pept        complement(538247..538417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6638"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45238"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY68"
FT                   /protein_id="ADC45238.1"
FT                   /translation="MLKLFGKCDENLGKCKRFQFPAQRRNAPGTALKWLGRYSTLRRKR
FT                   LPPKRGIPPTG"
FT   gene            538450..539775
FT                   /locus_tag="Rmet_3974"
FT   CDS_pept        538450..539775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3974"
FT                   /product="putative diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3974"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10842"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG84"
FT                   /protein_id="ABF10842.1"
FT                   /translation="MVAKSEAQATGALPPADVDPLTGVVARQSFLNRLETRLHSEATPR
FT                   FSLLLVGIDDFRAFNDMHGHMEGDAILLQVARRLRDAAPRDAVVGRVGGDEFAVLLTSI
FT                   SDPTLVRHVSAAILSMLSAPHELNGRRHHVLASLGACVMPTGGDTTSDVLAAASLALAR
FT                   AKHDGGRTIRFFKPQMRTDVMTRLSLVQALREAYAQRQFELLYQPQVDLRDGRVLGAEA
FT                   LMRWRHPTLGLLAPAAFIDALAASSVAADVGMWLLHTACAQARAWSLTFPDAPRVAINL
FT                   FAAQLSESRLLTEVRHVLRALELPPDRLEIEITETIALQQGDEVSGQLQALRRDGVTLT
FT                   CDDFGTGYASLSFLKSFPVDRLKIDQSFIRNVTQDSVDAAIVRSVINVGQSLRIGVVAE
FT                   GVENAAQREFLLANGCVEAQGYLYGRPMSADLLTEHLRHQPR"
FT   gene            539964..542471
FT                   /locus_tag="Rmet_3975"
FT   CDS_pept        539964..542471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3975"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3975"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10843"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG83"
FT                   /protein_id="ABF10843.1"
FT                   /translation="MQSHTRFALAPVAFGLAALLAQAPAGAQGYNPNMPPGYVEQGQGG
FT                   AGMPVGPETAQSADPSSRIATVTDAAGGLSFAPAGSDEWAAIGLNRPVTTGDRVWVDPG
FT                   GRAELHAGATAIRLGGGTAAGVLNLDDHTTQVKLTQGTLQLRVRALPPDQQVEIDTPNL
FT                   AFVPREPGDYRLDVSPDGTTTQVSIRHGTAVLYGDTRSIEMSRGQRMRFAGADLSDAGP
FT                   GNAGGPDSFDQWTAARDAREDESVSARYVPRDMTGYTALDDYGDWQQDPGYGAVWFPRA
FT                   EPAGWAPYSSGYWAWVAPWGWTWVDDAPWGFAPSHYGRWAYFGNRWGWVPGPIAVRPYY
FT                   APAVVGFVGGVSATISIGGGPGVAWYPLGPRDVYRPIYRASPTYITRINNVTINNNFIA
FT                   RGDRDRWNNREVPGAISGMSSRSFVEGRPVPRARTRDEWRHLPAGEGNFGAPPMAPVKT
FT                   SLIGAAQPRGLPPMARAGFERQAIAARQPGRVGPDELANRFAREGGTAGAGPAWRGPTQ
FT                   DARPQQSSRRGGQPAQAMPWQPDVRVSQAAQSGRGFAPRPDQMRGLPQESQRQEQAIQR
FT                   QQFDQQRQTEERQRQSADFQQRQQQALQRQAQDQQRQQLDQQRQAQERQQMDQQRQSQQ
FT                   RQQQMDQQRQSQERQQMDQQRQAQERQQMDQQRQAQERQQMDQQRQAQQRQQQMDQQRQ
FT                   AQERQQMDQQRQAQQRQQQMDQQRQAQERQQMDQQRQVQQRQQQQLEQARQLQEQQRQQ
FT                   FEQQRQQAMQRQQVDQQRQAQEQQRQVQEQQRQMQEQQRQQQDRQRQIQQQQQQQQQQQ
FT                   QQQRAQQERARQSREEQAHNDGR"
FT   gene            complement(542665..543837)
FT                   /locus_tag="Rmet_3976"
FT   CDS_pept        complement(542665..543837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3976"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, livK-like periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3976"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10844"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG82"
FT                   /protein_id="ABF10844.1"
FT                   /translation="MQYKTLGRFFPLAACAVAALVASAPTLAQEVVKIGYTGPLSGGAA
FT                   LYGKNVLSGIQMAVDEINASGLEVKGKKIKLEVVSLDDKYAPAEAAINARRLVQQYKTP
FT                   AVFVPHSGGIFALQAFNEQEKFMVMAYSSVPRITDAGNKLTIRIPPAYTGYIEPFVKAQ
FT                   MKRFGKNVALVPADHDYAKAWVQAFVPAWEGAGGKVVGNNPMSYTKATDFYTGVSRAIA
FT                   DKPDVMFVGGPSEPTALVVKQARELGFKGGFIIMDQAKMDEMAKVTNGLAMLEGSIGVM
FT                   PLVNDARPVAQAYNARYKKLHDGRDATTEMSLNYTMTWALANAMKLAGTTSDAAAIRAK
FT                   MPEAVKTLPKDVNPNEVEGIDAKGGSMADTVVGWVQNGKIAPVRLSELGK"
FT   gene            complement(543940..544647)
FT                   /gene="livF4"
FT                   /locus_tag="Rmet_3977"
FT   CDS_pept        complement(543940..544647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF4"
FT                   /locus_tag="Rmet_3977"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding component"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3977"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10845"
FT                   /db_xref="GOA:Q1LG81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG81"
FT                   /protein_id="ABF10845.1"
FT                   /translation="MLQLDRVSLSYGSFRALDNISLHAGAGELVVLLGANGAGKSSIFL
FT                   AMSGIHRISGGSMRFDGRELSGMKPSQIVQAGLVHCPEGRKLFPAMSVEKNLTLGAYVH
FT                   RRDRAGIRKTLEEVYEMFPILFQKKDDPAGSLSGGQQQMVALGRALMSRPRALLLDEPS
FT                   LGLAPLVVKQMFEIIQRINRAGTTVLLAEQNAYAALGIAHRAYVIENGHIVMEGDRDTL
FT                   LKDEGIRKAYIGG"
FT   gene            complement(544634..545398)
FT                   /gene="livG4"
FT                   /locus_tag="Rmet_3978"
FT   CDS_pept        complement(544634..545398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG4"
FT                   /locus_tag="Rmet_3978"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3978"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10846"
FT                   /db_xref="GOA:Q1LG80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG80"
FT                   /protein_id="ABF10846.1"
FT                   /translation="MLEIRNLTKKFGGLTAVHDVSVKFETGHINAIIGPNGAGKTTFFN
FT                   LIAGTHAPTSGQILLKGQDVAGLRADQIARLGVARTFQATSLFDRATVLDNLIVGHRLR
FT                   TKSGLADVLFNTSRLREEEKLCREKAEAALDFVGLSHLAHELAADITQEARKRVAFALA
FT                   LATDPDLLLLDEPAGGVNPEETVGLAELIRKMVRHGKTVCLIEHKMDMIMRLADKIMVL
FT                   NYGEKIAEGTPAQIQQDPHVIEAYLGADHVAA"
FT   gene            complement(545391..546419)
FT                   /gene="livM4"
FT                   /locus_tag="Rmet_3979"
FT   CDS_pept        complement(545391..546419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM4"
FT                   /locus_tag="Rmet_3979"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3979"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10847"
FT                   /db_xref="GOA:Q1LG79"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG79"
FT                   /protein_id="ABF10847.1"
FT                   /translation="MKSMQGKIGWTLLFVAAIVFPLAVPNSYYLTVMTLAFIMAIATLG
FT                   LNLLTGYTGQLNLAHGGFMAIGAYTLGILTVDHQMPYWLAFALSGVVCMVLGYVVGTVS
FT                   LRLKGHYFSIFTMCVGYIIYLLIEKWESLTHGAVGLIGIPVPASIGPIAFDSVQAQYYL
FT                   VLVFLALGTFVMHRIVSSLVGRSFMAVRNSDALAEALGINLMRTKVLSFVLSVGYAGFA
FT                   GALYAGQVRFLGPDIARTDITFDMVMAMLVGGTGTLLGPLLGSLLVPWVTQTLQFLQDY
FT                   RMLVFGPVLILLIIFVPDGIVGSFLKRQVRRAAAARRGQMAAPRPTQTTSVPTTRPGAE
FT                   NA"
FT   gene            complement(546439..547302)
FT                   /gene="livH4"
FT                   /locus_tag="Rmet_3980"
FT   CDS_pept        complement(546439..547302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH4"
FT                   /locus_tag="Rmet_3980"
FT                   /product="ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3980"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10848"
FT                   /db_xref="GOA:Q1LG78"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG78"
FT                   /protein_id="ABF10848.1"
FT                   /translation="MALFFQQFLNGLTLGGVYSLVALGLTLVYGILHVPNFAHGAFYMA
FT                   GAYVSYYAMTTLGMNYWLAMLAAAVVVAMLSMLADRLVFYPLRHAPEIHDMIAAIGILL
FT                   FLEAGAQALWGADFHRMPTPYGQMVEIFGLTAPLQRLLIIVAAFGLMVLLHLFLTRTVT
FT                   GSTIVAMAQNREGAALVGIDAMRVTLLVFAISGALAAIAATLYAPINLVYPSMGNLVIT
FT                   KAFVIIILGGMGSIPGAIVGGLIIGMAESFGGFYISTDYKDIIAFLLLVIILSVRPQGL
FT                   FAGKTA"
FT   gene            547611..548453
FT                   /locus_tag="Rmet_3981"
FT   CDS_pept        547611..548453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3981"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3981"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10849"
FT                   /db_xref="GOA:Q1LG77"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG77"
FT                   /protein_id="ABF10849.1"
FT                   /translation="MKRTTSIPMPADTALVSADAARPAEDGDRNFVTALARGVELLRAF
FT                   GPDDDFLGNAELSRRTGIPRPTVSRLTYTLASLGYLVYVEAQEKYRIGQAAMLPAQRYL
FT                   SGAGIRDIAQPLMQSLAFATGCTVALAAPDRHDMVYLEVCQPRGALVMRLTPGSRLPMA
FT                   TSAIGKAWLAGLTSDRRGAVFAELERHHGARWASIRTKLERGLREHARRGFCMAHAEWD
FT                   RSVSGAAAPVSLADGSEVLSINIGGASTRLSPEILEGNLGPRIRELADALAARLWRPG"
FT   gene            548491..549303
FT                   /locus_tag="Rmet_3982"
FT   CDS_pept        548491..549303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3982"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3982"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10850"
FT                   /db_xref="GOA:Q1LG76"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG76"
FT                   /protein_id="ABF10850.1"
FT                   /translation="MEVRNKTVIVTGGGTGIGRALVLAFARAGARGIAVADIDEAGASQ
FT                   VAAEAVAAAPGCQIFSQRVDVANAEAVQKLVDTATQRFGQVDVFCSNAGIILRKGLDAT
FT                   ADEWQRIWEINVMAHIHAAKAVLPQMLERGDGYFVNTVSAAGLLSQIGSAPYAVTKHAA
FT                   IGFAEWLSITYGDRGIKVSCICPQGVQTKMLFGEGGERKGFLQAGSVTAEHVAEKTLEG
FT                   VANESFLILPHPEVLEYYRRKGQDYDRWLRGMRRLHDQVTKEFGNIVV"
FT   gene            549373..550359
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3983"
FT   CDS_pept        549373..550359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_3983"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3983"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10851"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG75"
FT                   /protein_id="ABF10851.1"
FT                   /translation="MFVRMFARRQVVAMLAATASLAAIPAAQANDAYPSKPIRMVVGFP
FT                   SGGAPDILARIFSEKISLGQPVVVDNKPGAGGNIGAETVARSAPDGYTLALGTVGTHSI
FT                   NGALYSKMPYDMVKDFTPVILLASTPNVLVVHPSVPAKNVQELIALAKAKPGQLTFGTP
FT                   GIGTSLHVAGELFNTMAGTKIEHVPYKGRAMAIPDLLGGHITMMFDNLPSALPVVKEGK
FT                   LRALGVTSAQRSTSAPDIPTIAEQGLPGYEATSWFAVFVPAHTPKEIVAKLNAEMNRIF
FT                   TLPDVQTKLKTLGLDPILGTPEKLAEYQRSEIAKWAKVVKDSGAKAD"
FT   gene            complement(550415..551836)
FT                   /gene="yebQ"
FT                   /locus_tag="Rmet_3984"
FT   CDS_pept        complement(550415..551836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebQ"
FT                   /locus_tag="Rmet_3984"
FT                   /product="putative transporter; MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3984"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10852"
FT                   /db_xref="GOA:Q1LG74"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG74"
FT                   /protein_id="ABF10852.1"
FT                   /translation="MASPSRSPPRSMQPHQGLPYPQRVWAILTVFCGLIMAVLDGSIAN
FT                   IALPSISRELNAEAASTIWVVNAYQLTVTICLLPLSSLGDILGYKRVYRTGLAIFLIGS
FT                   LIAACAVNLPMLVAARVIQGIGGAGIMSVNTALVRFIYPPTKLGRGIGLNALVVGVTIA
FT                   VGPSLGALILGISSWQWLFAVNVPVAIVALWISRWALPDTPAQPRAFDYPSAVLSAVVF
FT                   GMFILGVDSMGHATLRVVGAIGIALAIVLGWLLVRRQRGRPAPLVPVDLFASRAFTLAV
FT                   GTSFCSFMTQMLAFVALPFYLEYQLGRSLQETGLLITPWPLMVALMAALSGRLSDRYPA
FT                   SILAGAGLIMLTTGLIGLAWLSPTASSFDIAWRTALCGIGFGFFQSPNNRAMIGATPRE
FT                   RSGGASGAQATTRLLGQTTGTAVVALLFSLDNAGAARTALFAAAGVAAIGAIISFSRLR
FT                   DAQPAPAEGAAEPDA"
FT   gene            complement(551994..555464)
FT                   /locus_tag="Rmet_3985"
FT   CDS_pept        complement(551994..555464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3985"
FT                   /product="signal transduction histidine protein kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3985"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10853"
FT                   /db_xref="GOA:Q1LG73"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG73"
FT                   /protein_id="ABF10853.1"
FT                   /translation="MQQVLDRTQESLAQAFASLARNARRQRQLYYATVGLLIAIVIVSA
FT                   ILLGGLAAAKQLDIRRSRLAQYVSAISLQLQSDASFLRRTTLTVAHYLNAHSDSPTDPD
FT                   LLERIRRTGVAVAPDGRYTLLIPSSTQQAWGRSLPERVWQLQQIAIAALTTRLAFELDN
FT                   PAYVVDANAEYAVILTPSPMSLDAVLLISEQSDPVTVLRDKIVQALQAQTGQELPRSGE
FT                   QVWIGPVEDPVLHSQVMTSVAATTAGDGHRPALIASSTPVNAFLSQLKRPSGAAMLLLL
FT                   NRAEDRIDISPSGSSLEVAERILSRTRRLPPDTLRLGRSGLVLVQPLRQEFGSLVYFLS
FT                   YGKLFSSIYYELIAIGSLSMMLIIAIVISARYWDIHLLRHGQAEATRALENETINHILV
FT                   NATPIGLCIVGQQDHVIVTSNLVADTLLGFSQGATMPARIIDALRQRPSQAFSDAFGPI
FT                   AQIRVPGCANADAAQQCNSTTEAAPASKPQFLQITSAPAKYRGECVLFCAIQDVTAQQQ
FT                   LEQKLRSAQQATEAMMRARSNFFAAMSHEIRTPLNALLGNLELLGRSAGLEAHATRLRA
FT                   LQSSSEGLRRIVNDILDFSKIDAGEMKLVSAPFNPLDELESLSLSYAPMVTDRPIRFYA
FT                   HLSPTLSTLLRGDRMRLAQIVNNLLGNAFKFTASGKISLSAEISRDAQGLATLVCRVRD
FT                   TGDGMSQALASRVFQPFVQGETSTTAQYSGTGLGLSICARLSELMGGHISVESVEGVGS
FT                   AFTVVIPFAEPAATAPPHGLTMLGGMVMVLCQETESGATLEAWLTRVGCQVHVLPASCA
FT                   AHAWLCTSHPQIMVVTGEYGLDTIRSLRTVCPTNAVWITRNGPDRPAELESGIFEVSAY
FT                   SHTAILAGVKAALVAPPRLVETTNRTASASENARPEAASHSPHQHGTVLVAEDNPLNRM
FT                   LIAEQLETIGWASIVVNDGRQALAVLDQRVVDIVLTDIQMPVMNGYELLSAIKTKRPPL
FT                   PVFAFSAVTHAGQASDWQARGFDGYIAKPVSLAELEHALHGVSSQLAVDAARSTPASTG
FT                   SPTDIVAGADRERYLALLREHLQTDEPKLAGILLSRNTQALGQWAHRCAGAFLIVGATT
FT                   IVKLCRAVERLCDDGNEWSPLLETEARALQAAVHDFRASPNQPEETSTT"
FT   gene            complement(555473..556126)
FT                   /locus_tag="Rmet_3986"
FT   CDS_pept        complement(555473..556126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3986"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3986"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10854"
FT                   /db_xref="GOA:Q1LG72"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG72"
FT                   /protein_id="ABF10854.1"
FT                   /translation="MIAKTIRVALADDHPLVVVALRDCLQRTPGFQVTCECTNGSELVD
FT                   ALTQNPVDVAVTDFSMGHGDTSLDGFNLLRKLHRRHPDTRIVVVSAQTNPGVVSRAMKL
FT                   GARAFVSKEDELDEIVRACIHVTVSNGHFYSPSIRAVLDSATAAATAAPATDLTLRELD
FT                   VVRLYAQGFQLTEIANKLGRSVSTISSQKTVAMRKLSVQTNTDLIRYAYENGLI"
FT   gene            complement(556505..557440)
FT                   /locus_tag="Rmet_3987"
FT   CDS_pept        complement(556505..557440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3987"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3987"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10855"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG71"
FT                   /protein_id="ABF10855.1"
FT                   /translation="MQTKSSTLRETEQQRQTILQTARAQAEALNGMYQNTLSAFLVAPN
FT                   AMPLPRAARAMFWLGRLRQWRAIDLSGDEACSPPNVTSLQLGVIESIAGTHALALHKEK
FT                   WSGPHSRQAYERDMALQVAMLLALEWRELAAFALQAWFGTNSELASLHPVSGMTGLIIG
FT                   VAGQALGVGVPQVTFQKGDAVLSKIVNHWQDSDIAFAPLARELADRHVNQCRLDTDHSL
FT                   FDFDHPVEQAIPVELLMLLRLRDGDKVPAWLARHGAFSHPAAVMLKATTPSQSQLCHSF
FT                   ITSATTLLPQYGDLSAALDRQISASRKLSS"
FT   gene            557519..557953
FT                   /locus_tag="Rmet_3988"
FT   CDS_pept        557519..557953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3988"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3988"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG70"
FT                   /protein_id="ABF10856.1"
FT                   /translation="MKCAIYTVTLRTSAASQYIRYGHGLLSRATCRWFWWHSLSRAWQL
FT                   VFVASRRTTPAWRCAMAMRQFAEFPANERQDLEALFRQVGLAAQEFEVFDVNGTSARQV
FT                   TVRRQRTGAESVYEAGPGSAWIEEFESDLECGLFGQVSTQ"
FT   gene            complement(558011..558454)
FT                   /locus_tag="Rmet_3989"
FT   CDS_pept        complement(558011..558454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3989"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3989"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10857"
FT                   /db_xref="GOA:Q1LG69"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG69"
FT                   /protein_id="ABF10857.1"
FT                   /translation="MLVRLLYASRARQPLDADVLDAILDTSLEQNLRHGITGVLCHSNT
FT                   VFLQALEGDREAVSRLFLNIGRDDRHHHVVLLSYEEIAERAFAGWSMGRVNAGRINAAT
FT                   LLKYSAQGELDPCRMPGAASLALLTELIAGASIIGRGGERGRH"
FT   gene            complement(558478..559203)
FT                   /gene="folE"
FT                   /locus_tag="Rmet_3990"
FT   CDS_pept        complement(558478..559203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="Rmet_3990"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3990"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10858"
FT                   /db_xref="GOA:Q1LG68"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG68"
FT                   /protein_id="ABF10858.1"
FT                   /translation="MSHKDQSDRPEHTPTASPVSNRIRARIEAAGERFHANDNISRHIE
FT                   HGELEALQAEVEARMEDVLRTLVIDVDQDHNTRETARRVAKMYLKEIFAGRYAKAPDVT
FT                   EFPNVEQLNELMIVGPIRVRSACSHHLCPIIGSLWVGVMPNRHSNLIGLSKYARLAEWI
FT                   MCRPQIQEEAVAQVADLLQEKMNPDGLAIVMEAEHFCMHWRGVRDTDAKMTNSVMRGSF
FT                   LKDDKLRREFLTLLNLNRR"
FT   gene            complement(559311..560570)
FT                   /gene="arsB1"
FT                   /locus_tag="Rmet_3991"
FT   CDS_pept        complement(559311..560570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB1"
FT                   /locus_tag="Rmet_3991"
FT                   /product="Arsenical pump membrane protein, putative
FT                   arsenite permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10859"
FT                   /db_xref="GOA:Q1LG67"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG67"
FT                   /protein_id="ABF10859.1"
FT                   /translation="MPAYATPLIWSVAALSTAGVLFRPFRLPEPFWAMAGALVLCVAGL
FT                   LPWRDALQAVARGNDVYLFLAGMILISELARKTGLFDHVAALAVRAARGSARKLFALVY
FT                   GFGIAVTAFMSNDATAVVLTPAVIAATRAARVKHPLPYLYACAFIANAASFLLPISNPA
FT                   NLVLFGDRMPPLTSWLARFTLPSVVAIAMTFIVLYWTQRDALAEPIENDVPTPPLTLQA
FT                   WLTTLGIMLTGAALLTASLHGQDLGWPTFIGGLLTLAVVCATQPRLLVPALKEVSWGVL
FT                   PLVAGLFVLVAGLAQTGLTAQLAHWVRMLSGLQGPEAVLGAGVAGVLVGITSNIVNNLP
FT                   AGLFAASALAAGHASDTVTAAVLIGVDLGPNLSITGSLATLLWLTALRREGHMVGAGTF
FT                   LKTGALVMPLALLPALAVLR"
FT   gene            complement(560582..562645)
FT                   /gene="mrcB"
FT                   /locus_tag="Rmet_3992"
FT   CDS_pept        complement(560582..562645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="Rmet_3992"
FT                   /product="fused peptidoglycan glycosyl transferase ;
FT                   transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3992"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10860"
FT                   /db_xref="GOA:Q1LG66"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG66"
FT                   /protein_id="ABF10860.1"
FT                   /translation="MRAMKKIAVKAAGVVAALGAAGVLLVGFAAVVSLRQLPSVDALRD
FT                   YRPQVPLRVFTSDDVLIGEFGAEHREFIPIERMPKLMTEALLAAEDDQFYNHAGVDIPG
FT                   LVRAALADLGEGYAQGASTITMQVARNFYLSREKTLARKWYEVLLAWQIDRTLPKDRVL
FT                   ELYMNQVYLGEHAYGFGSAAQTYFGKPLASLSLAETAMLAGLPKAPSTMNPQVNYPRAK
FT                   RRQEYVLGRMLALGMITQDQYREARGAQLVVSRDANGSFSGHAEYVAELARQLAFDRFG
FT                   DEAYTRGINVYTTVSSVRQTLAYDAVQAGLASYGKRHGSAKAQVALPQAALVSLDASTG
FT                   AIEAMVGGASFDTSRFNHATQAQRQPGSTFKPFIYSAALERGISPGTLINDAPLDDPRW
FT                   QPSNDDNRFVGPITVRQALAESRNLPAIRTLRAIGIPYAIDFAGKFGFSTKRLPPYLPL
FT                   ALGTGTTSPLRLAAAYGVFANQGHRIEPYLIDKITDGDGNVLFAAQNAAEVTRVISERN
FT                   AFVMNSLLQSVVDEGTGTGVKRYLRRDDVAGKTGTTNDSVDGWFAGYAGDVVTVTWMGF
FT                   DDNRSLGRHEFGATTALPIWAAYMEGRLAGAPEASFPTPPQLARLNDDWAYAENADGSH
FT                   GIASIGFPPPTVTPDVPAEGSPPGAPTAAAPTPAALEVSPQVSSQRPAATGL"
FT   gene            complement(562647..563537)
FT                   /locus_tag="Rmet_3993"
FT   CDS_pept        complement(562647..563537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3993"
FT                   /product="conserved hypothetical protein, putative
FT                   hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3993"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10861"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG65"
FT                   /protein_id="ABF10861.1"
FT                   /translation="MFSLLRRTLAATLVTAGGFVCYWTYLTINQERLLFDARRRPPRDL
FT                   PDGIVGYSHAVPGGQFRGYCYHADHEGVGDLLFYLPGRGEDVLETLQFVKWLPHGMGFA
FT                   TFDYRGIGHSDGMPSEAAAVADASQFLLHLRRAFPGVRVHVVGRSLGTGVAIQLADLQD
FT                   FESLQLITPYDSLLEIVRKRFPLVPLRQLMRHHFDSISHCKKVVQSTKVLLAESDDVVP
FT                   HECSERLMAAWPGPVALQMISGVDHYTIIERWETWHALCEFAREVPHQPPDRTQQHPPS
FT                   DHTESGVPLPLPAAR"
FT   gene            563682..563915
FT                   /locus_tag="Rmet_3994"
FT   CDS_pept        563682..563915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3994"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3994"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10862"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG64"
FT                   /protein_id="ABF10862.1"
FT                   /translation="MNDEQKRAEEAQAMERVVNATRQVQVAFTALLSQYPPQGAGKPSK
FT                   LALQTFDAALQGLEDAQAAFDEILNDLLDGNR"
FT   gene            complement(563922..566246)
FT                   /gene="bglX"
FT                   /locus_tag="Rmet_3995"
FT   CDS_pept        complement(563922..566246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="Rmet_3995"
FT                   /product="beta-D-glucoside glucohydrolase, periplasmic"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3995"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10863"
FT                   /db_xref="GOA:Q1LG63"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG63"
FT                   /protein_id="ABF10863.1"
FT                   /translation="MRMLSTLALAAGLACAPLIAPTSVSSAYAADIQATGKSDKQALIA
FT                   DLIGRMTLDEKIGQLRLISIGPEMPQPQLIKEIAAGRVGGTFNSITQAENRPLQDAAVM
FT                   QSRLKIPMFFAYDVVHGHRTVFPISLGLASSWDMGLVEKTARISAVEAAADGIDATFAP
FT                   MVDISRDPRWGRTSEGFGEDPYLVSQCARASVKGFQGASPANADSLMAFVKHFALYGAV
FT                   EGGRDYNTVDMSLQRMYQDYLPPYRAGLDAGAGGVMIALNSINGQPATSNRWLLHDLLR
FT                   KEWGFKGVTVSDHGAIDELLRHGVASNGREAAKLAIEAGVDISMADTRYLEQLPTLVKS
FT                   GAVPVALIDDAVREVLGAKYDMGLFADPFRRIGVAAQDPADVDAESRLHRAEAREAARK
FT                   SIVLLENRNQTLPLRKSGKVAVIGPLTDAQIDILGSWSAAGKPRQSVSLLQGMRDALAG
FT                   KGEVIYARGANVTDDARVVGYLNFLNWDSPEVVQDKRSPGEMIDEAVRTARDADAIVVA
FT                   VGESRGMSHEASSRTSLSLPGSQEALLKALKTTGKPLVVVLMNGRPLTVNWEKDNADAM
FT                   LETWYAGTEGGHAIADVLFGDENPSGKLPVSFPRSIGQIPTYYNHLRIGRPFTPGKPAN
FT                   YTSQYFEEESGPLYPFGYGLSYTTFSVSEIRLSSPKLARNGTINASVTVKNTGKYAGET
FT                   VVQFYVQDVTASVVRPVKELKGFRKVLLAPGESRAIEFPVTEDTLKFYNARLEYVAEPG
FT                   DFNLQIGLDSASVREARFTLE"
FT   gene            566454..568064
FT                   /gene="mdoG"
FT                   /locus_tag="Rmet_3996"
FT   CDS_pept        566454..568064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoG"
FT                   /locus_tag="Rmet_3996"
FT                   /product="periplasmic glucan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10864"
FT                   /db_xref="GOA:Q1LG62"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG62"
FT                   /protein_id="ABF10864.1"
FT                   /translation="MVLAVFAASLRNRMKLLLPGLAFAGCLVGVSPAAHAFSLDDVTAR
FT                   AKKLAEQPYAAPVSNLPPVFAQMQFADYIKIQPKLDHLAWNDQGTPFRLGFYHQGMQFS
FT                   SPVRISEIAGGKVQEIRYDASRFDFGDLKLDRAATNKLGYAGFRVLYPVNRPDKLDEVM
FT                   SVLGASYFRVIGKGQVYGLSSRGLAINTGLSEPEEFPAFREFWIERPNPQDKRVVFYAL
FT                   LDSKSATGAYRFELHPAEDATLKVQARVFMRGPVTKVGIAPLTSMFLFGPNQQRDANNF
FT                   RPALHDSNGLAIHTGDGEWLWRPLNNPKHVALSTFAVNNPRGFGLLQRGREFSAYEDLK
FT                   DRYDLRPSAWIEPQGDWGKGKVELVEIPTPDETNDNIVAFWTPDQLPPKGQPIRADYTM
FT                   HWTMDERAIFAKDLAWVKQTMRTAGEITQANLIRHLDGSLGFVIDFEGPVLANLPPNTQ
FT                   VQPSFSVSDNAEVIENVIQPNPVTKGYRVTLRIKVKDPKKVVEMREALVSNGKVLSETW
FT                   SYQIPPDTVNQVVSGQTVR"
FT   gene            complement(568077..568307)
FT                   /locus_tag="Rmet_3997"
FT   CDS_pept        complement(568077..568307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3997"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3997"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10865"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG61"
FT                   /protein_id="ABF10865.1"
FT                   /translation="MLPDSESLLLLVTREMPFGKHKGTLIADLPGNYLNWFAREGFPPG
FT                   EIGRLLALMHELDHNGLAHLLKPLRAQMGRR"
FT   gene            complement(568381..569091)
FT                   /locus_tag="Rmet_3998"
FT   CDS_pept        complement(568381..569091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3998"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3998"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG60"
FT                   /protein_id="ABF10866.1"
FT                   /translation="MPVSLLRRALTIGVMLATCGMTSNTLATTASRGTIALVMQSNGPN
FT                   ADVDQNIRIRLEGRGFTVRMLNQDTPASNAGDVRLVILSSTISAKQVSAGWRELAVPLL
FT                   TWENDLLDDLAMTGKRLDTDYGESRRERFVWLVNAPHPVAAGLPAGATNVYRKQAAMNW
FT                   GKPGLGASIIATLYGQPEKAVIFTYEKGATMDYESLAPARRVMFFLGNDTFTNLSGAGI
FT                   KLFDAAIDWATGDR"
FT   gene            complement(569101..571566)
FT                   /locus_tag="Rmet_3999"
FT   CDS_pept        complement(569101..571566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_3999"
FT                   /product="putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10867"
FT                   /db_xref="GOA:Q1LG59"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG59"
FT                   /protein_id="ABF10867.1"
FT                   /translation="MPSRILALPRRRSTAVLKNTILLAALYGAGALSAIDVIAQGTTAQ
FT                   TMSPLRTYDIPAGPLQATLNRFGREAGILLAFTPEQAANHQSPGLRGQYSVHDGLDTIL
FT                   QGTGLAASAQANGSYVLARKVTHAEGQPATDGHVAALPPVTVSADAENYRAPPTTSVLR
FT                   SDVPLMDTPQAVNVVPAQVMADQRPRNLDDAVNNISGITQGNTLAGTMDAIMKRGFGNN
FT                   RDGSIMRNGMPLVQGRSLNANADSVEVLKGPASLLYGIMDPGGVINIVSKRPSLQRSTS
FT                   LSLLGTTYGHGKNGAGGTIDTTGGIGTTGLAYRLVADYVDESYWRNFGEHRETLIAPSI
FT                   AWYGQDTQVNLSYEYRKFLYPFDRGTALDPRTMEPLPIPSRRRIDDPLNEMHGESHLAQ
FT                   LTVDHQFHTDWRAHFAYSYNREGYDAGQLRNTRINPVTGAVTRRNDGTDGALSTDSYGV
FT                   AYVSGNFRVAGLRNELQMGMDSEYRRIYRQNMLRQKATAPFNFWNPVYGREVPSTTISA
FT                   SDSDQTDTLHATSLFFQDSLYLTDKWILVGGARYLSYSQVAGRGRPFVTNTNISDQKWL
FT                   PRAGIVYKWTPALSLYGSYTQSLKPNSTIAPLSGGAVIDASIAPEQAQSWELGGKVDLA
FT                   SGVSGTLALFNIDKRNVLVSQFNPTTGLTDWRTSGRARSSGVELDVTGQIGLRWNVIAS
FT                   YAYIDAKTTEDPKYAGNRLWNVAQHTAALSAVYDFGEIFGGDRLRLGGGAHYVGNRPGD
FT                   SANSFWLPAYTVFDAFATYETRVSGQKMRMQLNVKNLFNRVYYPSAVNQYAVAVGNPRQ
FT                   VTLLTTFEF"
FT   gene            complement(571663..572607)
FT                   /gene="fecR"
FT                   /locus_tag="Rmet_4000"
FT   CDS_pept        complement(571663..572607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecR"
FT                   /locus_tag="Rmet_4000"
FT                   /product="FecR-like transmembrane sensor, Fe2+-dicitrate
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4000"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10868"
FT                   /db_xref="GOA:Q1LG58"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG58"
FT                   /protein_id="ABF10868.1"
FT                   /translation="MALAAVEWLVTLQGGETDGASHAAWRHWLSQHPDHARAWARIEAV
FT                   NARLRDVASPLTTAVAHAALTTPRSASRRRAVQALVVAFTGGAAAWAARDHAPLQDWLA
FT                   DVSTAVGEQRLLSLADGTQIRLNSDTAIDIAFTATERRVVLRRGEIHVQTAPDRHWPAR
FT                   PFIVATASATLRPMGTRFAVRVSGDAGWIAVTEGAVAVQPQADPTGGRIIAAGKQARFT
FT                   PASVGAPTPLPESDTAWTDGMIVATDMRLADFLAEVDRYRPGRLRCAPDVADLRVSGTF
FT                   PVADTDRILDALRTALPVRIHFLTRYWTTVLPA"
FT   gene            complement(572637..573146)
FT                   /gene="rpoK"
FT                   /locus_tag="Rmet_4001"
FT   CDS_pept        complement(572637..573146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoK"
FT                   /locus_tag="Rmet_4001"
FT                   /product="RNA polymerase sigma K factor (ECF:FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10869"
FT                   /db_xref="GOA:Q1LG57"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG57"
FT                   /protein_id="ABF10869.1"
FT                   /translation="MAADAGPHHDIQALYSCHHRWLLGWLHRKIGCWHRSADLAHDTFM
FT                   RLLAREEALAIAEPRAFLTTVAQRVLANQWRREKLEQAYLEALASRPAALAPSEEERAI
FT                   LLETLNDIAERLDGLPVVVKRAFLMAQLEGQSQAEIASALRISVTTVKRYLVRAGTKCY
FT                   FAMSLA"
FT   gene            573157..573357
FT                   /locus_tag="Rmet_6639"
FT   CDS_pept        573157..573357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6639"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45239"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY69"
FT                   /protein_id="ADC45239.1"
FT                   /translation="MSPDGPAEVRLLVNENRYCMDCREVMQCSEWCSYHAERLVAPGGT
FT                   AGESKEMIKALAGAVKAGASG"
FT   gene            complement(573384..574598)
FT                   /locus_tag="Rmet_4002"
FT   CDS_pept        complement(573384..574598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4002"
FT                   /product="Probable two-component response regulator with
FT                   EAL domain, transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10870"
FT                   /db_xref="GOA:Q1LG56"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG56"
FT                   /protein_id="ABF10870.1"
FT                   /translation="MPAQFEALRVLIVEDHPFQRAVAGHLLHRLGAMNTHAAADGREAE
FT                   QALREQAFDLVLCDIDMPNCNGPELMARLTRDREHAFFGTPPTWAWTSSLAPDILDSHR
FT                   AFASEHIFPRVYALAKPLNLITLQAILEEVATSKSVLNIANHNGPTDDELRDLTSHPDA
FT                   LVFMLQPQFHIATGRLAGAEALCRWQHPRLGLIPPTLFIPRLEALDAADVIFLTAIDRC
FT                   LAALILLAKAGVAVPISVNASAQTLCRPGLVERLESVVAASGVPRARLTLELTEETTVR
FT                   DPFALGIALNRLRLLGYRIAIDDFGIGIATLKLLADLPFTQMKVDKSFVSQMLAGNQRA
FT                   TICRSIIRLAKDLSMECVAEGVETPAQCAALHALGCDIGQGYLWAPPEPIDVFLNAAPG
FT                   RYGQE"
FT   gene            574794..575522
FT                   /locus_tag="Rmet_4003"
FT   CDS_pept        574794..575522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4003"
FT                   /product="putative aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10871"
FT                   /db_xref="GOA:Q1LG55"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG55"
FT                   /protein_id="ABF10871.1"
FT                   /translation="MKTIGLIGGMSWESSAEYYRLINQGMKARLGGHRNARSVMVTVCF
FT                   EEVKTLQHAERWEDLGNQMQQAARQVEAGGADFVVLCTNTMHKLAPAIEAVLDVPFLHI
FT                   VDPTADALRRAGIERVGLLGTRFTMEQDFYRARMEQRHGIQVVIPDQDDRTLVHDVIYD
FT                   ELCHGVVRSESRAVYQRIIESLKAGGAQGVILGCTEITLLIKPEDSALPTFDTTELHAM
FT                   AAVALAAGEVARWPEALLPG"
FT   gene            576113..577132
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_4004"
FT   CDS_pept        576113..577132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_4004"
FT                   /product="Transposase for insertion sequence element
FT                   IS1086"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10872"
FT                   /db_xref="GOA:P37248"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37248"
FT                   /protein_id="ABF10872.1"
FT                   /translation="MTRTKYQQLQPEERMRIEIWKAEDVSLRAMARRLGRAPSTLMREL
FT                   RRNATARGGYGAMSAQACRTQRLKASRPVAKLAPDGVLWGVVRHFLDQKWSPQEISATL
FT                   KRAFPDQPDLNVSHETIYNAIYAYPRGELRRQLIACLRQARTKRLPRSRGTDRRGQIPD
FT                   MVSIHVRPPEVNDRLMPGHWEGDLIKGAGNQSAVGVLVERMSRAVLLVKMPDATAASAL
FT                   AGFTGKLQSLVAPLRQTLTYDQGREMARHAELSAATGVRVYFCDPHSPWQRGTCENTNG
FT                   LLRQYLPKGTDLSVYSQEELDAIADSLNGRPRKTLNWHSPLQVLAQVLANPTDRLPVQ"
FT   gene            577169..578071
FT                   /locus_tag="Rmet_4005"
FT   CDS_pept        577169..578071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10873"
FT                   /db_xref="GOA:Q1LG53"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG53"
FT                   /protein_id="ABF10873.1"
FT                   /translation="MIYTVSGDWDAYGGHNAGWCQNLPAGNLSPIGNLRVKTKVYFSML
FT                   GTPVQRYWNDVYPTNLAGVGVRIYIWNPSSYYGTPTRATAIPLSFTADLQNSLPSMRPA
FT                   YGTGGLRVRVEVIKTAPNWQAGSLRFVGGQLRVTAADNASNSVTLTQVSIMGTMNTRSC
FT                   SVAAGSRNVSVNMREVAYPNGFSGRQAGAYGPTIPFRITMNCVSGPRTSIQFDPVTAIA
FT                   GKPDILGLTPNSSNASGIGVQLLSSVGVPLQLRTPVLLTARAPDGASTYSFGGRYILTG
FT                   EPVRGGRADATSIFTMVYE"
FT   gene            complement(578199..578834)
FT                   /locus_tag="Rmet_4006"
FT   CDS_pept        complement(578199..578834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4006"
FT                   /product="conserved hypothetical protein; putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10874"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG52"
FT                   /protein_id="ABF10874.1"
FT                   /translation="MPIRLSVPTVALAMLGTTSVAMAASPSFDCGNAKGQVEQLICKDD
FT                   TLARLDRETTRLYGMALDARSLPAPQKKTLLAEQRGWIKGRNDCWKASDAGVCVAASYL
FT                   ERIHELRHAYAGARTQDDKGISRGPFDIRCPDVKAVIAGTFVQTEPGFAYLRWLDQQLV
FT                   LTQTPAASGARYTATTANGEAVFWDKGPDAQLTLPGKADMNCRVGIRD"
FT   gene            complement(578858..579244)
FT                   /locus_tag="Rmet_4007"
FT   CDS_pept        complement(578858..579244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10875"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG51"
FT                   /protein_id="ABF10875.1"
FT                   /translation="MNSTTQPSLPTLTDFLGRPAPSHDNPRPDRLVKGNPDRTTWTHYS
FT                   ATQGDFDCGIWACEPGAWRIAFPAGKEEFFHVISGRLRITSLAGEAREFGPGDACVIPA
FT                   GFEGVFEVLEPVRKHFVVIDRNAS"
FT   gene            complement(579310..579801)
FT                   /locus_tag="Rmet_4008"
FT   CDS_pept        complement(579310..579801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4008"
FT                   /product="putative PilT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10876"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG50"
FT                   /protein_id="ABF10876.1"
FT                   /translation="MYLVDTNIISEQRKSARANPGVLEFFEDAAANGREIFLSVITLGE
FT                   LRRGVELKRFRGDHKQCQVLDDWVLTVHRRHTHNILGIDAQIVELWGHLSVPDTQNSLD
FT                   KLIAATALVHGLTVVTRNVRDFANTGVRILNPFSDVPSVRRVLALCPRLLRGRCQAARC
FT                   "
FT   gene            complement(579817..580194)
FT                   /locus_tag="Rmet_4009"
FT   CDS_pept        complement(579817..580194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10877"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG49"
FT                   /protein_id="ABF10877.1"
FT                   /translation="MATLAAPAIPRAGVFSFAAPLLPTRADSIALYQTSNLSAQTDTTF
FT                   HPAMVHDGDLFNDSARRSTMEMTHHPDTQCLNRATDGQCPVEAQDQPSNPAVAQSRSLA
FT                   ALILAIPPGDASDEWDFARVQ"
FT   gene            complement(580294..580884)
FT                   /gene="aroK"
FT                   /locus_tag="Rmet_4010"
FT   CDS_pept        complement(580294..580884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="Rmet_4010"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10878"
FT                   /db_xref="GOA:Q1LG48"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG48"
FT                   /protein_id="ABF10878.1"
FT                   /translation="MLPFGGTSVQRAILDQQTSGDNLFFIGFMGAGKTTIGRAVAHELG
FT                   RPFFDTDHEIETRCGVRIATIFELEGEEGFRQRESRVLDELTQRSGIVLATGGGAVLRP
FT                   ENRAMLRARGQVVYLDASLPEIWRRTRRNRNRPLLQTDNPRARLEALFCERDPLYREIA
FT                   HIVMPAHGGSIAQAVANVLARLDLAPPDPFPHA"
FT   gene            complement(580928..582307)
FT                   /gene="pcaK"
FT                   /locus_tag="Rmet_4011"
FT   CDS_pept        complement(580928..582307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="Rmet_4011"
FT                   /product="permease of the major facilitator superfamily;
FT                   Protocatechuate (4-hydroxybenzoaat) transmembrane
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10879"
FT                   /db_xref="GOA:Q1LG47"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG47"
FT                   /protein_id="ABF10879.1"
FT                   /translation="MSHAPHSATSTLDVQSLIDSQRFSAYQWLILVLCFLIVAVDGFDT
FT                   AAMGYVAPALVQDWGIEKSSLGPVMSAALFGLAFGAIFAGPMADRVGRKKVLVLSVFFF
FT                   GACSLATAFAPTIRWLTVLRFLTGLGLGAAMPNAVTLMSEYAPARRRAVLVNTMFCGFP
FT                   LGSAAGGFFAAAIIPQFGWHSVLVFGGVVPLVLAVVLVTTLPESVRYMVVRQYPADQIR
FT                   QVLARVTGARVDGAGVFTISEAAPASSSAIGTVLAPRYRLGSTMLWLTYFMGLVIFYLL
FT                   TSWMPTLMKDAGFSLQRASFLTALFPLGGGIGTIAAGWFMDRFNPNKVIAMTYALTGVL
FT                   IYAVGQVASGDQVVLGVLIFLAGTAMNGAQSSMPSLAAAFYPTQGRATGVAWMLGIGRF
FT                   GGITGALLGAELLRLHLGFDVIFTLLAIPAFAATAALVAKHVGARGAAPVDTGGAMVSG
FT                   H"
FT   gene            582249..582416
FT                   /locus_tag="Rmet_6640"
FT   CDS_pept        582249..582416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6640"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45240"
FT                   /db_xref="GOA:D3DY70"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY70"
FT                   /protein_id="ADC45240.1"
FT                   /translation="MSMSDWTSSVLVAECGAWDMIVSVSDLSATALAFLTGVWRGRFAF
FT                   IVLRANHCSQ"
FT   gene            complement(582586..583539)
FT                   /locus_tag="Rmet_4012"
FT   CDS_pept        complement(582586..583539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4012"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10880"
FT                   /db_xref="GOA:Q1LG46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG46"
FT                   /protein_id="ABF10880.1"
FT                   /translation="MHSSSPSREARIDTFRSRIRLRHLHCFVAVAQTQHLGRAGERLGL
FT                   TQPAVSKTLTELEELVGARLLVRQRAGTDLTAAGMRFLRQALRVLEDLDAVADSLAGAD
FT                   AARQERIRVGALPSIVPALLLEAVTDFRANHPEVGLAVQSGMNRTLIDLLKADVLDVVI
FT                   GRMDDPGAMEGLWFESLAAEPLVLAVRAGHPLAGNARPTMRDVLAWPMVVPAVGSIPRH
FT                   STESLLARHGFALPAGCLETADGYLGRLVTQQGDSVWAAPLSATRRAVAAGELVLLSFD
FT                   TQGTEEPIGLLRRSDRTLEPVAEAFADTIRRIAASR"
FT   gene            583645..584358
FT                   /gene="pcaH"
FT                   /locus_tag="Rmet_4013"
FT   CDS_pept        583645..584358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="Rmet_4013"
FT                   /product="Protocatechuate (dihdydroxy benzoate)
FT                   3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10881"
FT                   /db_xref="GOA:Q1LG45"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG45"
FT                   /protein_id="ABF10881.1"
FT                   /translation="MPPRSARPDQYRRPYWNTQPEYRFDPYASTQLRSPSQSLIALPQS
FT                   LSEVTGPTFGPEFVREGDNDLTVGNGGEPIGERILVTGRVLDENGHPVPNALIEVWQAN
FT                   AAGRYVHKRDQHDAPLDPHFSGQGRTITDADGRYQFKTIKPGAYPWRNHHNAWRPQHIH
FT                   FSLFGNAYATRLVTQMYFPGDPLLPFDPIFNCVPDEKARNRLISTFDWENTAPEYALGY
FT                   RFDIVLRGRDATPME"
FT   gene            584363..584932
FT                   /gene="pcaG"
FT                   /locus_tag="Rmet_4014"
FT   CDS_pept        584363..584932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="Rmet_4014"
FT                   /product="Protocatechuate (dihydroxy benzoate)
FT                   3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10882"
FT                   /db_xref="GOA:Q1LG44"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG44"
FT                   /protein_id="ABF10882.1"
FT                   /translation="MLYATASQTVGPYLHIGLAGLNCADLTADAPDLAAQRIVIEGRVI
FT                   DGNGEPVPDGMVEIWQANPAGRYRHPEDKRELGLVPGFTGFGRVPTEGDGSFRFVTVKP
FT                   GAVPDVEGRPQAPHIMVSVFMRGLVKHVASRIYFPEETTANAADGVLALVPAERRATLI
FT                   AQPNGQNSYRWDVVLQGAGETVFFDI"
FT   gene            584937..586409
FT                   /gene="pcaB"
FT                   /locus_tag="Rmet_4015"
FT   CDS_pept        584937..586409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="Rmet_4015"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10883"
FT                   /db_xref="GOA:Q1LG43"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG43"
FT                   /protein_id="ABF10883.1"
FT                   /translation="MHCKQGAGFPPCPALHDNRRITTGLPPPTMPTLSRLTDPMFGSPA
FT                   VLEVFSDTGTVRRMLDAEAALARAEAQCGVIPATAAAVITEVCGRVDVIDLEALAQAAV
FT                   SAGNLAIPFVKQLTAAVTQRDADAGRYVHWGATSQDIIDTALVLQLRDALREIVVDLLR
FT                   AGDACATLAATHRATPMVARTWLQHALPTTFGCKAGGWLDALRRDLTRLDHVGAQVRVI
FT                   QFGGAAGTLASLGDDAPAVAARFAAELQLDVPALPWHAHRDRLVEVATALGMLTGTLGK
FT                   MARDVSLMMQTEVGEVAEPSGPGRGGSSTMPHKRNPVGCAAVLTAATRVPPLVATMLAG
FT                   MTQEHERALGGWQAEWDTLPQIVTLAAGALRQMADVASGLEVDEARMRANLDITHGLIL
FT                   GEATMLELGRRIGRLQAHHLVEQASRRAAAEDTTLRIALARTLAEDANHAGLLDDAALD
FT                   RLSDPAQYAGQSERFTDAAVAAWQALRANPQN"
FT   gene            586443..587621
FT                   /gene="pcaD"
FT                   /locus_tag="Rmet_4016"
FT   CDS_pept        586443..587621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="Rmet_4016"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10884"
FT                   /db_xref="GOA:Q1LG42"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG42"
FT                   /protein_id="ABF10884.1"
FT                   /translation="MPYLDQAGARLFYTVDGPEDAPVIVFSNSLGTDHTMWQPQADALA
FT                   GRFRVVRYDVRGHGRSTTTETSLTVETLGRDVLAILDALHVDKAVFCGLSMGGLTGMWL
FT                   GAYAPERFSKIVLANTAPKIGTAESWNTRIDAVIRDGLGGMVDASLGRWFTPTFVATSG
FT                   RALDDLRAVLAGLDPRGYAASCAAVRDADLREAVKTMPVPVLVIAGSDDPSTTAEEGRA
FT                   LAAAIPGAIYVELHAAHLSNREQPGRFTAALLDFINGRLPVTDDQARYDAGLAVRREVL
FT                   GSAHVDRSLQRLTPLNEEFQNLITRYAWGEIWTREGLPRHSRSLITIAMMVALNRSEEL
FT                   KLHLRAAANNGVTRDEIKEVLLQTAIYCGVPAANSAFHMAGEVFAELDRARG"
FT   gene            complement(587625..588554)
FT                   /gene="pobR"
FT                   /locus_tag="Rmet_4017"
FT   CDS_pept        complement(587625..588554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobR"
FT                   /locus_tag="Rmet_4017"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10885"
FT                   /db_xref="GOA:Q1LG41"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG41"
FT                   /protein_id="ABF10885.1"
FT                   /translation="MRTVPTYSLYGVNSSEPLLDQLHFESIASRSQLYAWEIKPHRHER
FT                   FLQFLYIHRGSGEALLEGRKERLASGSLITVPPHHVHGFVFAPDVDGIIVTMTDTYLRT
FT                   LLAGLPGTVPLFEHPRHDRVARRHALAGTLALFREEMESVSPWRGASLSALLTLMLVGI
FT                   ARIAEASAPAKTQAGSRPARHFRQFQQLLETDYREQNDIAYYAGAIGVTPTQLNRICRQ
FT                   LAGHSALQLIHARVLAEAQRDLLFSDLDIKQIAMTLGFSDAGYFSRFFARLTGQTPTAF
FT                   RESGRARLPAFAIKDALNATDMAGAADA"
FT   gene            588682..589878
FT                   /gene="pobA"
FT                   /locus_tag="Rmet_4018"
FT   CDS_pept        588682..589878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="Rmet_4018"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10886"
FT                   /db_xref="GOA:Q1LG40"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG40"
FT                   /protein_id="ABF10886.1"
FT                   /translation="MAPNGSINSRSTRVAIIGAGPAGLLLGQLLTVAGIDNIVIEQRSP
FT                   EYVLGRIRAGILECVTVEALKRAGVDGRLREEGLVHHGIELSFGGERHRIDFHALIGSD
FT                   VTVYGQTEVTRDLMAARQASGVPTVYEAEDVSLHDFDSNRPRVCYRKDGVEHEVVCDYI
FT                   AGCDGFHGVSRASVPEPSKRIFERVYPFGWLGILSETPPVADELIYASHERGFALCSMR
FT                   SKTRSRYYVQVPSTEKPEDWSDARFWDELRHRLDPAAAEALVTGPSIEKSIAPLRSFVC
FT                   EPMRYGRLFLAGDAAHIVPPTGAKGLNLAASDVLYLADGLIAHYQHDDSHELDMYSERC
FT                   LRRVWKAERFSWWMTSLLHRFPDADAFAHRIQQAELDYLVGSEAACRSLAENYVGLPR"
FT   gene            590045..590824
FT                   /gene="surE"
FT                   /locus_tag="Rmet_4019"
FT   CDS_pept        590045..590824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="Rmet_4019"
FT                   /product="5'-nucleotidase; stationary-phase survival
FT                   protein; protein damage control"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10887"
FT                   /db_xref="GOA:Q1LG39"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG39"
FT                   /protein_id="ABF10887.1"
FT                   /translation="MSEPVVERVLLTNDDGIDAPGLAVLAEVAATIAREVWIVAPEHDQ
FT                   SGTSHSISLHDPLRITEHGPRRFGISGTPGDCVVMAVRHVMRDTPPDLVLSGINRGGNL
FT                   GLETVFSGTVGAAMTGMLLGIRSIALSQVFKDRNAVKWGTSRALAGDVIRRLVTAGWSD
FT                   DACLNVNFPDVEADAAGPLTVSRQGVGLINAIDVRAHVDPRGFPYHWLQFSRGPRPDVD
FT                   DAEAMVVARGAVSVTPLRFERTSEEAAVALADNLMRA"
FT   gene            590949..591245
FT                   /locus_tag="Rmet_4020"
FT   CDS_pept        590949..591245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10888"
FT                   /db_xref="GOA:Q1LG38"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG38"
FT                   /protein_id="ABF10888.1"
FT                   /translation="MELAAQIPNLLNGLEWSGCALAMSGSFLVALHNRASRWGWIAYIC
FT                   SNLVWSAFALATGTYGLFVQQLGFTATSLYGLYRHTRYYRELAAHTPTAAAAA"
FT   gene            complement(591242..592027)
FT                   /locus_tag="Rmet_4021"
FT   CDS_pept        complement(591242..592027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4021"
FT                   /product="Ribosyldihydronicotinamide dehydrogenase
FT                   (quinone)"
FT                   /EC_number="1.10.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10889"
FT                   /db_xref="GOA:Q1LG37"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG37"
FT                   /protein_id="ABF10889.1"
FT                   /translation="MNVLLVYAHPEPKSLNGSLKDFAVQRLEAAGHQVRVSDLYAMQWK
FT                   APLDAGDSLAPANGTPFHPSLASKHAFENGLQSPDIAREQEKLKWADAVILQFPLWWFS
FT                   MPAILKGWIERVYAFGFAYGVGEHSDSRWGNRYGEGTLAGKRAMLMVTTGGWESHYDAR
FT                   GINGPIEDILFPIHHGILYYPGFDVLPPFLVFRSGRIDGDRYAAVTEELGQRLDTLFTT
FT                   EPIAFRPQNGGQYEIPSLILRSDISPGQTGFAAHVALEN"
FT   gene            592121..593017
FT                   /locus_tag="Rmet_4022"
FT   CDS_pept        592121..593017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4022"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10890"
FT                   /db_xref="GOA:Q1LG36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG36"
FT                   /protein_id="ABF10890.1"
FT                   /translation="MINLRRLDLNLLVTLDTLLAEHNVTRAAERLHYSQPSVSVHLARL
FT                   REIFDDPLLLPGPRGMRPTARAESLREPLREALAALEAAISPEHPFDPAEATQTWRVAA
FT                   TDYSETTVLLPALAGLRQAAPGTRMAVIELAPPRIARQAEQGDVDLVFHITTDAPESLH
FT                   LLPLFTERFVLAGRRGHPRLKRKPTIAQFCALEHVIVSPEGGGFVGATDEALAEVGLSR
FT                   RVVLSVPHFLYLESVLASTDLVAMLPARLVRDNDRLQIVDAPVEVPGFEMSMLWHERVH
FT                   RDPAHQWLRESIAAAVR"
FT   gene            complement(593140..593547)
FT                   /locus_tag="Rmet_4023"
FT   CDS_pept        complement(593140..593547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10891"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG35"
FT                   /protein_id="ABF10891.1"
FT                   /translation="MSLRSILFIAAVTITWNSPAAAAGCQYDMQCKGDRICQQGQCMTP
FT                   DSDDSDAATSKGQSGQSGQPAQPVQPAPPAQSAMRLAPASTTASAPRNCCTVAGKLRLT
FT                   TPQSGDAALMVGDACQGLTATGKPVPGTACN"
FT   gene            complement(593588..593923)
FT                   /locus_tag="Rmet_4024"
FT   CDS_pept        complement(593588..593923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10892"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG34"
FT                   /protein_id="ABF10892.1"
FT                   /translation="MWGGHEQRDCEALVIACRRSLADRILRPVSGAPACSARREGAIVK
FT                   QNGAACRTRPGVDEKADRRTIRAQSAHDRAMVVDPTIRSHQYCAQGYRRTMRRPMLKLC
FT                   DARVPYP"
FT   gene            594026..595174
FT                   /locus_tag="Rmet_4025"
FT   CDS_pept        594026..595174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4025"
FT                   /product="putative transmembrane transporter of the major
FT                   facilitator superfamily MFS"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10893"
FT                   /db_xref="GOA:Q1LG33"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG33"
FT                   /protein_id="ABF10893.1"
FT                   /translation="MLALGVGSFGIGTGEFVIMGLLPDAARDLAITIPEAGHLISAYAL
FT                   GVVIGAPLLAVLGARWPRRNLLIALMSVFALGNFASALAPGYLPMLAVRLLTGFPHGTY
FT                   FGVAALVAASLVARERRAQAVGLVMLGLTVATLVGVPIAAGIGTWLGWRTAFVIVGAIG
FT                   ALTALLVWRWVPFVPADRHASPLRELSALARKQVWFTLGIGAIGFGGMFAVFSYVKPTM
FT                   LEVAHMPASGIPIVLALFGVGMVAGNLAGAKLADKALMPTIGGVLLWSALVLGAFVYTA
FT                   PHPWLASLNVMLVGTAVALGPPLQIRLMDVAGDAQTLAAALNHSAFNMANALGAWLGGV
FT                   TIAAGLGWTSTGWVGMLLALAGMVVFGWSLMSASRRDITVTA"
FT   gene            complement(595239..595958)
FT                   /locus_tag="Rmet_4026"
FT   CDS_pept        complement(595239..595958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4026"
FT                   /product="periplasmic ligand-binding sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10894"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG32"
FT                   /protein_id="ABF10894.1"
FT                   /translation="MTPQDMQALETFLSQLVQARADGKDPQAAAMIADAAGRQPDAAYL
FT                   LVQRAMLLDRALVNAQAQIASLQQQLQQMQQGQGSRSFIDDANAWGNHPGRAMPGAAPS
FT                   ARPPYQAAPQYPSTPQPAPQPPQAARPGFLSGGLGGTLGSIATTAAGVAGGAMLFQGIE
FT                   NLFHRNSGGFFGQPAMGSAPTETVINNYYEDGSGSNGGSGGSNALLADNGNLDSGNLDN
FT                   GLDDFVDDDYRNDDSIF"
FT   gene            596091..597047
FT                   /locus_tag="Rmet_4027"
FT   CDS_pept        596091..597047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4027"
FT                   /product="prolyl aminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10895"
FT                   /db_xref="GOA:Q1LG31"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG31"
FT                   /protein_id="ABF10895.1"
FT                   /translation="MPEPRTLYPAIEPYETGTLDVGDGHVLYYERVGTRGAKPAVFLHG
FT                   GPGGGISPDHRRLFDPARYDVLLFDQRGCGQSTPHAELEANTTWHLVDDIEKLRERIGV
FT                   ERWLVFGGSWGSTLALAYAQTHPQRVSELVLRGVYTVSRAEVDWYYQFGVSEMFPDKWA
FT                   RFQAPVPEAERGNMMAAYRKLLTGDDKAKQVEAAQAWSVWEGETITLLPDAGISTKHAD
FT                   GHFALAFARIENHYFTHGAWLDDGQLLRDAHRLAGIPGVIVHGRYDMPCPVRYAYALHQ
FT                   AWPDADFHLIEGAGHAWSEPGILDQLIAATDHFAGKE"
FT   gene            597081..597380
FT                   /locus_tag="Rmet_4028"
FT   CDS_pept        597081..597380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10896"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG30"
FT                   /protein_id="ABF10896.1"
FT                   /translation="MRLYWILLRCTKITCRGCHCRESHQNLESAMVPCELCKSLLGRPG
FT                   YVPPHPRLIRTGDAISGTGAQAFLYTCQRCTQVIALATHDDGADYWTGHEGAMG"
FT   gene            complement(597444..599942)
FT                   /locus_tag="Rmet_4029"
FT   CDS_pept        complement(597444..599942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4029"
FT                   /product="putative mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10897"
FT                   /db_xref="GOA:Q1LG29"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG29"
FT                   /protein_id="ABF10897.1"
FT                   /translation="MFILARRARHCLPGLANPENFHEVQFAMSKISRLALSLVLAALFH
FT                   VAAPALAAESASDAEAQQIPVLTHAEAVAELKRLQTAQDQIKQQASSALGRTKINGLDD
FT                   DLKQLATDVDKLAASLTPQRAQLQSQLDVLGPPPETGKAKEAPAVVAQRAELTARKTQL
FT                   DDELKQAANSKDNIAHLQEQLAKLQRTQMKDQLALRSESILNPQFWKPLFGRAPEDPEQ
FT                   PGAFTDEIVPMFEHAWASGQRATTVILLVIALAAWTLGRRLLERGAAWLCLTQLPEARI
FT                   RRSALAFATTLATVIATATGVRIAFAAFTGGEDVPPEIQDLLNEIAKLAMTSALIAGLG
FT                   RALLCTRHPSWRLPALADRLALAMKPFPTVLAGLLLLAGTLEQFNRMADTSLPVTLLGR
FT                   GVVSLVVVLTIGAALLRASRVRAELLAAGEQPEARATLVGLIHVGVTLTVAISFGALLI
FT                   GYISIARFLTYELVWFDIVLCSLYLLTQLTRDICEATFSTQYGGGRVIKQLFGAGDTQL
FT                   EQASTVFSGLGSSVLLLLAVLALLTGGFGTTPADLFNSLLAMLGGEKLRALNIMPDRIM
FT                   NAVIALVVGIWLLRSVRRWLDAELLPKLCSESGLRASLITLFSNIGYVLLVLLVLSLLG
FT                   VKWENLAWIVSALSVGIGFGLQEIVKNFVSGLILLTERPVKVGDMVSLAGVEGDIRRIN
FT                   VRATEIQLADRSTVIVPNSQLISQNLRNVTMHNNTQGVATLQLTFPLNTDPEAVRDLLL
FT                   DVYRQNEAILDIPAPSVTFSQLAPNGITLSVTGYVNSPRIAGGTKSDLLFEILKRLRAE
FT                   EIPLSAPQTLRLENMEALGT"
FT   gene            600208..600615
FT                   /locus_tag="Rmet_4030"
FT   CDS_pept        600208..600615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4030"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10898"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG28"
FT                   /protein_id="ABF10898.1"
FT                   /translation="MTLAIDRFDHIVLNVKDVETSAAWYEQVLGMKREDFESRSGKRVS
FT                   VKFGQQKINLRPVGEDTVAWFTGVHPTSGSDDLCFITHMPPQEVVAHFLAHKVAVEVGP
FT                   VQRTGALGAITSVYCRDPDGNLIEVASYPAA"
FT   gene            600612..601001
FT                   /locus_tag="Rmet_4031"
FT   CDS_pept        600612..601001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4031"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10899"
FT                   /db_xref="GOA:Q1LG27"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG27"
FT                   /protein_id="ABF10899.1"
FT                   /translation="MKYALPLVLALLVHPVANAANAANATVGNVQTGKETFTRLCASCH
FT                   RVGPSARGAFGPQLNGVFGRKAGSTADYRYSDAMKTSNVVWSDATLGAFVQSPGKVVPG
FT                   TKMRFWGMSDPQQIADLLAYLRTFQ"
FT   gene            complement(601086..601403)
FT                   /locus_tag="Rmet_4032"
FT   CDS_pept        complement(601086..601403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4032"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10900"
FT                   /db_xref="GOA:Q1LG26"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LG26"
FT                   /protein_id="ABF10900.1"
FT                   /translation="MKTVGLYLLTALAEILGCYLPYLWLRQGASPWVLLPGAASLAVFA
FT                   WLLTLHPDASGRVYAAYGGVYIAMAIAWLWAVDGVRPSPWDIAGVAVALGGMAIIVFQP
FT                   R"
FT   gene            complement(601441..602421)
FT                   /locus_tag="Rmet_4033"
FT   CDS_pept        complement(601441..602421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4033"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10901"
FT                   /db_xref="GOA:Q1LG25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG25"
FT                   /protein_id="ABF10901.1"
FT                   /translation="MHYHLVIQLLPIAAMPIATDKLLHNIVSRLRLRHLPLLLALEQQR
FT                   SISRVAAEMNLSQPAVTKALREIEDIFTTPLFTRTRNGLEPTATGTAVLGHARMALADA
FT                   DALGRELAVIEAGLSGRLRIGAIPYTARAVLDAALAYGLNRTPRISVLVREGTTDELVV
FT                   ALRQHELDCAIARSFYLAGEDIVQQPLYREEPVLVVPSRAAARLSRGGLDWKRLAELDW
FT                   ILPPHHTPVRRTINTMFALAGVAPPLPIVETYSVKPMATLLRSQPHVITIVPRSVGAEL
FT                   VELGDAAMLPFSLSWDLPPVGLMWRRESQENELVTGLAAALRQAI"
FT   mobile_element  602491..612893
FT                   /mobile_element_type="transposon:Tn6048"
FT   gene            602639..602974
FT                   /gene="mmfA"
FT                   /locus_tag="Rmet_4034"
FT   CDS_pept        602639..602974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfA"
FT                   /locus_tag="Rmet_4034"
FT                   /product="Propeptide, PepSY amd peptidase M4 precursor
FT                   (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10902"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD1"
FT                   /protein_id="ABF10902.1"
FT                   /translation="MYRYTKLSLLAVAIAATGAVAYAANGGMENDALAISKAKIPLTQA
FT                   VTVAEQHANGKASRAEYENSKQGWVYDVEVVSGAKVFDVRVDADKGTVISSTEDKADHD
FT                   DDHDKRD"
FT   gene            603031..603627
FT                   /gene="mmfB"
FT                   /locus_tag="Rmet_4035"
FT   CDS_pept        603031..603627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfB"
FT                   /locus_tag="Rmet_4035"
FT                   /product="undecaprenyl pyrophosphate phosphatase (Tn6048)"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10903"
FT                   /db_xref="GOA:Q1LDD2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD2"
FT                   /protein_id="ABF10903.1"
FT                   /translation="MESLNHTFFLWLNAPEHPSALALTLATFFAEQLIWAVPLLIGIGW
FT                   LRGGEPTRKTMLVASASGLLGLLINQIIGLAWLHPRPFMIGLGHTLIPHVADSSFPSDH
FT                   LTLWWAVAFSLALQRGPRIAGVTLALLGVPIAWARIYLGVHFPFDMLGAIAVAAICAWL
FT                   TLREAHWYLLPSYQLSTGIHRRLFSGLIALGWVRE"
FT   gene            603698..604480
FT                   /gene="mmfC1"
FT                   /locus_tag="Rmet_4036"
FT   CDS_pept        603698..604480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfC1"
FT                   /locus_tag="Rmet_4036"
FT                   /product="putative permease MFS (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10904"
FT                   /db_xref="GOA:Q1LDD3"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD3"
FT                   /protein_id="ABF10904.1"
FT                   /translation="MNKLPTSSTTGWLNKVPEVALSFWIIKIMSTTVGETGADFLAVNA
FT                   GWGQGVTRTVMAALLAAALFMQLRTRRYTPWIYWLTVVLVSVVGTQITDLLTDGLGVSL
FT                   YISTSAFAVALAAIFFVWYRIERTLSIHDIVTRSRELFYWAAILCTFALGTAAGDLATE
FT                   ALGLGFTWGAVAFGVLIGITYTAWRMGGNAVLTFWIAYILTRPFGAALGDLLTQAKTYG
FT                   GLGMGAMWTSALFLTVIVMLVAVAQIGMNGRRSAQLVE"
FT   gene            604510..604959
FT                   /gene="mmfD"
FT                   /locus_tag="Rmet_4037"
FT   CDS_pept        604510..604959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfD"
FT                   /locus_tag="Rmet_4037"
FT                   /product="secreted protein (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10905"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD4"
FT                   /protein_id="ABF10905.1"
FT                   /translation="MLIKHSIARPVAAISAAVLVVLAAGCSKSADQNNASSASTTPAQT
FT                   VSALQVKTASKLGDLSAFRSIATDVAAIVDKGDLPAAKSRIKDLEVAWDSAEAGLKPRA
FT                   ADDWHLLDKAIDKSLATLRADTPSQADCKAAMDALLKTFNTLEGK"
FT   gene            604969..605727
FT                   /gene="mmfC2"
FT                   /locus_tag="Rmet_4038"
FT   CDS_pept        604969..605727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfC2"
FT                   /locus_tag="Rmet_4038"
FT                   /product="putative permease of the Major Facilitator
FT                   Superfamily (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10906"
FT                   /db_xref="GOA:Q1LDD5"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD5"
FT                   /protein_id="ABF10906.1"
FT                   /translation="MKTSTEHALAKVPEVTLGFWLIKIAATTLGETGGDAVSMSMNLGY
FT                   LVGTAIFAAIFLAAVVAQVKAKGFHPFLYWTTIIATTTVGTTLADFADRSLGIGYAGGS
FT                   SLLLALLLGSLFVWHRTLGSVSVSTVSSPKAEAFYWLTIMFSQTLGTALGDWTADTAGL
FT                   GYTGAAVVFGGLLALVVAAYYWTSVSRTLLFWAAFILTRPLGAVVGDFLDKPLSAGGLA
FT                   LSRYSASAALLAFMLTAILLFRQRAARTAH"
FT   gene            605750..606415
FT                   /gene="mmfR"
FT                   /locus_tag="Rmet_4039"
FT   CDS_pept        605750..606415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfR"
FT                   /locus_tag="Rmet_4039"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10907"
FT                   /db_xref="GOA:Q1LDD6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD6"
FT                   /protein_id="ABF10907.1"
FT                   /translation="MRVLLVEDDPMIGDAIQGALKDASYAADWVKDGQTALTTLGCQHY
FT                   DLVLLDLGLPGKDGLEVLASIRAKDNPVPLLIITARDGLDDRLRGLDGGADDYVSKPFQ
FT                   MAELLARMRAVLRRKGGTAAPVLSNGVVTLDPATKEACANDGPQVQLSNREFSLLQALL
FT                   VRPGAILSRSELEDRIYGWGEEVESNAVEYLIHALRRKLGGEVIKNVRGVGWMVSKGA"
FT   gene            606412..607743
FT                   /gene="mmfS"
FT                   /locus_tag="Rmet_4040"
FT   CDS_pept        606412..607743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmfS"
FT                   /locus_tag="Rmet_4040"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase (Tn6048)"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10908"
FT                   /db_xref="GOA:Q1LDD7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD7"
FT                   /protein_id="ABF10908.1"
FT                   /translation="MNESVQLKLSFTLSLAILVVAVVAGVFSFLSAFDEAHELQDDVLR
FT                   QVAQLMDRQRLLPAVPTTDIRLKDVDEESRVIVQRLGEVSPSTVGVDAGGVLPLPATLA
FT                   DGLHTLEVGGETFRVLVKTTASGERIAVAQESGFRNEIARDGALRTVMPFLILVPVLLL
FT                   IVADLVRKMFQPIAALSKEIDQRAEQELHPVEDRHLPVEVRPFVVAINRLLARVSQSME
FT                   SQRRFVADAAHELRSPLTAMSLQAERLAEAEMSSVARERLTVLRQGIERGRSLLDQLLT
FT                   LAKAQSATDLPKSPVSVQSIYRRVLEDLMPLAEAKHIDIGVEGALDAEVWASELDMIAV
FT                   VKNLVDNAIRYTPEGGRVDLSVGVSEGKVVLRIQDSGPGIPLAERDRVFDPFYRTLGSE
FT                   QIGSGLGLSIVQTIANRIGAEIRLDFSDQEKQTGLNVAVIAPMR"
FT   gene            607772..608203
FT                   /locus_tag="Rmet_4041"
FT   CDS_pept        607772..608203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4041"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10909"
FT                   /db_xref="GOA:Q1LDD8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD8"
FT                   /protein_id="ABF10909.1"
FT                   /translation="MVNSAGWFYWALLSAILAALTAIFAKVGIQGVDSDLATLIRTAII
FT                   IVVLSAFVAYTGKWTNPLELSPKTWLFLGLSGLATGASWVCYFRALKIGDASKVAPVDK
FT                   LSLVLVAVFAFAFLGERPSLREWSGISMVAGGVLLLAFK"
FT   gene            complement(608270..608884)
FT                   /gene="tniR"
FT                   /locus_tag="Rmet_4042"
FT   CDS_pept        complement(608270..608884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniR"
FT                   /locus_tag="Rmet_4042"
FT                   /product="serine-based site-specific recombinase activity
FT                   (resolvase) (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10910"
FT                   /db_xref="GOA:Q1LDD9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDD9"
FT                   /protein_id="ABF10910.1"
FT                   /translation="MLIGYMRVSKADGSQATDLQRDALIAAGVDPAHLYEDQASGKRED
FT                   RPGLLSCLKALRPGDTLMVWKLDRLGRDLRHLINTVHDLTGRGIGLKVLTGHGAAIDTT
FT                   TAAGKLVFGIFAALAEFERELITERTIAGLASARARGRKGGRPFKMTAAKLRLAMAAMG
FT                   QPETKVGDLCQELGITRQTLYRHISPKGELRLDGEKLLSQI"
FT   gene            complement(608945..610162)
FT                   /gene="tniQ"
FT                   /locus_tag="Rmet_4043"
FT   CDS_pept        complement(608945..610162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniQ"
FT                   /locus_tag="Rmet_4043"
FT                   /product="transposon related protein TniQ (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10911"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDE0"
FT                   /protein_id="ABF10911.1"
FT                   /translation="MKPAPRWPLHPAPREGEALSSWLNRVALCYHMEVSELLEHDLGHA
FT                   QVDDLDTAPPLALLAMLSQRSGIEPDRLRCMSFAGWVPWLLDSLDDQIPDALETYAFQL
FT                   SVLLPKLRRRTRSITSWRAWLPSQPIHRACPLCLNDPANQAVLLAWKLPLMLSCPLHGC
FT                   WLESYWGVPGRFLGWENADTASRTASDAIAVMDRRTWQALTTGHVELPCRRIHAGLWFR
FT                   LLRTLLDELNTPLSACGTYAGYLRQVWQGCGHPLRAGQSLWRPYETLNPAIRLQMLEAA
FT                   ATAISLIEVRDISPPGEHAKLFWSELQTGFTSGLPAKPPKPEPVNHWQRAVQAISEAII
FT                   EARHDPETARSLFALASYGRRDPASLEQLRATFAKEGIPPEFLSHYEADGPFACLRQND
FT                   GLSDKF"
FT   gene            complement(610159..611067)
FT                   /gene="tniB"
FT                   /locus_tag="Rmet_4044"
FT   CDS_pept        complement(610159..611067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniB"
FT                   /locus_tag="Rmet_4044"
FT                   /product="NTP-binding protein TniB (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10912"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LDE1"
FT                   /protein_id="ABF10912.1"
FT                   /translation="MEEYPIIDLSHLLPAAQGLARLPADERIHRLRADRWIGYPRAVEA
FT                   LNRLEILYTWPNKQRMPNLLLVGPTNNGKSMIVEKFRRTHPARADADQEHIPVLVVQMP
FT                   SEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSV
FT                   NRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMMLPVWEANHDCCSL
FT                   LASFAASLPLRRPSSIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHRT
FT                   LSMADYTGPSERRRQFERELM"
FT   gene            complement(611070..612788)
FT                   /gene="tniA"
FT                   /locus_tag="Rmet_4045"
FT   CDS_pept        complement(611070..612788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniA"
FT                   /locus_tag="Rmet_4045"
FT                   /product="Transposase (Tn6048)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10913"
FT                   /db_xref="GOA:Q1LG13"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG13"
FT                   /protein_id="ABF10913.1"
FT                   /translation="MLNTRVHQSEMSMATDTAPITEHGVATLPEQAWERARRRAEIIGP
FT                   LAQSETVGHEAADAAAQALGLSRRQVYVLIRRARLGSGLVTDLALGQSSGGKGKGRLPE
FT                   SVERIIRELLQKRFLTKQKRSLAAFHREVVRACKLQKLRVPARNTVALRIAGLDPREVT
FT                   HRREGQDAARDLQGVGGVPPPVSAPLEQVQIDHTVIDLIVVDERDRQPIGRPYLTLAID
FT                   VFTRCVVGMVVTLEAPSAVSVGLCLVHAACDKRPWLEGLNVEMDWPMSGKPRLLYLDNA
FT                   AEFKSEALRRGCEQHGIRLDYRPLGQPHYGGIVERIIGTAMQMIHDELPGTTFSNPDQR
FT                   GEYASEKMAALTLRELERWLTLAVGTYHGSVHNGLLQPPAARWAEAITRTGVPTVITRA
FT                   TAFLVDFLPIIRRTLTRTGFVIDHIHYYADALKPWIARRDRLPAFLIRRDPRDISRIWV
FT                   LEPEGQHYLEIPYRTLSHPAVTLWEQRQALAKLRQQGREQVDESALFRMIGQMREIVTT
FT                   AQKATRKARRDADRRQHLKATATPVKTTPPPGADMDGQQADNQPPAKPFDQIEEW"
FT   gene            612866..614740
FT                   /gene="ggt"
FT                   /locus_tag="Rmet_4046"
FT   CDS_pept        612866..614740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="Rmet_4046"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10914"
FT                   /db_xref="GOA:Q1LG12"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG12"
FT                   /protein_id="ABF10914.1"
FT                   /translation="MVQSSSENDTLRAHFMFTTRPEIVGTFGVAASTHWLATQTAMGVL
FT                   ERGGNAFDAAVAAGFVLQVVEPHLNGPGGEVPILFWSERERAARSVCGQGPAPALADPE
FT                   ALRKMGMEMMPGIGLMPATVPGAFGAWMTMLRDHGTWSLADVLEPAIGYARDGFPLVPR
FT                   ISQAILAVQALFRDEWHSSADTWLPDGKVPRPGSLHTLPVLADTYTRIVTTAIAQSDTR
FT                   EGQIDAAMRCWYQGFVAEEIDAYCRNTPVRDTTGEKHVGLLRFEDMEHWQATVEAPVSL
FT                   DFGRYSVAKCDIWSQGPVFLQQLGMLRHAGLEAHAPTSPEFVHTIAEAAKLAMADRAAW
FT                   YGDPRFVDSPLAALLNPHYLASRAALIGDRAALTMFPGALGGRAPRMPDPAVAERTLTA
FT                   ADTRFGVGEPTFAALPPVTEWAERELFVGDTCHIDVIDRHGNMVAATPSGGWLSSSPTI
FT                   PSLGFALNTRLQMTWLEPGLPNTLAPGKRPCTTLSPSLAMRDGEPYMVFGTPGGDQQDQ
FT                   WSLAFFMRHAVHGMNLQESIDAPAWHIDHFPQSFWPRQTTLNRITVESRFPAATIEALR
FT                   ARGHEVRVGDDWSEGRMSACTRERDARGRLVLRAGANARGMQGYAVGR"
FT   gene            614798..615787
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4047"
FT   CDS_pept        614798..615787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4047"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10915"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG11"
FT                   /protein_id="ABF10915.1"
FT                   /translation="MKSEMKSVLRSLLCGAAALTMSFANLASAADAWPTKPITLIVPWA
FT                   AGGSTDILARTLSEQLTKSLGQPVIVDNRPGASGNIGSAMVARAKPDGYTLLIGSMSTH
FT                   AMNPALMPNMPFKGVDDFTPLGLLAYVTNTMVVNASVPVHNVKELIAYAKANPGKVAYA
FT                   SAGPGSTNHLSAVLFEKMAGVQLLHVPYKGGAPAVVDTVAGQTQLLFSAGTQTLTHVKS
FT                   GKLRLLAVTEAKRSPLLPNVPTVGETLPGYELSVWYGAFGPKNMPAELVTRLNNEINRA
FT                   MALPDVKAKMESIGVETATSTPQEFGKILRRDADRYGKLIRELGIQGE"
FT   gene            615787..616305
FT                   /locus_tag="Rmet_4048"
FT   CDS_pept        615787..616305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4048"
FT                   /product="conserved hypothetical protein"
FT                   /note="GAF domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10916"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG10"
FT                   /protein_id="ABF10916.1"
FT                   /translation="MVDAANMTLPMHWQAQLNALLDRLRDAATPQGAMDAVGQATLAMV
FT                   GPGLLTINAWHVRTGEIERLWSSDSAAYPVGGKKIKGDTAWTRQLLVRGEVFVGEGDEA
FT                   LAAVFDDIAVIRGLGLNGVVNVPLSRRGAVIGTFNYLADVQAWTADEITALRLLGQLVA
FT                   PAVVEVIAG"
FT   gene            complement(616322..616531)
FT                   /locus_tag="Rmet_4049"
FT   CDS_pept        complement(616322..616531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10917"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG09"
FT                   /protein_id="ABF10917.1"
FT                   /translation="MKPRRVSGSAVPVPQSRDLEVRAFGDQDVEIEAALVATSADGDAL
FT                   DASVARLGGTSVVSQAFWSASTTE"
FT   gene            complement(616539..617531)
FT                   /locus_tag="Rmet_4050"
FT   CDS_pept        complement(616539..617531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4050"
FT                   /product="conserved hypothetical protein; putative
FT                   pyridoxine oxidase FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10918"
FT                   /db_xref="GOA:Q1LG08"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG08"
FT                   /protein_id="ABF10918.1"
FT                   /translation="MNRQPAPHAELLPGTPWHTGERILQSRAGVEERLAEVGPRVVRDY
FT                   MPDQHREFFAMLPSVVIGAVAPDGHVWATLRAGQPGFLQSPNPYLLEVASPRDADDPAD
FT                   SGMEDGNAIALLGLDPMTRRRNRLNGIVRRDDARGFGVTVGQSFGNCPQYIQKREFVVT
FT                   RDHATPGTVAPQILTALDARARTLIRHADSFFVATYVDLPGGRQVDVSHRGGRPGFVRV
FT                   DADGSLTIPDFPGNTFFNTLGNMLVNPVAGLVFVSYPTGDLLQMTGRAEVITDSPEIGT
FT                   VEGAERLWRFFPQQIVRRDRALPLRWDFMPGGESPQALRTGVWPGDPAS"
FT   gene            complement(617587..618258)
FT                   /locus_tag="Rmet_4051"
FT   CDS_pept        complement(617587..618258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4051"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10919"
FT                   /db_xref="GOA:Q1LG07"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG07"
FT                   /protein_id="ABF10919.1"
FT                   /translation="MMRARHLPSRRTIASKDVPTMKLYVHPLSGHAHRAQLLLSLLGQP
FT                   AELIEVDLMTGAHKSPEFLKLNPFGQIPVLVDGETVVPDSNAILVYLSKKLGRTDWLPE
FT                   APATAAAVQRWLSVAAGDIAFGPARARIATLFNAPYDLDDAVARAHVVLKRMDDALADR
FT                   PWIAADHPTIADVALYSYTARAPEGFVDLRDYGKVRQWLARVEALPGFVPIVKSPVGLE
FT                   A"
FT   gene            complement(618355..619257)
FT                   /locus_tag="Rmet_4052"
FT   CDS_pept        complement(618355..619257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4052"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10920"
FT                   /db_xref="GOA:Q1LG06"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG06"
FT                   /protein_id="ABF10920.1"
FT                   /translation="MDRLQAMKTFVTVVDTGGFTPAARKLDVSLSVVSRVITELETHLG
FT                   VRLLTRTTRLVRPTATGATYYENCRRILAEIEEAELATTGAHAAPRGKLSITASVLFGR
FT                   RFVTPIVVEYLRRYPEVDAECLLIDRNVNFVEEGIDVGVRIGPLPSSSLQAIPVGRVRR
FT                   VVCAAPDYLARFGTPATPDDLAHHTVIQTTGISTLPEWRFMRDGETAPTRLTPRLATST
FT                   NDSAIGAAVAGFGLAAVLSYQIADEVRDGKLRIVLDNFEQPPLPIHVIHREGRHAMHKV
FT                   RAFIDLAVDTLRGTASLNP"
FT   gene            complement(619270..620355)
FT                   /locus_tag="Rmet_4053"
FT   CDS_pept        complement(619270..620355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4053"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10921"
FT                   /db_xref="GOA:Q1LG05"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG05"
FT                   /protein_id="ABF10921.1"
FT                   /translation="MAESPGLYHKTFLLLLAAVSIAFFWILLPFYGAVFWGAVLAIIFA
FT                   PLQRRLTAGLRGRNNVAALLTLLLVLVLVILPLTIITASLINQGVSLYDSIRSGQLNFG
FT                   VYFQRAVDALPPYVRTLLAKVDLTSIADLQEKLSASALQASQFVATRALSIGQNTAQFV
FT                   ISFGIMLYLLFFLLRDGPRLSRKIRTAVPLSDLYKQHLIQKFTTVVRATVKGNVAVALV
FT                   QGTLGGGIFAVLGIQGALLWGVIMAFLSLLPAVGAGLIWAPVAVYFLLTGSTVTGLVLI
FT                   GFGVLVIGMVDNVLRPILVGKDTQMPDYVVLISTLGGMALFGLNGFVIGPLIAALFIAC
FT                   WDLNAHGIDENGDIGSNGPAA"
FT   gene            complement(620454..621488)
FT                   /gene="cycL"
FT                   /locus_tag="Rmet_4054"
FT   CDS_pept        complement(620454..621488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycL"
FT                   /locus_tag="Rmet_4054"
FT                   /product="cytochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10922"
FT                   /db_xref="GOA:Q1LG04"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG04"
FT                   /protein_id="ABF10922.1"
FT                   /translation="MPRTWLSTLTLLIALHAGAAFALTDAELDARVLALSSQLRCLVCQ
FT                   NQTLADSNADLAVDLRRQIRAQMAQGASDDAIKTYLVQRYGDFVLYKPPFKPQTWLLWL
FT                   GPFLLLMAVLAWLWRGRRRQMAAGNAVEETERDMQSPARRQSLLTNAMLFTVLPPVAVA
FT                   LYLHLGSPVSLLGSAVAHDGPHGPDGEVTLTAARVEDMVDQLAARLRKNPNDAEGWVML
FT                   GRSYTVLERNDDAAEAFARAVALEPKVASLRSDYADVLASVNGGSLEGPAMAQIDAALR
FT                   LDPDDPKGLALAASAAAERGDKAGAIAYWEHLYRLLPPDSQTAGRVAANLAAARSVAEP
FT                   GQRK"
FT   gene            complement(621481..622032)
FT                   /gene="ccmG"
FT                   /locus_tag="Rmet_4055"
FT   CDS_pept        complement(621481..622032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /locus_tag="Rmet_4055"
FT                   /product="periplasmic thioredoxin of cytochrome c-type
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10923"
FT                   /db_xref="GOA:Q1LG03"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG03"
FT                   /protein_id="ABF10923.1"
FT                   /translation="MMRFLLPLGVFLAIVIALAAGLRHDPRELPSSLVDKPAPAFVLPV
FT                   LETSANANAQKFDPASLRGKVWVLNVWASWCTACRAEHPVLLGMAGQTQVPLYGLNYKD
FT                   TRGAALEWLQRMGDPYKASAVDADGRVGIDLGVYGVPETFIIDAAGVVRYRQVGPVTQQ
FT                   VLEQKLLPLLKSLENGGSRA"
FT   gene            complement(622029..624071)
FT                   /gene="ccmF"
FT                   /locus_tag="Rmet_4056"
FT   CDS_pept        complement(622029..624071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="Rmet_4056"
FT                   /product="cytochrome c-type biogenesis protein; heme lyase,
FT                   CcmF subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10924"
FT                   /db_xref="GOA:Q1LG02"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG02"
FT                   /protein_id="ABF10924.1"
FT                   /translation="MNPELGHFALILAMLVALVLATLPMVGAARGNVAWMCLARPAAFL
FT                   HGTLLIAAYLSLTYAFVDNDFSVLYVAANSNSALPLIYRMAAVWGGHEGSMLLWSLMLA
FT                   LWAMAVAGFSRRLPLAFVARVLGVMGGISTGLLLFVLFASNPFLRLLPRAMEGRDLNPL
FT                   LQDPGMVFHPPFLYMGYVGFAVAFSFAVAALLEGRLDAAWARWSRPWTILAWMFLTIGI
FT                   AMGSMWAYYELGWGGWWFWDPVENASFMPWLAGTALIHSLAVTEKRGAFRAWTALLAIF
FT                   TFSLSLLGTFLVRSGVLTSVHAFAVDPRRGIFILTLLGLVTGLALALFAWRAPRLTQRT
FT                   DFNLTSRESFLLANNVLLAVAASAVLLGTLYPLLLDVLDLGKVSVGPEYFEEVFVPLMA
FT                   PAVLLMGAAPLARWGRSDLPDMARRLRWAAVASVVIALGLLAVLRNSSAMTGLGLTLAA
FT                   WCAMSGLASLATQMRHARDWRSGLRQLPAGYYGMLLAHIGVGVFITGVTLVKSQESVRE
FT                   LSMRVGDSVAVGGYDFRFDGVAPVRGPNYDALRGTVTVTRQGRPVTTLATERRVYRSQD
FT                   MPTTEAAIDTGLARDLYVALGDSSDATSADARWALRVYVKPFVSWVWGGCALMALGGLL
FT                   AASDRRYRARHPAAAVTSAVTANDDAGARPATPPLTLPAGKESEA"
FT   gene            complement(624068..624517)
FT                   /gene="ccmE"
FT                   /locus_tag="Rmet_4057"
FT   CDS_pept        complement(624068..624517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="Rmet_4057"
FT                   /product="cytochrome c-type biogenesis protein; periplasmic
FT                   heme chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10925"
FT                   /db_xref="GOA:Q1LG01"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG01"
FT                   /protein_id="ABF10925.1"
FT                   /translation="MTRRQRRLGLLLAALLCGGTALAFVLNAFRSNLVFFFSPTQVAAH
FT                   EAPASRNFRLGGLVAPGSLKRDPENLTIRFVVTDTRHDIPVVYRGLLPDLFREGKGVVA
FT                   RGALDRDGTFVASEILAKHDENYMPPEAADALKRAASDNPTEKTR"
FT   gene            complement(624514..624660)
FT                   /locus_tag="Rmet_6641"
FT   CDS_pept        complement(624514..624660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6641"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45241"
FT                   /db_xref="GOA:D3DY71"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY71"
FT                   /protein_id="ADC45241.1"
FT                   /translation="MSTLNLDMLAGHAGYIASAFGMTFVLIAAELILLCARRRNSLRAR
FT                   SRR"
FT   gene            complement(624657..625436)
FT                   /gene="ccmC"
FT                   /locus_tag="Rmet_4058"
FT   CDS_pept        complement(624657..625436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="Rmet_4058"
FT                   /product="cytochrome C biogenesis protein; heme exporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10926"
FT                   /db_xref="GOA:Q1LG00"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LG00"
FT                   /protein_id="ABF10926.1"
FT                   /translation="MQRDISLDANAHSPRTARARWLAFAAPVRFYPLAGRLAPWCFAVA
FT                   ALFLALGLYLGFVVAPTDAQQGEVYRIIFIHVPAAWMSMFIYVVMAGWCALALVLRTRL
FT                   SSMMASALAPTGAMFTVIALWTGALWGKPTWGTYWVWDARLTSELILLFLYLGYMALEA
FT                   AIDEPRRAERACAVLALVGVANVPVIYFSVQWWNTLHQGASVSLTAAPTMAATMLAGML
FT                   TMTVACWLYAIGVALVRLRCILRERGEIDTGTLETMP"
FT   gene            complement(625441..626109)
FT                   /gene="ccmB"
FT                   /locus_tag="Rmet_4059"
FT   CDS_pept        complement(625441..626109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="Rmet_4059"
FT                   /product="cytochrome C biogenesis protein; heme exporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10927"
FT                   /db_xref="GOA:Q1LFZ9"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ9"
FT                   /protein_id="ABF10927.1"
FT                   /translation="MIQAIGTIIAHDLSIAWRRRTGLLSSLVFFVIATSLFPLAIGPDP
FT                   QQLRALAPGILWVSALLASMLSLSRLFTQEHEDGSLDQLLLSPHPLALLVLAKIGAHWL
FT                   TSGLPLLVLTPLLAQQYSLPAGSALLLSASLLVGTPALSLIGAVGAALTLGVRGGAVLL
FT                   CILVLPLSIPVLVFGASAGAAADAGLDVIPQFSLLGACLALSLFLCPLATAAGLRIAME
FT                   "
FT   gene            complement(626106..626741)
FT                   /gene="ccmA"
FT                   /locus_tag="Rmet_4060"
FT   CDS_pept        complement(626106..626741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="Rmet_4060"
FT                   /product="Cytochrome c biogenesis ATP-binding export
FT                   protein ccmA; heme exporter protein A2"
FT                   /EC_number="3.6.3.41"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10928"
FT                   /db_xref="GOA:Q1LFZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LFZ8"
FT                   /protein_id="ABF10928.1"
FT                   /translation="MADAVLEARELGVRRGHCAIFRGLGISLAPGDLLQVMGPNGAGKT
FT                   SLLRVLSSLMPPAEGDLYWRGRAVRAGDPDYLAQVAYLGHVNGIYPDLSAFENLQFAAR
FT                   MAGQQPDADAMHHALARFGLDRVADAPARTLSQGQRRRVALSRLALTPRALWLLDEPLT
FT                   SLDDASTDCFHTLLAEHLQRGGIAVVATHQRLPAEGAVLDLATDAGSP"
FT   gene            complement(626745..627332)
FT                   /gene="napC"
FT                   /locus_tag="Rmet_4061"
FT   CDS_pept        complement(626745..627332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="Rmet_4061"
FT                   /product="Periplasmic nitrate reductase c-type cytochrome,
FT                   NapC/NirT"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10929"
FT                   /db_xref="GOA:Q1LFZ7"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ7"
FT                   /protein_id="ABF10929.1"
FT                   /translation="MWDLIKRYWHTINRPSAYFSLGFLTLGGFIAGVVFWGAFNTALEL
FT                   TNTEQFCTGCHEMRDNVYQELQGTIHFTNRSGVRAKCSDCHVPHNWTDKMARKMQASKE
FT                   VWAKIFGTVDTREKFQAHRLELAQHEWARFKANDSLECRNCHDYQSMDFTRQSPRAQAM
FT                   HSTYLANKEKTCIDCHKGIAHHLPDISKAEEQ"
FT   gene            complement(627353..627844)
FT                   /gene="napB"
FT                   /locus_tag="Rmet_4062"
FT   CDS_pept        complement(627353..627844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="Rmet_4062"
FT                   /product="Nitrate reductase cytochrome c-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10930"
FT                   /db_xref="GOA:Q1LFZ6"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ6"
FT                   /protein_id="ABF10930.1"
FT                   /translation="MLPSRSWVPLPLLVLMLVVMLLSVPLARAQGLVDSMRGPTPVANE
FT                   TSPPILFPTENKDIRRTRNYTMQPPTIPHKIDSYQLDKDFNRCMFCHARTRTEETQAIP
FT                   VSITHYMDRDNNVLAEISPRRYFCTQCHVPQADAKPLVNNTFVDVEAILKRSGGTKGAK
FT                   "
FT   gene            complement(627862..630357)
FT                   /gene="napA"
FT                   /locus_tag="Rmet_4063"
FT   CDS_pept        complement(627862..630357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="Rmet_4063"
FT                   /product="periplasmic nitrate reductase, large subunit"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10931"
FT                   /db_xref="GOA:Q1LFZ5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ5"
FT                   /protein_id="ABF10931.1"
FT                   /translation="MPLTRRDFIKQTAIAATASVAGVSLPTDAANFVTDSEVTKLKWSK
FT                   APCRFCGTGCGVTVAVKDNKVVATQGDPLCEVNKGLNCVKGYFLSKIMYGQDRLTKPLL
FT                   RMKNGKYDKNGEFAPVSWDRAFDEMEAQFKRVLKEKGPTAVGMFGSGQWTVWEGYAASK
FT                   LYKAGFRSNNIDPNARHCMASAVTGFMRTFGMDEPMGCYDDIEAADVFVLWGSNMAEMH
FT                   PILWTRITDRRLSHPKTRVAVLSTFTHRSFDLADIPVIFKPQTDLAMLNFIANYIIRNN
FT                   KVNKDFVNKYTVFKEGVTDIGYGLRPDNPLQKAAKNAGNPNDSKLITFDDFAKFVSKYD
FT                   ADYVSKLSGVPKKQLEQLAELYADPNLKVMSLWTMGFNQHTRGTWVNNMAYNVHLLTGK
FT                   IATPGNSPFSLTGQPSACGTAREVGTFSHRLPADMVVTNPKHREEAERIWKLPPGTIPD
FT                   KPGYHAVLQNRMLRDGKLNAYWVQVNNNMQAAANMMEETLPGYRNPTNFIVVSDAYPTV
FT                   TALSADLILPTAMWVEKEGAYGNAERRTQFWHQLVDAPGEARSDLWQLMEFSKRFKVED
FT                   VWPAELIAKKPEYKGKTLFDVLYRNGQVDKFPLKETASDYNNYESKAFGFYVQKGLFEE
FT                   YATFGRGHGHDLAPFDMYHEARGLRWPVVNGKETRWRYREGSDPYVKAGTGFQFYGNPD
FT                   GKAVIYALPYEPPAESPDKEYPFWLATGRVLEHWHSGSMTRRVPELYRAFPNAVCFMHP
FT                   EDAKALGLRRGVEVEVVSRRGRMRTRIETRGRDAPPRGLVFVPWFDASQLINKVTLDAT
FT                   CPISLQTDFKKCAVKIVKV"
FT   gene            complement(630338..630667)
FT                   /gene="napD"
FT                   /locus_tag="Rmet_4064"
FT   CDS_pept        complement(630338..630667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="Rmet_4064"
FT                   /product="putative periplasmic nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10932"
FT                   /db_xref="GOA:Q1LFZ4"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ4"
FT                   /protein_id="ABF10932.1"
FT                   /translation="MPASGVSIPIVPVPAGEEWHIAGIMVYANPEKLDAVCSAIDAMTG
FT                   MEIHAISDAGKIVVTAEAPSSRAIAAQLTCLHQLEGVFSATLVYQHNEDAAAMNEEISD
FT                   ATHAP"
FT   gene            complement(630763..630927)
FT                   /gene="napE"
FT                   /locus_tag="Rmet_4065"
FT   CDS_pept        complement(630763..630927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napE"
FT                   /locus_tag="Rmet_4065"
FT                   /product="putative periplasmic nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10933"
FT                   /db_xref="GOA:Q1LFZ3"
FT                   /db_xref="InterPro:IPR004448"
FT                   /db_xref="InterPro:IPR010649"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ3"
FT                   /protein_id="ABF10933.1"
FT                   /translation="MQSGSVEDPQRKTEELRSFLFLTAVMVPVLSVIVVAGYGFIVWMS
FT                   QLISGPPTH"
FT   gene            630942..631826
FT                   /locus_tag="Rmet_4066"
FT   CDS_pept        630942..631826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10934"
FT                   /db_xref="GOA:Q1LFZ2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ2"
FT                   /protein_id="ABF10934.1"
FT                   /translation="MYRLAGLCAGYAYLLKKPLSKVSRRPHAVVTPLRRRWNISRRDLI
FT                   RDRGLREGAEDGKSVVLVPSTEIAVAAAGPTMPIARKAMQSKDHWETVYATKPPTEVSW
FT                   YQSAPTLSLDLIRKLDLPADATIADIGGGASTLVDHLLSLGLHRLVVVDLAGHALAAAR
FT                   DRLGARAAGVRWIVGDVTTPVLPEASADLWHDRAVFHFLTASEDRAAYVAQARRAVRPG
FT                   GHLIIATFALDGPTQCSGLPVVRYDVAGLRAEFAPAFDLVAHTTETHTTPAGHAQSFLY
FT                   CHFVPHPSALMPD"
FT   gene            complement(631799..632776)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4067"
FT   CDS_pept        complement(631799..632776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4067"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10935"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ1"
FT                   /protein_id="ABF10935.1"
FT                   /translation="MNTQRRHLLKLSAAMLGGLALHRPALAQTVTGPIRIVLPYPPGGS
FT                   TDAITRFIADKLGTALKTNVIVDNRPGAAGMIGAAAVATAAPDGRTLLFTNTALIQSPL
FT                   IQPQPLYNPLTDFEALTLVADAAQVLVASDATPARTLPEYVEWARKHPGSAYGSLGVGS
FT                   TGHLYGELLKRKAGINIVHAAYKGDTAAIGDLLANQLPVGFVSTVMAKTYGDAGRIKVL
FT                   ATLGRSRVPSMPNVPTFAEAGFSGFESIGWIGMLAPARTPASLVQRLSNELAAIIKTPA
FT                   GSKMLIDSGMLPRGTTAQEFAALLRRDQQVWQTLVAQSGIKAEG"
FT   gene            complement(632826..634565)
FT                   /locus_tag="Rmet_4068"
FT   CDS_pept        complement(632826..634565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4068"
FT                   /product="acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10936"
FT                   /db_xref="GOA:Q1LFZ0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFZ0"
FT                   /protein_id="ABF10936.1"
FT                   /translation="MEDAAFFADLEARHRRIWPAGLPTSPQYPHGEISLGETLRAWARI
FT                   QPERPALIYYGSEITFAELDDLSERCAELLRGHGIGPGNRVAVLLGNCPQFHIVFYAIL
FT                   KLGAVYVPVNPLFKEHELAYELNDAGATMVIALDTLVPMLMTVKPQTSVETVFSTSAGE
FT                   FLPAHPTLPVPAGLDAAPVAHAGTIDLMAAIQTCTGNVRDVSVDLDALAALNYTGGTTG
FT                   MPKGCMHTQRDMIYTAAATLAVTSGREDRDATLPSSDVMLNFLPMFWIAGENLGLIYPI
FT                   FSGATLVLLARWDPLAVMSAVDRYRVNRTFMVVDNLVELLQHPELARHDMRSLQHTRVA
FT                   SFIRKLTVDLRRQWHALTGSVVAEGAWGMTETHTSDTFTTGMQTDDMDLHGRPVFVGLP
FT                   VPGTRIKICDFETGVTLPVGEEGEIVVTTPSLLKGYWGRPDANAEVFRDGWFRTGDIGA
FT                   YDDAGYLHFLGRRKEMIKVRGMSVFPSELEVLLGRHAAVLGSAVVARPDRDKGQVPVAF
FT                   IRLRPGHDDVSAEALTAWCREHMATYKVPEIRVVDELPMTATGKVKKGELQKQFEQDEQ
FT                   EVG"
FT   gene            complement(634644..638024)
FT                   /locus_tag="Rmet_4069"
FT   CDS_pept        complement(634644..638024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4069"
FT                   /product="acetyl-CoA carboxylase (biotin carboxylase and
FT                   carboxyl transferase domains) / biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10937"
FT                   /db_xref="GOA:Q1LFY9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY9"
FT                   /protein_id="ABF10937.1"
FT                   /translation="MQLDARALHSGLHPGGTASIPHGIEPVKKLLIANRGEIALRVQRA
FT                   AQDLGIATVAVYATDDAQSRHRQLADEAIALPGNGPATYLDIDAILGAARAAGCDAIHP
FT                   GYGFLSERADFAQACAAAGITFVGPTPEQLALFGDKGRALELAAQCDVPVMPATPGGAS
FT                   LDDVRAFFAAQQGNGIVLKAVGGGGGRGMRVVRDAEALAEAYARCQSEARSAFGIEAIY
FT                   AERLVERARHIEVQIIGDGTETIALGERDCTLQRRFQKLVEIAPSPVLTPALRDRIVQA
FT                   ASRIAKHTGYRSLGTFEFLVETDDAGTPHGFVFIEANPRLQVEHTITEQVTGLDLVALQ
FT                   LGLADGRSLRDLGLDPAAPPTARGFSVQLRINAEATDAQGQARPALGRLERFDPPTGPD
FT                   VRVDTHGYTGYAPPAGYDSLLAKLIVSTSSPRFEDVVRRVRRALGECRVDGVPSNLDLL
FT                   RALVAREDFATQHVHTRHFEAILPELLTAAQRVAASDAARQASIGIAQTAPVPVPTATA
FT                   EAIDEGLVAVRAPMNGRVVEMRVQEDDIVQPGQIVAILDAMKMEHTIAAECAGRVIDVR
FT                   VGATGQTVEGQILLVLEPVADAGVAHHRSEAADPRAIRPDLQRVRDRDAFLDDAARPDA
FT                   VAKRHARGQRTARENVADLCDAGSFVEYGAYAVAAQASRRSAEDLIANTPADGLITGTG
FT                   RINGTRFAPERARCAVLAYDATVLAGTQGKRNHIKTDRILQVAAEQKLPTVIFAEGGGG
FT                   RPGDVDFPTVAGLYQPSFAAFAALSGEVPVIGIAAGRCFAGNAALLGCSDVIIATRDAN
FT                   IGMAGPAMIEGGGLGVYRPEDIGPAAVQYQNGVVDLLVDDEAEAVRAAKHYLSMFQGRT
FT                   QDWEAPDALMLRGVVPENRLRVYDTRAAIQGIADVGSVIELRAGYGTGVHTALARIEGR
FT                   PVGIVANNPRHLGGAIDVDGADKAARFMQLCDTHGLPIVSLIDTPGFMVGPEIEARAQV
FT                   RHVSRLFVLGAKVRVPFMAVVLRKGYGLGAMAMAAGGFRAPAFTISWPTGEFGGMGLEG
FT                   AVRLGFRKELEALPAGPERDALYQQLVAQMYERGHAINAAAGLEIDAVIDPAETRRWLL
FT                   AGLDAAPRDEAPRRYVDAW"
FT   gene            complement(638132..639025)
FT                   /locus_tag="Rmet_4070"
FT   CDS_pept        complement(638132..639025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4070"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10938"
FT                   /db_xref="GOA:Q1LFY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY8"
FT                   /protein_id="ABF10938.1"
FT                   /translation="MDLRQLQQFVVLAETGNFHRAAERLHMAQPPLSISIRKLEESLGT
FT                   PLFVRTTRGVRLTQAGEAALNDARRALFHAGQARAAAVSAALGERGALRIGFVGSATYA
FT                   LLPRLIPAFRSAHPGIDLILHESTSAAILDRIEHGQLDAGLVRFPILNSGPYTLTPLES
FT                   DAFVAAVPADGRFAEQESIALKALADEPFIMHPRADVPNLQAVAMLLCQQAGFVPRIAQ
FT                   EAVQVQTIVSLVESGLGVALVPGVAARYTNRRVRFLRLSSPRPAARIGIALATQQDTDD
FT                   RHVQRFIAAAQRIAGD"
FT   gene            639138..640313
FT                   /locus_tag="Rmet_4071"
FT   CDS_pept        639138..640313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4071"
FT                   /product="putative formyl-CoA transferases/L-carnitine
FT                   dehydratase"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10939"
FT                   /db_xref="GOA:Q1LFY7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY7"
FT                   /protein_id="ABF10939.1"
FT                   /translation="MLPLSGIRVVDLSTVVMGPYASQWLADLGAEVIKVETPEGDSTRR
FT                   TGPATEDGMSAIFLGVNRSKKSVVLNLKRPEAQAALHRLLASADVFVHSMRPQKLAKLD
FT                   LDPASVMARHPQLIFVSLLGFAEDGPYGGRPAYDDIIQGLCGNAALMAAQTGTVRYFPT
FT                   ISADKTSGLVAALSISAAIAGRERQGGKGSMVEVPMFESMVAFNMVEHLYGQHFEPPRG
FT                   PSGYPRVLAPLRRPYQTADGYVCMMPYTDAHWRDFFQASGREDLVADARFTDIAARTRH
FT                   IETLYEITGELVRARSTADWLAICERLQIPVARVNDLHELVDDPHLRATGFFDQIEDPS
FT                   MGTLRFPGAPVRFDGERARAAVPPRLGEHTREILAAAGLGDDEIDRLQSNQ"
FT   gene            640349..640810
FT                   /locus_tag="Rmet_4072"
FT   CDS_pept        640349..640810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10940"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY6"
FT                   /protein_id="ABF10940.1"
FT                   /translation="MTTSQPQRLGQGFYWQDIREGQVFETFSRTVTETDLVNFISVTGM
FT                   LEAIFIEEGYEAGAIKGRPVPAALTYSLIEGFILQTMIQGTGLAMLELTQKILGPVVVG
FT                   DTIHARITVTGIRPTSKSGRAVVDSSIEVFNQRNELVMTYTARRLLAGR"
FT   gene            640869..641867
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4073"
FT   CDS_pept        640869..641867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4073"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10941"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY5"
FT                   /protein_id="ABF10941.1"
FT                   /translation="MPTQSKKAGHSIRSILLAGCAFALTAAVAPAMAGEFPDHPIRLVV
FT                   PFPPGGPTDLVSRVIARKMSEEIGQQVIVDNRPGANGNIAGEMVAKSPADGYTVLYNTS
FT                   SIALSPALYKKLPYDVKRDFAPVAMTAMVPLVLEVNAQVPVRTVPEFVAWLKANPGKMT
FT                   YGSAGNGNVTHLAAFLFLQANGLDATHAPYKGSAPALTDLASGQVQFMTDTINSSLPFI
FT                   RDKRMRALAVTSSARSSQLPDVPTLAESGMHGFEVGAWQGMMVPAKTSPEIIKKLNSAA
FT                   LKALAAPDVRASLAQQGAEVRASSPEAYAKYVASEIDRWHKVVKDTGVTLD"
FT   gene            641910..643070
FT                   /locus_tag="Rmet_4074"
FT   CDS_pept        641910..643070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4074"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10942"
FT                   /db_xref="GOA:Q1LFY4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY4"
FT                   /protein_id="ABF10942.1"
FT                   /translation="MSSLFGAFSLTSLPPEALAFRREVKAFLAEHLPDLPADVRARSWM
FT                   GFDAAFSRALAQRGWVGVTLPARFGGAGLDAFSRFVLVEELLACGAPVSAHWIADRQSG
FT                   PLILRYGSDAQREFYLPRICRGEAFFCIGMSEPNSGSDLASVATRAVPQPGGGWRLNGR
FT                   KIWTTNADRCHYMLALVRTSGEAGDRQKGLSQVIVDLSLPGVTVRPIHDLAGDAHFSEV
FT                   SFEDVLLPADALIGNEGAGWEQVNAELAFERSGPERLYSSVVLLDAWVAALRRLPAVRR
FT                   DAVTIGGIVGRLATLRAMSVAVTARLAAGESPLVEAALVKDLGTGLEQSIGALAEAALG
FT                   DDPELAMDAELYRTAAYVSQISPTYSLRGGTREILRGMIARGLGLR"
FT   gene            643250..644245
FT                   /locus_tag="Rmet_4075"
FT   CDS_pept        643250..644245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4075"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10943"
FT                   /db_xref="GOA:Q1LFY3"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY3"
FT                   /protein_id="ABF10943.1"
FT                   /translation="MYNEYSEALEVLLRDHCTPAVVRQIESGGSGADLWRLLDESGFAD
FT                   SLLPEAGLSLADVAPMLFVMGRHVLPVPLAQTMFARAVLRMAGVEVPEGREGPEGSIAL
FT                   ADLDGAQRTHVPCGATATWFLVQDGAQAALVHRDAVALSPTGVRDDLTLSLGEIGMQRF
FT                   PQRFPLPAGLLRSVGACLHAVQMAGAMSSVFDLTLQYANDRVQFGRNIGKFQAIQHQIS
FT                   VMAEQVAAVRMAAQIACAADGWQPDRLRAAIGKFNASDAVTAVTSIAHAVHGAIGVTAE
FT                   YDLQLYTRRLHAWRLADGSERYWARELGEATCEADGLTVDLIREWSGEAA"
FT   gene            complement(644308..645102)
FT                   /locus_tag="Rmet_4076"
FT   CDS_pept        complement(644308..645102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4076"
FT                   /product="putative short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10944"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY2"
FT                   /protein_id="ABF10944.1"
FT                   /translation="MNIDLSGKTALVTGSTAGIGFATARGLAESGAHVIVNGRSQASVD
FT                   NALASLKKSYPTAQATGFAGDLTDAAVCDTLVKTHPAVDILVNNLGIFEPKDFFDIPDS
FT                   DWTRFFDVNVLSGVRLSRAYAKGMAERKWGRIVFIASESGINIPVEMIHYGFTKTAQLA
FT                   VSRGLAKRMAGTGVTVNAVLPGPTLSEGVTAMLKDEIAKSGKSAEEVAAEFVKAHRSTS
FT                   IIQRAASVEEVANMIVYVCSPQASATTGAALRVDGGVVDTIV"
FT   gene            complement(645292..646635)
FT                   /locus_tag="Rmet_4077"
FT   CDS_pept        complement(645292..646635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4077"
FT                   /product="putative TRAP transporter solute receptor, TAXI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10945"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY1"
FT                   /protein_id="ABF10945.1"
FT                   /translation="MSRRDPALRRSQNPPMSAGRRRLLIAGGILLLVALGWSLVAVIRP
FT                   AIQHTIIITTGADKGIYQGFADRYATILKRDGIKLEIRSSSGSIENYERLKNPDSAYEV
FT                   GFIQSGTVSPSDTDGLQTIAAVAYEPIWVFYRGAAKMDRLSELQGKKVSIGVPGSGLLE
FT                   VSRILLAHSGITASNTTLLQMDANAAYQGLKDGQLDAAFFIGRPDAEMQQTLLNSDLKL
FT                   MSFAQADALVQKFPSLSKIVFPRASTSIVNDLPQADVTLLAAKALLVSKDTMHPALVYL
FT                   LLEAAKTVHGGEDYFTPLGTFPNLNTNEFPVSEESTRFFKSGRPFLQRYLPFWLASFVE
FT                   RRLLILLPFMALLLGLLQALPRFAESRIKGRLVVWYREIKALEDEIWKSERPTRHQIAQ
FT                   WREEIEQIDAHASQIRMPQRYFQDVYALKQAIAVVRNRILHVAGTVKE"
FT   gene            complement(646836..646967)
FT                   /locus_tag="Rmet_6642"
FT   CDS_pept        complement(646836..646967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6642"
FT                   /product="putative major facilitator superfamily
FT                   permease-like protein (C part)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6642"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45242"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY72"
FT                   /protein_id="ADC45242.1"
FT                   /translation="MDNSQVKAQPTSKGLLAIFWLYVLVPLVWGVSNTITQAMKLFH"
FT   gene            complement(646989..648416)
FT                   /gene="oxlT"
FT                   /locus_tag="Rmet_4078"
FT   CDS_pept        complement(646989..648416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxlT"
FT                   /locus_tag="Rmet_4078"
FT                   /product="major facilitator superfamily (MFS);
FT                   oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10946"
FT                   /db_xref="GOA:Q1LFY0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFY0"
FT                   /protein_id="ABF10946.1"
FT                   /translation="MSSVMNEGSSPAYGPAPFFSKEATYAKPGFSRWMVPPAALAVHLC
FT                   IGQAYAFSVFNVPLSRVIGITESAPDDWKLTTLGWIFSLAIFFLGISAAFAGKWLERVG
FT                   PRLTMFTAACCFGSGFLVSALGIYTHQIALLYLGYGVLGGIGLGLGYVSPVSTLIRWFP
FT                   DRRGMATGMAIMGFGGGAMIAAPLSVALMNTFKSATSVGVAQTFVVMGIGYFVSMLIGS
FT                   LAIRVPAPGWKPAGWTPPTTASKMITRNHVHIDQALKTSQFYLLWLVLFLNVTAGIGVL
FT                   GQASLMIQESFKGSVTAAAAAGFVGLLSLFNMGGRFFWASSSDWIGRKNTYFVFFALGA
FT                   VLYWLVPQLGASGNIALFVLAYCVIMSMYGGGFATIPAYLADMFGTAFVGGIHGRLLTA
FT                   WAAAGIAGPVLVNYIREYQVAHGVTGADAYTMTLHIMAALLVVGFICNLLVARVSDRHH
FT                   MSEADVSSLAGNASAAH"
FT   gene            648485..648757
FT                   /locus_tag="Rmet_6643"
FT   CDS_pept        648485..648757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6643"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45243"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY73"
FT                   /protein_id="ADC45243.1"
FT                   /translation="MAQPVDPSRRGRITPRCVDAPGFGHGYGPDWSTLATTLQIGNEIG
FT                   LRVMAQQQLARASAGGSGSRRGERREASRHEMAHYFSVGGEQSLF"
FT   gene            complement(649177..649314)
FT                   /pseudo
FT                   /locus_tag="Rmet_4079"
FT   CDS_pept        complement(649177..649314)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4079"
FT                   /note="conserved hypothetical protein, partial overlap"
FT   gene            complement(649395..649583)
FT                   /locus_tag="Rmet_6644"
FT   CDS_pept        complement(649395..649583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6644"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45244"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY74"
FT                   /protein_id="ADC45244.1"
FT                   /translation="MGLRGGRIGCLPLAAHGWTAGGGSGQTAFLNYQMDEQVTGAWSRS
FT                   VGAIWTINRSAGLLLER"
FT   gene            complement(649493..649771)
FT                   /locus_tag="Rmet_6645"
FT   CDS_pept        complement(649493..649771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6645"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45245"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY75"
FT                   /protein_id="ADC45245.1"
FT                   /translation="MRRCERQSASRLRLRPECMVAAPSGSDWDLDFLMSPIENIHFDPG
FT                   RHSVKIVHLDRPKGMRTRWDYAADESAACRLPPTVGPRAAAAARLPS"
FT   gene            649751..650134
FT                   /locus_tag="Rmet_4080"
FT   CDS_pept        649751..650134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10947"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX9"
FT                   /protein_id="ABF10947.1"
FT                   /translation="MAFASPQMGDGLGLIAVGQLDCAGVVAVAGVAETFGVLAAAESQA
FT                   GRVSCCRCRASARPRSITAKSGPAMADSEARREAAPHRASRADFIRKLRRVGKTMPRMI
FT                   RSFRHSVQDRIVIRAIGWANSWR"
FT   gene            complement(649804..650019)
FT                   /locus_tag="Rmet_6646"
FT   CDS_pept        complement(649804..650019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6646"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45246"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY76"
FT                   /protein_id="ADC45246.1"
FT                   /translation="MKSALLALCGAASLLASLSAIAGPDFAVIERGRAEARQRQQLTRP
FT                   ACDSAAASTPKVSATPATATTPAQSS"
FT   gene            complement(650327..650776)
FT                   /locus_tag="Rmet_4081"
FT   CDS_pept        complement(650327..650776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4081"
FT                   /product="Exported or Membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10948"
FT                   /db_xref="GOA:Q1LFX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX8"
FT                   /protein_id="ABF10948.1"
FT                   /translation="MGWFLVTVALPVLAPMISLICMKAFPLAIPSAQLALVSVVRNGQL
FT                   CWAAIGFCTSALYELAEPCPPSARVNAIFQGYLNGGMTLLLVLASLFAACGAVLPHTDG
FT                   YASGVPRRGHNRVLLASLGITSLSAIGFALIPLGALASSDFWRLI"
FT   gene            complement(650954..651247)
FT                   /locus_tag="Rmet_4082"
FT   CDS_pept        complement(650954..651247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10949"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX7"
FT                   /protein_id="ABF10949.1"
FT                   /translation="MTRYIVLASFTDQGIRTVKETTKRAAAVRELGAQLGVQVKDVFWT
FT                   LGKYDVVLTLEAQDDTVVTAFGLSVGALGNVHTQTLRAFDATEMQAILGKMR"
FT   gene            complement(651343..651627)
FT                   /locus_tag="Rmet_4083"
FT   CDS_pept        complement(651343..651627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX6"
FT                   /protein_id="ABF10950.1"
FT                   /translation="MAAMLQRIRYMAMATGRVAARKALHFCNTSRHTTGSHSPKWARND
FT                   YEPHPVAGGSQFACFRHCSGCFAEFPGERRHRHRLRVNDEAPRELAPNP"
FT   gene            651730..653190
FT                   /gene="phoA1"
FT                   /locus_tag="Rmet_4084"
FT   CDS_pept        651730..653190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA1"
FT                   /locus_tag="Rmet_4084"
FT                   /product="alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10951"
FT                   /db_xref="GOA:Q1LFX5"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX5"
FT                   /protein_id="ABF10951.1"
FT                   /translation="MRRISVLAAAAMSVALAACGGDDNNGNNAGTTPPIEQPQGGTTPT
FT                   KNVVFFLGDGMGMTTLTAARIYKVGEEGDLTIDTMPESGFVRTYSNDAQVTDSAPSMAA
FT                   YMTGVKMNNEVISMTPETSAVDANGKAYVSGADSTCPATGNGKSVPTLLEQMKAAGYGT
FT                   GVVTTTRITHATPAATYAHICHRDGENAIAAQLVPKGAGFNGALTDGVDVIFGGGRQHF
FT                   LATTAGGKRTDGRDLVGEFKTAGYSYAASKSDFDKITASSAKVVGLFNASHMDYDLDRD
FT                   PAKEPSLAEMTGKAIDVLAAKKKGFFLMVEGGRIDHALHETTARKALQDTAAFDDAIKA
FT                   AIDKLNVIDPGLKNTLIVVTADHDHTLVLNGYAKRTGKTSDANPGVLGLVKDYVTGSAK
FT                   LDSTGNPFSIIGFGNGENRPATRTALTDVQVFDKTYHQEAVIPMPAGGETHGGTDVFIG
FT                   AMGNGATSFTGVMDNIEVFGLIKKAIGL"
FT   gene            653226..654629
FT                   /gene="phoA2"
FT                   /locus_tag="Rmet_4085"
FT   CDS_pept        653226..654629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA2"
FT                   /locus_tag="Rmet_4085"
FT                   /product="alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10952"
FT                   /db_xref="GOA:Q1LFX4"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX4"
FT                   /protein_id="ABF10952.1"
FT                   /translation="MKITTRIGMLAAAAASACLTMPAAQAAGEAKNVIFFLGDGMGPAT
FT                   VTASRIYKYGESGKLTMESLKRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVISMS
FT                   PDTKATAPGTDVNGNKTINNCLPTNGTSVPTLLELAKARGKATGAITTTELTHATPAAT
FT                   YSHICHRDAQYDIAAQAVPGGAGFNTALGDGVDVLMGGGRNHWTPFDATANKKGRADGR
FT                   NLLTEFAAKGYAVAATRDQMMQASGNKLIGLFSTTSHLEYEIDRVAGKGEGATQPSLAD
FT                   MTAKAIELLSKNGNGYFLMVEGGRIDHALHGTNAKRALEDTIAFDDAIKRALSMVDLSN
FT                   TIIVVTADHDHTMTINGYSHRGNPILATATDYKTKKTALAADGLPYTTLVFGNGGTPRK
FT                   ATRDNPSLVDTTANDYLQEVGVNLGSPGAETHGGGDVMLFSTGPGSAPLKGTLDNTKVF
FT                   GVVKSALGL"
FT   gene            654720..655469
FT                   /locus_tag="Rmet_4086"
FT   CDS_pept        654720..655469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4086"
FT                   /product="Conserved hypothetical protein (membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX3"
FT                   /protein_id="ABF10953.1"
FT                   /translation="MINMKQASMKQAGVKQAIGQFVLLALGICASSTALAATATATDSG
FT                   KPLALRVQHELSALGKDGVKRDVSFGERVYRNGDSVWIEREVPASVRHAHDEAEHAAGD
FT                   KGHKHMDVSTAARWIERKPNGELNVRLVSDQMRKTFEVRQGDYGNIGFDGSWAAASHLL
FT                   DPALLKTMKANGPVRDGVQEYTARRGDERVTVQWDVAGQYPRLVQSLNTSGTQKKITRV
FT                   TSVATPASAPWSRTRGYAQGDYSDLLD"
FT   gene            complement(655530..656096)
FT                   /locus_tag="Rmet_4087"
FT   CDS_pept        complement(655530..656096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4087"
FT                   /product="conserved exported protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10954"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX2"
FT                   /protein_id="ABF10954.2"
FT                   /translation="MASVALIGLLAGCSSPKSRFYTLDPDNTVERASTATPIRVVVGPV
FT                   TIPDLVDRPQIVTRVSANEVKVNEFARWAEPLKSEISQVIAADLRTMLGSDQVTVFDTG
FT                   SNAMPAWRVRVDILSLDSEPAVAVSMDALWTIQPPGKQPAIAGRSVVREAVASDGFDAI
FT                   IAAHNRALASVSRDIATSIRTQPGR"
FT   gene            complement(656129..657655)
FT                   /gene="pqiB"
FT                   /locus_tag="Rmet_4088"
FT   CDS_pept        complement(656129..657655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="Rmet_4088"
FT                   /product="paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10955"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX1"
FT                   /protein_id="ABF10955.2"
FT                   /translation="MPIIAVLIGGWLAVKAVIEQGPTITVSFKTGEGLEAGKTKIKFKD
FT                   VDIGLVKSVALSPDSKRVVVTAEIAKDAGRLLVDNTRFWVVRPRISGGSVSGLGTLLSG
FT                   SYIATDAGTATATRHDFVGLETPPAFTSDVPGREFTLKSEDVGSLDVGSPVYFRRLQVG
FT                   QITAFDLDSDGRGVTLKVFVNAPYDRFVQQGTRFWHASGVDVSLDTGGLRVNTQSVVSI
FT                   LIGGIGFETPYESQDQPVAAAGSTFALFHDRVTALKRQDSVVHHYVVNFTDTVRGLAVG
FT                   APIEFRGIVIGEVTGIYTRYDPVTRKFSIPVEINFYPGRFTSRYRTGAGAGPVTETPRE
FT                   LGDFLVSQGLRMQLRNGNLLTGQLYIALDFFPNAPKAKINWNENPPEFPSIQGDLQSLQ
FT                   QSLTRVVAQLNSVPFAQIGQNTKDMLRNATSLLTRLDSELVPQARDTLASARSTLDSAN
FT                   TALGPDSALQQNTADAMKELARTAAALRSLADYLEQHPEALIRGKAEDKP"
FT   gene            complement(657759..659030)
FT                   /gene="pqiA3"
FT                   /locus_tag="Rmet_4089"
FT   CDS_pept        complement(657759..659030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiA3"
FT                   /locus_tag="Rmet_4089"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10956"
FT                   /db_xref="GOA:Q1LFX0"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFX0"
FT                   /protein_id="ABF10956.1"
FT                   /translation="MTRTDLIACPECDLLQRALPVPIKGTLRCCRCDAELARNHPDGLE
FT                   QALALALGALVLLGISNLYPIVGLSVSGTLVQTTLAGAVRVLFHGGMWPLAILVLITTI
FT                   VMPVLQTVGMLWVLLPLRLGRKPWFAPQVLRLCHQAESWGMTEVLILGLLVALVKLAHI
FT                   ASVVPGVALWSFGALMLVLVGAHTAFDPHSLWVRFSDVRTTSGARPHLEPPIVSGPITA
FT                   AHCGLLSCHDCGLLTSAHTRDHALACPRCGATLHSRKPASLTRTWALLISAVVLYIPAN
FT                   VLPVMYTSSLFGAENDTILSGVAYLWTSGSWLLAIVVFIASIAVPMLKILALGYLAFST
FT                   QFHSTSAPKRRTKIYRVVEFVGRWSMLDIYVITVLVALVQFKALATIQAGPAAIAFGAV
FT                   VVLTMFAAMTFDPRLIWDEAEHQP"
FT   gene            complement(659290..659703)
FT                   /locus_tag="Rmet_4090"
FT   CDS_pept        complement(659290..659703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4090"
FT                   /product="putative transcriptional regulator, MerR/CueR
FT                   family domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10957"
FT                   /db_xref="GOA:Q1LFW9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW9"
FT                   /protein_id="ABF10957.1"
FT                   /translation="MKIGELARLSGVAASRIRFYEASGLLQPAQRQANGYREYAPETLT
FT                   RLEIILRAQNAGFSLDEIRAILPTRLNDWPREKLIEVLRRKAGEIELLEQRLAGTRRDL
FT                   LALAHDIENLADDEDCSGHARHVLGQMDQRSGR"
FT   gene            659772..661034
FT                   /locus_tag="Rmet_4091"
FT   CDS_pept        659772..661034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4091"
FT                   /product="flavine mononucleotide (FMN) oxidoreductase
FT                   containing old yellow enzyme (OYE)-related FMN binding
FT                   domain, group 2 (OYE_like_2_FMN)"
FT                   /EC_number="1.6.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10958"
FT                   /db_xref="GOA:Q1LFW8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW8"
FT                   /protein_id="ABF10958.1"
FT                   /translation="MRKCLRTPAMKLFTPLTLPNGAVIPNRLAKAAMEENMADADHAPS
FT                   DALLRLYEAWAAGGAGLMLTGNVMVDHRAMTGPNGVVLENDAHLDRFRQWARIARAHGA
FT                   HVWMQINHPGRQMPAALGQTTLAPSAVPLELGALSKQFPVPREMTAADIDDVRELFVRS
FT                   AQLAEQSGFTGVQIHAAHGYLLSQFLSPLANRRQDQWGGPIENRARLLLDIVRAVRQAV
FT                   SPAFVVSVKLNSADFQRGGFSPDDAKRVVELLNPLGVDLVELSGGSYEAPAMQGQARDG
FT                   RTLEREAYFLAFARDIAAIAQMPLMVTGGIRRRAVADQVVDSGIAMVGIATALSIDPNL
FT                   PRDWLAGKNNAPALRPITWKNKVLGSLANMAVVKFQLKRLSQGRGTHPRVSPLRALLMQ
FT                   QMANACQTRRYKRWMMGRELG"
FT   gene            complement(661063..661980)
FT                   /locus_tag="Rmet_4092"
FT   CDS_pept        complement(661063..661980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4092"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10959"
FT                   /db_xref="GOA:Q1LFW7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW7"
FT                   /protein_id="ABF10959.1"
FT                   /translation="MDQIPDLNDLRLFAEVVDRGSFTAAARSLGQQTSKLSRRIRALEE
FT                   ALGVRLLNRTSRSLSLTETGRRFHQHCLAVVAEARAAKEIVDQTRSQPQGTVRISCPVA
FT                   LLSSGVAETISRYVHDNPQVQVLVDATNRRVDVIEEGLDFAIRVRPAPLEDTDLAVRQL
FT                   GLSTFVLVASPELARLHAPPASIESLQDWPTIAMASNNERYVWNLVDAGGKEQAFAHRP
FT                   RLATDDIASLRIAAMFGVGVAMLPREFIEEDLQSGRLLHLLPELASTSGLVHAIFPTRR
FT                   GMVPAVRHLLDALVAGFEAVNQGR"
FT   gene            662161..662859
FT                   /locus_tag="Rmet_4093"
FT   CDS_pept        662161..662859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4093"
FT                   /product="conserved hypothetical protein (pirin-related)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10960"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW6"
FT                   /protein_id="ABF10960.1"
FT                   /translation="MLVHRRWESLDAADHGWLRAKHHFQVDAAGNPAHHPLGSLIVWND
FT                   DEIAVGAGFPLHGHRDMEIVTYVRQGTLEHRDTLGSIGTIRAGEVQVMSAGRGIRHAES
FT                   NRGSEPLRLYQIWLLPRERGGDPRWETRPFPEAGRFGRFAVLASGFPGDGDALPIRANA
FT                   RLLAATLGPGDRLTHSFAPHNNAYLVVASGRIAVDGEFVGLRDGVAITNAASIDVAALE
FT                   HSELVMVETR"
FT   gene            662912..663334
FT                   /locus_tag="Rmet_4094"
FT   CDS_pept        662912..663334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10961"
FT                   /db_xref="GOA:Q1LFW5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW5"
FT                   /protein_id="ABF10961.1"
FT                   /translation="MEHNKYYPLLGRIMLGAPFLMSGLGKLAAYGGTVGYISAVGLPVA
FT                   PLAYLIAVAVEVGGGMMLLSGYQVRAASLVMAAFCVATAVFFHHNFADQNQMIHFLKNL
FT                   MIAGGLLQIASFGAGAWSLDARLAGPASHKTALRAN"
FT   gene            663385..663750
FT                   /locus_tag="Rmet_4095"
FT   CDS_pept        663385..663750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10962"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW4"
FT                   /protein_id="ABF10962.1"
FT                   /translation="MQNSIPTLLRRNLEEVFGEIDPARRRRAIDDIFTDDSVFYDPNSG
FT                   IHRGRDAIDRIAGVIKASHPDFRYQPIAEPEVAGDGGRIRWVSGRPGEAPAYAGTDFIV
FT                   TRDGRIVAVYLFFDELP"
FT   gene            663839..664438
FT                   /gene="wrbA"
FT                   /locus_tag="Rmet_4096"
FT   CDS_pept        663839..664438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="Rmet_4096"
FT                   /product="putative trp repressor binding protein"
FT                   /note="flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10963"
FT                   /db_xref="GOA:Q1LFW3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LFW3"
FT                   /protein_id="ABF10963.1"
FT                   /translation="MSKVLVLYYSTYGHVEALAEAVAEGARATGATVDVKRVPETVPAA
FT                   VAEASHFKVDQKAPVATVEDLANYDAIVVGTPTRFGRISSQMAAFLDQAGGLWMRGVLN
FT                   GKVGGAFTSTATQHGGQEATLFSIIANLLHFGMTIVGLPYSHQGQMTLDEIVGGSPYGA
FT                   TTIAGGQGQRQPSAIELEGARHQGELIAKTANKLFG"
FT   gene            complement(664564..665688)
FT                   /locus_tag="Rmet_4097"
FT   CDS_pept        complement(664564..665688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4097"
FT                   /product="outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10964"
FT                   /db_xref="GOA:Q1LFW2"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW2"
FT                   /protein_id="ABF10964.1"
FT                   /translation="MTRVGVWHWMRPLATIAALSASATCLVGTANAQSSVVIYGRLNTA
FT                   VEYASASTATDGTHLGGTARLTNNRSVFGIRGEEALGYGLKAIWQVESTLSIDTGAGQI
FT                   AARDTRLGMASPYGTVFMGNWDTAYTTSTKTLDPYYPTTAGYMSIMGNGAAATTDNVQN
FT                   TNSFDRRQQNSLHYQSPQWHGLSGAMTWGLPEEKISVPRNPALYSFAGAYERGPLSVSM
FT                   AYEIHQHYQTAGRNDDGMKVGVSYQFPTTTIALVYERLHYRTATGDLARNSYYTSLVQK
FT                   LGPGSVKIGFTFASNGTGNATETIGSFHAGPETGATQITVGYDYPLSKRTSIYTYYSRI
FT                   NNKRNALYDFAINGLGVKAGADPQTFALAMRHNF"
FT   gene            665784..666494
FT                   /locus_tag="Rmet_4098"
FT   CDS_pept        665784..666494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10965"
FT                   /db_xref="GOA:Q1LFW1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW1"
FT                   /protein_id="ABF10965.1"
FT                   /translation="MALENQKPIPTSMHGGVLSFVAGFVDVVGFIALFGLFTAHVTGNF
FT                   IMIGVELTGNSDGLATKLLALPAFVVAVAATRVLESNFARRQRPVVALLLAIECLFLLL
FT                   FIGTGLWAKAGAGLTANALPSTLAGMLAVVAMGIQNALSRTALADLGPTTIMTGNTTQV
FT                   VIDLVDLTSASPEQTGAIVTRLRKMLPAVVGFAAGAVLGALAYQAVSFWCVFLPVLLLA
FT                   AVCRQRWPGRVALA"
FT   gene            666581..667816
FT                   /gene="caiB"
FT                   /locus_tag="Rmet_4099"
FT   CDS_pept        666581..667816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="Rmet_4099"
FT                   /product="acyl-CoA transferase/L-carnitine dehydratase,
FT                   CaiB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10966"
FT                   /db_xref="GOA:Q1LFW0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFW0"
FT                   /protein_id="ABF10966.1"
FT                   /translation="MQKMEANKFRPLAGVKVLELSQILAGPTCGLMLGDLGADVVKIER
FT                   FPAGDDARKYRRQGDSGLPPSFLIVNRGKRSLGLDLRKEEGKAVLKRMVAQADVLTENF
FT                   RLGVMEKLGLGYDVLREVNPALIYCSITGYGRTGPLASKGGFDLILQAFSGLISVTGEP
FT                   GRDPVKPGMSIADVNAGILAAFGILAAYINRLRTGEGSRVETSLLQASMQQLYWYAAAY
FT                   FSTGAIAKPVGTAHPLIAPYQVYQCADGGIALGGANQTNWERIADVLGHPEWKADPRFD
FT                   SAAERLARRAELELLITDVLKGAPVATWVERFDAVGVPVGPVQNVAQALEHPQAKAVGM
FT                   VVEARKPGGGMTRALGLPVLFDGGNASSTGPAPALGEHSSSVLREFGFAAGEIEDLLRN
FT                   AVVHDCAHPVAA"
FT   gene            complement(667831..668514)
FT                   /locus_tag="Rmet_6647"
FT   CDS_pept        complement(667831..668514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6647"
FT                   /product="transcriptional regulator (GntR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_6647"
FT                   /db_xref="EnsemblGenomes-Tr:ADC45247"
FT                   /db_xref="GOA:D3DY77"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3DY77"
FT                   /protein_id="ADC45247.1"
FT                   /translation="MSEEKKSRTETIRSEIEQEILSGHLPSGTQIDEQQLIDRFGVSRT
FT                   PAREALIQLASAGLVTLVPRQGAIVSSITLRDYVALSEILVQLESLAARLASRRMTPAE
FT                   RDALATAYEACAAAQGDAEAYRAANDEFHGVLYEGSRNDILAKQIRTMRARMRGMRDYR
FT                   FEHPARVRASLAEHKAVLDAIKVGDEDGAAEAMVRHISAGGNVYADMIAAMPDDGAAVG
FT                   RGRRP"
FT   gene            668704..669462
FT                   /locus_tag="Rmet_4100"
FT   CDS_pept        668704..669462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4100"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10967"
FT                   /db_xref="GOA:Q1LFV9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV9"
FT                   /protein_id="ABF10967.2"
FT                   /translation="MTDTSGLPSLAIEGRVATITFQRPDVANRLGPDDLDEIHRHIETV
FT                   NASEALVLRIRGTGKYFCSGFDIGKLAAGQRGSGFEELVNAVEDCRPVTIAALNGGVYG
FT                   GGTDLALACDFRVGVPTTDMFMPAARLGLHFYKRGMERYVTRLGLDTAKRLFLTAARLQ
FT                   SDELLHCGFLTSLVDAADLDANVDALSETVASMAPLAVLGMKKHLNRIARGVLDVEELA
FT                   VDVARAAQSADIKEGALAWREKRKPRFQGN"
FT   gene            669510..670496
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_4101"
FT   CDS_pept        669510..670496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bugT"
FT                   /locus_tag="Rmet_4101"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10968"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV8"
FT                   /protein_id="ABF10968.1"
FT                   /translation="MKIAKASRVCIAAALLVPMTLAWAQGPAAYPTKPIRLIVGFPPGG
FT                   GADAVARIVAERMSRDLGQSIIIDNKPGAGTTIAAEAAARAEPDGYTVFMGSANLFGAD
FT                   KVLYKKIRYDGQKDFTPISRWTIAPMILAVNNDIGVKSVQELIAKAKQNPGKYFYASSG
FT                   SGGAPHMAGVYFNKLGGTRMEHVPFKGGAPAVTAVIAGDAQMIFATPPSVLPMVETGKL
FT                   KALAVTSEKRSPLLPNLPTVSESGVKGYDFTFWFGLFGPANLPPDVVRKLFTASQKALS
FT                   DPEVVQKLAVQGNEALPSASPDEFRKWALAEGAKSKQLIEQSGAHLD"
FT   gene            670596..671231
FT                   /locus_tag="Rmet_4102"
FT   CDS_pept        670596..671231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4102"
FT                   /product="transcriptional regulator, TetR familiy"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10969"
FT                   /db_xref="GOA:Q1LFV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV7"
FT                   /protein_id="ABF10969.1"
FT                   /translation="MARTSDKTDIPNRLTKAGRELFSHHGYNATGIQQITDHAGVPKGS
FT                   FYNHFESKEAFAAAIIAEYADYLHRSWEAMMEDAPPEPMAAIRYVFTRMIAYHECCPTQ
FT                   AGCLIGNFAAEIALTSDTCRAVLQDAQFAWRERLAGMISLAQAHGEIRADIASAELSGL
FT                   VWDTWEGALLRMKIERSVAPLRRSVDLMFDHLFQPAAAAGIHHSPTLE"
FT   gene            671239..672348
FT                   /gene="nemA"
FT                   /locus_tag="Rmet_4103"
FT   CDS_pept        671239..672348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nemA"
FT                   /locus_tag="Rmet_4103"
FT                   /product="N-ethylmaleimide reductase, FMN-linked"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10970"
FT                   /db_xref="GOA:Q1LFV6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV6"
FT                   /protein_id="ABF10970.1"
FT                   /translation="MGAQTEAFLTEALFQPIKLGRIELANRMAMAPLTRSRADDDLVPT
FT                   EMVVEYYRQRASVGLIIAEATQVSETAQGYTNTPGVYTPEQIAAWKTVTDAVHAQGGKI
FT                   FLQIWHTGRMSHSHFQPDNQAPVAPSAIAANAKTYINGQGYVECSLPRALEASEIPEIV
FT                   NDFRVAAANAIKAGFDGVEVHGAHGYLLDAFLRDGTNKRTDAYGGSIENRARFLLEVMA
FT                   AVTAEIGADRVGVRLAPVSPVNDAVESNPQPLFEYVVRELEKLHPVYIHVVEGYTGGPR
FT                   DNVPFDYEALHRLYSGVWMVNNGYSKEMAEEAIRAGRADMVSFGRKMITNPDLPRRFRE
FT                   NQPLNSPFEDASLYGGTGPHGYVDYPALA"
FT   gene            complement(672617..674602)
FT                   /gene="acxR"
FT                   /locus_tag="Rmet_4104"
FT   CDS_pept        complement(672617..674602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acxR"
FT                   /locus_tag="Rmet_4104"
FT                   /product="sigma54 specific transcriptional regulator"
FT                   /EC_number="6.4.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10971"
FT                   /db_xref="GOA:Q1LFV5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV5"
FT                   /protein_id="ABF10971.1"
FT                   /translation="MPFTHYGTLVPRISDEPVVASAWERFLRDHPHHPHEGDGVRRVVL
FT                   ASWQRCRSEAVDPTLHSAPGAADDRLRQLRTQNRDLCDAAGPALEGLRDILRECGTLIM
FT                   LSDTDGTILQLNGSTRVRSVGEEVNLAMGGCWSEEVIGTNAIGTAIATVAPVQIHASEH
FT                   FCWDVKRWTCAAAPILDPFGRHLLGVVDVSGVKESFHGHTLGLVVAAARQIESELARRD
FT                   MAMHERLLARSIDDFVRYASDCVVLADFRGRVVRINGRAQAARDAHGVCFALETGNAIP
FT                   GLDLTLPEVDQIHQRPGWLRPEWLHTVKDREGLLGTMLVIPLAARPGRTSISLPATPTA
FT                   VTTDDAFTEIIGESEILAATKARARRIASLDLPVLLVGETGAGKELFARALHRSGKRPD
FT                   GPFVAVNCGALTRELLASELFGYAEGAFTGARRGGHPGKFEQAAGGTLFLDEIGEMPLD
FT                   MQPHLLRVLQDGVVVRLGDTRERQVSVRLVAATNRDLQKEIAAGRFREDLYHRLCAVSL
FT                   QLPALRDRPGDIESIVDHLNHKLARKYGCAPKQIEPSVYQTLVRYRWPGNIRELQNVFE
FT                   VMFALGENNGIDVSMLSSLVESGPAGDAMAPAPMPMSAASGRLDDLERQAIRAAINDAR
FT                   GNLSKAARTLGISRSTLYVKLAALRT"
FT   gene            674904..677072
FT                   /gene="acxA"
FT                   /locus_tag="Rmet_4105"
FT   CDS_pept        674904..677072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acxA"
FT                   /locus_tag="Rmet_4105"
FT                   /product="acetone carboxylase beta subunit"
FT                   /EC_number="6.4.1.6"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10972"
FT                   /db_xref="GOA:Q1LFV4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV4"
FT                   /protein_id="ABF10972.1"
FT                   /translation="MTPMTGDNMQPHSTVQVMGIDAGGTMTDTFFVRSDGRFVVGKAQS
FT                   NPGDESLAIYNSSEDALAHWERTVDDVYPELLTCVYSGTAMLNRILMRKGLDVGLICNR
FT                   GFEQIHSMGRALQSYLGYALEDRIHLNTHRYDEPLVPVSRTRGVTERTDVQGKVVIPLR
FT                   EEEVRQATRELVEAKSQAIVICLLQSHKNESSEQRARDIVQDELAKLKVDVPVFASVDY
FT                   YPSRKESHRMNTTILEAYGAEPSRQTLKKVSDRFKKHGAKFDLRVMATHGGTISWKAKE
FT                   LARTIVSGPIGGVIGSKLLGEALGDENIACSDIGGTSFDVALITKGNFAIKSDPDMARL
FT                   VLSLPLVAMDSVGAGAGSFVRLDPYSKSIKLGPDSAGYRVGTCWPESGLDTVTVSDCHV
FT                   VLGYLNPENFLGGAIKLDVARARQHIKAQIADPLGLSVEDAAAGVIELLDLTLSEYLRA
FT                   NISAKGYNPAEFTCFSYGGAGPVHTYGYTGGVGFKDVVVPAWAAGFSAFGCACADFEYR
FT                   YDKSVDLGVAQFAPDGSKETACRILQEAWSELAVKVIEEFRANGFDARDVVLIPGYKMQ
FT                   YMGQLNDLEIVSPVATASSAEDWDRIVDAFENTYGRVYASSARSPELGFSITGAILRGM
FT                   VVTQKPVLPEDPDAGPTPPREAYLGVRPFYRHKTWMDAALWKMESLKAGNHIVGPAIIE
FT                   SDATTFVVPGGFETTIDKHRLFHLKEVK"
FT   gene            677084..679408
FT                   /gene="acxB"
FT                   /locus_tag="Rmet_4106"
FT   CDS_pept        677084..679408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acxB"
FT                   /locus_tag="Rmet_4106"
FT                   /product="Acetone carboxylase alpha subunit (or
FT                   Hydantoinase B/oxoprolinase)"
FT                   /EC_number="6.4.1.6"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10973"
FT                   /db_xref="GOA:Q1LFV3"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV3"
FT                   /protein_id="ABF10973.1"
FT                   /translation="MNMMSNKEVGFADLLKNGQTLKEFRDDILARTQESGHYNGLTSLD
FT                   FRDSDPIGYEKLFSKLRGGLVHARETAKKIAASPIVEQEGELCFTLYNAVGDCVLTSTG
FT                   IIIHVGTMGAAIKYMIENNWEANPGIYPGDMFTNNDCSIGNVHPCDIATIVPIFWEGRL
FT                   IGWVGGVTHVIDTGSVTPGSMSTGQTQRFGDGYMITCRKTGANDVPFRDWLHESQRSVR
FT                   TPKYWILDERTRIAGCHMIRELVEEVIRADGIEAYEKFAYEVIEEGRRGLQSRIKAMTL
FT                   PGKYRKVSFVDVPYKHPDVQVSNAFAKLDSIMHSPVEMTIRPDGKWRLDFEGASRWGWH
FT                   TFNAHQVAFTSGIWVMMCQTLVPTQRINDGAYFATEFRLPKGTWCNPDDRRTGHAYAWH
FT                   FLVSGWAALWRGLSQSYFSRGYLEEVNAGNANTSNWLQGGGINQDGEIHAVNSFEASSC
FT                   GTGACAVKDGLNHAAAIWNPEGDMGDIEIWEMAEPLLYLGRNVKANSGGYGKYRGGCGF
FT                   ETLRMVWNAQDWTMFFMGNGFMNSDWGMMGGYPSATGYRFEAHRTGLEQRIASGDSLPL
FT                   GGDIDPANPDYERHIDATAEVKRDKQCITTEDCYANHDLYLNYLRGGPGFGDPLDRDPK
FT                   AIEADLNQKFLLPEYAQKVYGAVFAQDARGVFAVDAAKTKKRRAEIRKERLARAVPTRE
FT                   WMKEERERILNKHASVQVQHMFATSFALSEKFTQSFKDFWNLPEAWHVREEELGVPCYG
FT                   AKHRMDLSLMPDVTTVVQVEE"
FT   gene            679432..679941
FT                   /gene="acxC"
FT                   /locus_tag="Rmet_4107"
FT   CDS_pept        679432..679941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acxC"
FT                   /locus_tag="Rmet_4107"
FT                   /product="Acetone carboxylase gamma subunit"
FT                   /EC_number="6.4.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10974"
FT                   /db_xref="GOA:Q1LFV2"
FT                   /db_xref="InterPro:IPR016750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV2"
FT                   /protein_id="ABF10974.1"
FT                   /translation="MSVYTNEQVDHLVEGKLDWETTFRMLSMPKDEGRFEQYLAALQAK
FT                   VSFPDRIVLPLGPHMYIVQSAASKKWVVKCDCGHEFCDYRENWKLHASIYVRDTEEAMA
FT                   EVYPTLMAPDTSWQVYREYYCPSCGAMHDVEAPTPWYPVIHDFEPDIEAFYKEWVHLPV
FT                   PERAPD"
FT   gene            complement(680121..680897)
FT                   /locus_tag="Rmet_4108"
FT   CDS_pept        complement(680121..680897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4108"
FT                   /product="class II aldolase (or adducin-like protein; or
FT                   Ribulose-5-phosphate 4-epimerase; or related epimerase)"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10975"
FT                   /db_xref="GOA:Q1LFV1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV1"
FT                   /protein_id="ABF10975.1"
FT                   /translation="MANTMQLSKSEIVASSLEKMQTELRADRMPLREAVAETCRILFTF
FT                   GHDSVLSGQITARAEQPGTYYTQRLGLGFDEITADNLLLVNEDLEVISGNGMPNPANRF
FT                   HSWLYRARPDLNCIVHSHAPHASALAMLEVPLTISHMDTCVLYDQTAFLEKWPGIPVGN
FT                   EEGELIAGALGDKKAILLSHHGLLVAGASVEEACVLGVMFERAARLQLLAMAAGEIQPI
FT                   PPELGREAQRWVSTQKRFEATFAYYSRRARRQLDAQ"
FT   gene            complement(680943..681947)
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4109"
FT   CDS_pept        complement(680943..681947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bug"
FT                   /locus_tag="Rmet_4109"
FT                   /product="extra-cytoplasmic solute receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10976"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFV0"
FT                   /protein_id="ABF10976.1"
FT                   /translation="MQVSPTRPTRPHRRRSLSSMASLAAATLLSIPFTAHATGYPDKPI
FT                   TLVVPFGAGGITDLIARATGKALSEQLGQSVVVENRPGAGGNIAADFVRRARPDGYTLM
FT                   FATVGVLAVNPHTDVKVNFDSAKDFTYISLVGSTPFLVVVGADVPANTLPALIKLAQRK
FT                   PDAISVGTAGVGSAPYQGMRIFQDVAKVEFLHVPFKSGAESVTNVVSGQVNMTFEATPQ
FT                   VMPFVTSGKLRALAVASPHRLSTAPQVPSTAELGFPSLVSGSVAGLIGPAGLDPAIVKK
FT                   LNAAVAKVAADPKFKATLIAQGTEPAASSPEQFRKLISDENQRWSALLGAGNK"
FT   gene            682057..682695
FT                   /locus_tag="Rmet_4110"
FT   CDS_pept        682057..682695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4110"
FT                   /product="transcriptional regulator, Xre/Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10977"
FT                   /db_xref="GOA:Q1LFU9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU9"
FT                   /protein_id="ABF10977.1"
FT                   /translation="MDAPVQARTNLDSGMSKKQKVEPVAAEPSIAERLAELRKLNGLTL
FT                   EELAQRASLTKSYLSKLERGLSSPTIGTVLKLADALGVTVDQLITRSSRANEILHIRAA
FT                   DRIPFSPSTERLGYTYEAIATERPDKAMQPFIMVPPFTLEEDQPMASHAGEELIFVVSG
FT                   EMEVLFDDRTVRMSAGDSLYFNASIPHRSRSLGRIQAQALVVVSDRKKA"
FT   gene            682835..683359
FT                   /locus_tag="Rmet_4111"
FT   CDS_pept        682835..683359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4111"
FT                   /product="putative sulferase (MOSC domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10978"
FT                   /db_xref="GOA:Q1LFU8"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU8"
FT                   /protein_id="ABF10978.1"
FT                   /translation="MEETVSQTSDRSVGATAPSWRGVVRFLHKTPRAFLPMLPFPEITL
FT                   VAGKGIEGDRYMIGNEAGFYSHKPEEGRQVTLFELETLEALARDAKVVLHPEEHRRNVT
FT                   VEGVPLNHLVGRRFWLGETLLEATRLSTPCRHLEEILGKAVFDPLVHRSGLNCKILSGG
FT                   VVRIGDVVRPA"
FT   gene            683359..684312
FT                   /locus_tag="Rmet_4112"
FT   CDS_pept        683359..684312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4112"
FT                   /product="oxidoreductase/oxygenase, vanB family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10979"
FT                   /db_xref="GOA:Q1LFU7"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU7"
FT                   /protein_id="ABF10979.1"
FT                   /translation="MAARPIKTVSVVVSAIDEPLPGVKRFVLSDQDHWPLPPFTPGAHI
FT                   DLHLGGGLVRTYSLCNEPSDRNRYVIAVKHEVAGRGGSAFVHERLDVGASIGVSLPRGG
FT                   IRTTDTGMNVFIAGGIGVTPFISTIRDLELRGQTNYVLHWSSAGVPSLVDMLGDAIAAG
FT                   RVRLYDTRVESAPDMDAILNACGENAKAYCCGPMRMLDAFERIVEGWPDARKHIERFAP
FT                   PKPVEDTDAAPYTVVLARSGKEAIVEPHVGLVGTLEALGADVSVSCGGGVCGACRTTWL
FT                   EGPPIHRDRVLSPEERAQDVMVCVAGCAGSRLVLDL"
FT   gene            684482..685342
FT                   /locus_tag="Rmet_4113"
FT   CDS_pept        684482..685342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10980"
FT                   /db_xref="GOA:Q1LFU6"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU6"
FT                   /protein_id="ABF10980.1"
FT                   /translation="MHTDPPDSVHPTQPLHDLHNRWPQAESVEDFRHNLAAVHARIAAA
FT                   CHRVGRDPAGVRLLPVSKAKPEASIRLAHAAGCRLLGENKPQEAYRKWEALADLEDLQW
FT                   SVIGHLQTNKAKLAARFATEFQALDSLRVAEALDRRLQIEGRALDVFVQVNTSGEASKF
FT                   GLHPDEVPGFLRALPAFSGLRVRGLMTLALLSAESERVRQCFVLLRELRERLRQDAPVG
FT                   IGLDELSMGMSGDFEIAIEEGATVVRVGQAIFGARSTPDSFYWPEAEAGDSTLSAAHSG
FT                   RQGER"
FT   gene            685379..686245
FT                   /gene="pdxK"
FT                   /locus_tag="Rmet_4114"
FT   CDS_pept        685379..686245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxK"
FT                   /locus_tag="Rmet_4114"
FT                   /product="pyridoxal kinase (PL/PN/PM kinase family)"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10981"
FT                   /db_xref="GOA:Q1LFU5"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR023479"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1LFU5"
FT                   /protein_id="ABF10981.1"
FT                   /translation="MFGETGTGDALRPIFMDVVSVQSQVVYGHVGNNVALPTLRAHGLN
FT                   VAAVPTVMFSNTPHYPTLHGGALPIDWFGGYLSDLSARGALQRLKAILVGYLGNPEQVA
FT                   VLSRWINQVLAEHPDVQVIVDPVIGDHDTGIYVADGMVEAVRELLLPLAHGLTPNDFEL
FT                   GHLSGRSADSVEQVVAAARSLLTDRVQWMVVTSAAPGTWGHDDMKLLIVTRDDAQVLSH
FT                   PRIPVSPKGTGDLFSAKLTARLLEGMPLAEAAASASDHVVTALEATRRAQSLELQLPSN
FT                   PCITHRE"
FT   gene            686250..686501
FT                   /locus_tag="Rmet_4115"
FT   CDS_pept        686250..686501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU4"
FT                   /protein_id="ABF10982.1"
FT                   /translation="MKTYRLNIWRHDRLLGHFDSGTPWAAEAVKDVAGRLGAADGYRLE
FT                   LLVATDERRVVESGPGGVRVLGIEPLFVKTSLDEHPRG"
FT   gene            complement(686559..687413)
FT                   /gene="psd"
FT                   /locus_tag="Rmet_4116"
FT   CDS_pept        complement(686559..687413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="Rmet_4116"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10983"
FT                   /db_xref="GOA:Q1LFU3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU3"
FT                   /protein_id="ABF10983.1"
FT                   /translation="MSFSVLLQRLAPLHLLTRIAGQLADCRQPWLAQYLIRTFVRRHKI
FT                   DLDEALVSDLATYPTFNEFFIRALRPGARPIAAADWTSPVDGTISQIGRVEAGQMIHAK
FT                   QHAYSATALLGDAALAKQLEGGCFSTVYLSPRNYHRIHMPCEGRLLGMRHVPGKLYSVR
FT                   PDIVEGIDGLLAINERLVCWFEHPQHGVFALVLVGAAIVGRIATVWHGLVEPKRSGQVS
FT                   EWHYADGASAPQLKDLLQGVEMGHFQLGSTIVLLMPGSAWQYHPDWQVGQPVRLGQAIA
FT                   SRG"
FT   gene            687390..687602
FT                   /pseudo
FT                   /locus_tag="Rmet_6648"
FT   CDS_pept        687390..687602
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_6648"
FT                   /note="hypothetical protein"
FT   gene            complement(687583..688878)
FT                   /gene="pdxR"
FT                   /locus_tag="Rmet_4117"
FT   CDS_pept        complement(687583..688878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxR"
FT                   /locus_tag="Rmet_4117"
FT                   /product="transcriptional regulator with aminotransferase
FT                   and DNA binding domains (possibly involved in vitB6
FT                   biosynthesis)"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10984"
FT                   /db_xref="GOA:Q1LFU2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU2"
FT                   /protein_id="ABF10984.1"
FT                   /translation="MKIHGKTAAEIFDCVRTLTQSRQLLPGTSLPPVRDLALELGINRN
FT                   TVAAAYKRLAMAGIAVTQGRLGTIIRDQYEPGEQEGTLAGSPLTDLASGNPNIEWLPDI
FT                   SAALQSRPYKPRLYGEPTVNAGLEAYARKWFEPDCPAPFEVNLAHGAVDAIERLLNAYL
FT                   VAGDKVAVENPCFLSSINTLRAIGLQPIGVPMDAEGIQAEGLASALAKGAQAVILTPRA
FT                   HNPTGCCLSEKRARAISRLLAKHPNVPVIVDDHFALLSGAAYHPVIPRSTYRWAVVRSF
FT                   TKALGPDLRVAAVASDVATSRQLRLCLAPGTSWVSHLLQDIVEVTVTRPETIRLIDKAR
FT                   NDYARRRQAMEQALDAQGIGHMAQGDGFNLWVPLQCDDQAIALALARQGWLVRQGSVFS
FT                   VQDGVRGLRITISAIEPAQCERLAQDIRRSLG"
FT   gene            complement(688957..689208)
FT                   /locus_tag="Rmet_4118"
FT   CDS_pept        complement(688957..689208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10985"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU1"
FT                   /protein_id="ABF10985.1"
FT                   /translation="MILRHSIVTDRNNGPGGGRQVPLAAPTADRRGAPARRAPGEPPPR
FT                   MRREAHFNPVSPIPLHHRFLPYANRWIGIPAKCPGMSE"
FT   gene            689290..689727
FT                   /gene="hmyF"
FT                   /locus_tag="Rmet_4119"
FT   CDS_pept        689290..689727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmyF"
FT                   /locus_tag="Rmet_4119"
FT                   /product="auxiliary protein of the heavy metal
FT                   cation-transporting efflux system HmyCBA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFU0"
FT                   /protein_id="ABF10986.1"
FT                   /translation="MRFVLFLLTALCLSALSFSAAANVRSAVPKVVAAKAEAAKVEVAI
FT                   PDYDARLATGDDLAQLALPGDPDFGDDAEFDDGPPPGYCNIWSADLLDPPDLFDAVDET
FT                   SALFILPTFQLAQSVDVVLPTLTERGKFQSEGQFRPPRPFV"
FT   gene            689926..691308
FT                   /gene="hmyC"
FT                   /locus_tag="Rmet_4120"
FT   CDS_pept        689926..691308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmyC"
FT                   /locus_tag="Rmet_4120"
FT                   /product="heavy metal cation tricomponent efflux outer
FT                   membrane porin HmyC (CzcC-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10987"
FT                   /db_xref="GOA:Q1LFT9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT9"
FT                   /protein_id="ABF10987.1"
FT                   /translation="MKTKKTLTWAAALSLMSAPAWAAQPVPAGVTAAPGAASPQAAKLA
FT                   AKAMARATTPAPDTFDLPQLLQLAQSTNKGVEAAQANVDAATAAITSARAYPNPQVEVM
FT                   YGRLSGKQPGVTSGNAPSYAIVQKLDYPNQRNLREQMAGRGLEASEAMRQGFRSDLAAR
FT                   VKTSYYQVLRRETELAAAREDLNMMRQIQERAKVRVNVGEAPRYELIKADTELLAAQKT
FT                   LQTAELRVDQAKATLRQQVGGVMPARFALDGSLGHAPDMPPLATLRDTLQASNAELTQR
FT                   RSELERAKLGVDYQRALRWPEVAVRASTDRQPDNNVSQIGLVMTIPIWDRRSGPVGEAT
FT                   AQATQARTALEAREFELMQELDTAYRQYEIAQAQVTALESGIVREAESALGVAESAYRF
FT                   GERGILDYLDAQRVLRSARSELIAAQYELQVAAIQIDKLMSASPGVNTAPASSMPDLPN
FT                   LN"
FT   gene            691311..692465
FT                   /gene="hmyB"
FT                   /locus_tag="Rmet_4121"
FT   CDS_pept        691311..692465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmyB"
FT                   /locus_tag="Rmet_4121"
FT                   /product="heavy metal cation tricomponent efflux, membrane
FT                   fusion protein HmyB (CzcB-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10988"
FT                   /db_xref="GOA:Q1LFT8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT8"
FT                   /protein_id="ABF10988.1"
FT                   /translation="MRPQFLLSFAAAAVMMLSLAGCSDDPAPAAEAPKLPPGIVKPEEN
FT                   LKRTLKVAPVAASPFSEMLRVAGRIDFDEQRVSRIGASVTGRVTDLYAVLGQEVKAGQV
FT                   LARLHSSELGAAQMAFLKAEAQNTLQARNAERARQLFAADVIGRAELQRRESEYAIAAA
FT                   EARAYRDQLRVLGMSAASIATLAKSGSIESYSPVFSSINGTVVERNVAQGQVVQPADAL
FT                   YTVADLSRVWVVAEVPEQQAAQVAEGQSVDIEVPSLANSNGRITGKLIYVGRTVNPQSR
FT                   TVLVRTELQNKDGRLKPAMLATMLIAAKPVELLVVPGSAVVREGNDEQVYVEVGDGQYR
FT                   LTKVKLGPESDGMRVVQSGIKPGDRVVVEGAFHLDNERKQQEQG"
FT   gene            complement(692550..693578)
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_4122"
FT   CDS_pept        complement(692550..693578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="Rmet_4122"
FT                   /product="transposase IS1088"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10989"
FT                   /db_xref="GOA:Q1LB62"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LB62"
FT                   /protein_id="ABF10989.1"
FT                   /translation="MTKKNYQQLSETERHAIALGLQQKQSLSAIARALGRDKSTISREC
FT                   NRNAGGKGYASKFAQQRSDNRKRQARPSPKLHRQGPLFPLVCDYLRHKWSPQQIANELQ
FT                   RLHPQDRRLQASHESIYTCIYAQPRGELKKELVSCLRMAHAKRWPRSRGKDRRKETQDL
FT                   LSIHVRAPEIEDRQLPGHWEGDLIKGKANASAIGTLVERTTRLVVLVKLPHPNPATAAH
FT                   VLQAFSDKLKTIAQPMRQTLTYDRGSEMAEHRQLSENTGMKVYFCDPYSPWQRGSNENT
FT                   NGLLRQYFPKGTDLSGYSQEQLDAVADELNGRPRMTLGWRKPIEVYAEHLARLAQQPDL
FT                   VH"
FT   gene            693623..696694
FT                   /gene="hmyA"
FT                   /locus_tag="Rmet_4123"
FT   CDS_pept        693623..696694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmyA"
FT                   /locus_tag="Rmet_4123"
FT                   /product="heavy metal cation tricomponent efflux pump HmyA
FT                   (CzcA-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10990"
FT                   /db_xref="GOA:Q1LFT6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT6"
FT                   /protein_id="ABF10990.1"
FT                   /translation="MCVIAVVLFFFGLRAAGKLSVDAFPDVTNVQVQIATEATGRSPEE
FT                   VERFVTVPIEMSMTGLPGLEEMRSLNKAGLSLITLVFTDKTDVYFARQLVMERLIEVSG
FT                   RMPEGVTPVLGPVSTGLGEVYQYTLDRADDGDRELTQEELSERRIAQDWVVRPLLRSIP
FT                   GVAEINSQGGFVRQYQALVNPERMRHYGINIQQVYQALARNNANSGGGVLPHYAEQYLI
FT                   RGVGLAKGVDDIGSIVLKEINGTPVYLRDVAQVTIGHEVRQGALVKNGQTEAVGGIVMM
FT                   MRGGNAKEVVSRVKARVADINERGMLPGKLQIVPYYDRSELVDSALWTVTKVLLEGVVL
FT                   VVIVLFLFLGDVRSSVIVLATLVLTPLLTFIVMNQVGLSANLMSLGGLAIAIGLMVDGS
FT                   VVVVENAFERLGHAEKTGLTRTQVLVKAVQEVATPVIVGVGIIILVFLPLMTLSGMEGK
FT                   MFAPLAFTISIALAISLFLSLTLSPVLSSYLLKGGAEHDTRVIAFMKRYYLRMLHWSLA
FT                   NSKKTVLSAVGLFIATLMIVPLLGTSFIPEMKEGSIVPAIDRVPNISLEESIKLEKQAN
FT                   KLVLEVPGVKSVVSGVGRGESPADPQGQNESTPIASLKDRDEWPDGWTQDDIANAIREK
FT                   LKAIPGVQIVMAQPISDRVDEMVSGVRSDIAVKIFGDDLETLRDLAGQIARVAGGIQGS
FT                   QDIRIERISGQQYLSIEIDRQAIARYGLNVSDIHDIIEIAIGGKRATDIFEGERRFAAA
FT                   VRLPEEFRSNVQEIRQLLVSAPDGVQVPLQSVAKIEVTDGPAQISREMAKRRVVVMINV
FT                   KDRDLGGFVAELQSATESKVKLPEGYYFEWGGQFQNMERAMGHLKIIVPITIAAIFFLL
FT                   FLLFNSVRYATLIITVLPFASIGGIIGLFVTGEYLSVPASVGFIALWGMAVLNGVVLVS
FT                   YIRTLRESGMSLRNAVVRGATQRFRPVMMTATIAMLGLVPFLFSTGPGSEVQRPLAVVV
FT                   IGGLITSTLLTLVMVPTLYRWFDDRKPEPRDMSV"
FT   gene            696796..697170
FT                   /locus_tag="Rmet_4124"
FT   CDS_pept        696796..697170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10991"
FT                   /db_xref="InterPro:IPR021305"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT5"
FT                   /protein_id="ABF10991.1"
FT                   /translation="MTIQARRVLTALALIALPVTAMAAPAASSADAPVNVELGQRGGKP
FT                   EAPEAPGACMNAVKAALPNPDQFRWVRGTTRRVAEDVYSVVGSIEYVDKSGQARKGEAQ
FT                   CDVMRAPGNQFIVPKVRLPQ"
FT   gene            697319..697816
FT                   /locus_tag="Rmet_4125"
FT   CDS_pept        697319..697816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10992"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT4"
FT                   /protein_id="ABF10992.1"
FT                   /translation="MKIEATNEHRWLQKLVGRWVGEGEAQMGPEAPPEKWKIPEQVSQV
FT                   GDVWVQARAEGEFPGCGSAVTIMTLGYDPVRKHFVGTFIGSMMTHMWVYEGDLEADGRT
FT                   LTLRADGPAFGPDGNVIEGKTAKYRDVVAMVDDDHRTLTSFMQADNGEWMQIVQARYRR
FT                   EK"
FT   gene            697911..698543
FT                   /locus_tag="Rmet_4126"
FT   CDS_pept        697911..698543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4126"
FT                   /product="putative nitrogen fixation protein NifQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10993"
FT                   /db_xref="GOA:Q1LFT3"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT3"
FT                   /protein_id="ABF10993.1"
FT                   /translation="MNRSLLLLDAFAAQPGDPVTRALAGVLESACAGRLPRFAQWLGLP
FT                   PDAFRHMLDHCFPGAAQAGWAPDVPPQAPDSLPCEFADLVEMLEDGCTPGAAGTLVPLV
FT                   HWAAHALACGCFGHTHLWQDMGLSGRDDVSALLRQVFWPVFAANTTDMKWKKFFYHRVC
FT                   ERLDIHPCPEPSCEGCDHYAACHGAESAIESAIESVIESVIVRQPRS"
FT   gene            complement(698602..698946)
FT                   /locus_tag="Rmet_4127"
FT   CDS_pept        complement(698602..698946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT2"
FT                   /protein_id="ABF10994.1"
FT                   /translation="MRDMKQRNTRDCVHLLIDGLKRQGPLRRDVMADACGLTPEETTRA
FT                   LKAARQMNVVDHVPYGPGTLPGAIFYQLTGRQLPPARKSTRVPRAPDDRFQPLLEAWWS
FT                   SNELDRVDRA"
FT   gene            699161..700090
FT                   /gene="imuA"
FT                   /locus_tag="Rmet_4128"
FT   CDS_pept        699161..700090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imuA"
FT                   /locus_tag="Rmet_4128"
FT                   /product="DNA damage-inducible mutagenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT1"
FT                   /protein_id="ABF10995.1"
FT                   /translation="MTVSSHVTPPTVVAGHAASSSSAPRASVSELEHRYPGLWRAGQLG
FT                   RAGRLPVCPTGYDALTAELPGGGWPVGAVTELLLAQGGAGELRLLMPALRALAAAGRCI
FT                   GFVDPPYLPNAAGLAAGLADGGLPARQLYWVRPQAGASVASRRADMAWAAEQMLRSQAF
FT                   GAVLVWLPAARPEALRRLQVLAQAGDTVVWVLRPIRVLHESSPAMLRLALSPLPGNLLS
FT                   IVFHKRRGPARDTPLLLPLEGMLHVPRRAGVPAVPTPVALVVPATPAGADHHVPDISDI
FT                   RGSASHPGVLDRGAPAAPAAGRAAAELA"
FT   gene            700107..701690
FT                   /gene="imuB"
FT                   /locus_tag="Rmet_4129"
FT   CDS_pept        700107..701690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imuB"
FT                   /locus_tag="Rmet_4129"
FT                   /product="nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10996"
FT                   /db_xref="GOA:Q1LFT0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFT0"
FT                   /protein_id="ABF10996.1"
FT                   /translation="MPAATSAHASASTSVDPRPAPHTGTLHQALPVAVIEHERVVLANG
FT                   PAVALGVRYGMRRGGVQALSADVVQLDRDLAAESALMTSAALALLHFTPAVAIDAEPEA
FT                   ATVMLDVTASLRLFGGHRALCRAIRARVRQLGTFAQIGSGTTAQGAAWLARQPLRKTSR
FT                   GIVRPARRAVRAARMTRLLDRLPVECLHTLADPEWLEGIGCRTLGQVRRLPRAGLSRRI
FT                   GTELLARLDQAYGQISSGFAWFEAPPAFAQRMELPGRVESAEGVLAGAQRLLLALSGWL
FT                   AVQQAGVTRCVLMLEHERYRLGEDTDSTPVPLRLAQPSRDPVHLSKLLREKLDKIRFHA
FT                   PVGGLALRVEAMEICVPQSDSLFPEPGAEPAELGRLLDTLVARLGRDNVLQPHPQADHR
FT                   PERANQWAPVDEPPARVAASGTTSGTTNGRTSGGAAPPERPLWLLESPLPLRVHKHRPV
FT                   HDGPLVMLTRPERIEAGWWDGGLATRDYFIAERDDGLRCWVYRERPGHPTRDGQEDGGE
FT                   YRWFLHGLFA"
FT   gene            701717..705178
FT                   /gene="dnaE2"
FT                   /locus_tag="Rmet_4130"
FT   CDS_pept        701717..705178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE2"
FT                   /locus_tag="Rmet_4130"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10997"
FT                   /db_xref="GOA:Q1LFS9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFS9"
FT                   /protein_id="ABF10997.1"
FT                   /translation="MLSGLSSLLPSLPDYVELHCISNFTFLNGASHPQELISRAFQLGY
FT                   SGLALTDECSVAGTARAHHAIKVLREDMWEAVTRSARRLAAGQTAGDVDEIEELSAFDL
FT                   DTGGEESDAGGVDDAEDTEDEDALSPDDFDDDPDAAARRHRVLEARAAAADAFNLIIGS
FT                   RFTLTAAPEDTMPPPRLVLLARNRIGFGDLCEFITLGRTRAEKGSYLLYPSDLADPQPE
FT                   QAHLRGMPDCLVVLLPDYCADLDVLRAQARWCRATFGDRAWMAMELLQGHAEAMHRARL
FT                   QQVSAETGVPLVAAGAVNMHVRSRKPLADVLTAIRIGQPLSACGRALAPNAEAHLRMRQ
FT                   VLSRLYPREALAQTLKLADQCRFSLDMLRYEYPEELVPDGETPITYLRKEVERGITERF
FT                   PHGMAPEWKKQLKEELELIEEKHYEPFFLTVHDIVRFARQEGILCQGRGSAANSLVCYC
FT                   LHITEVSPEQANLLFGRFLSRERDEPPDIDVDFEHQRREEVIQYIYGKYGRHRAALAAS
FT                   LITYRSRSALRDVGRALGIDPGVVEQVVKGQAWWDGGAAFIDRISRYGLDPDSITVRQW
FT                   ASLTEQLRGFPRHLSQHVGGFVIARDKLSRLVPIENAAMENRSVIQWDKDDLESLGLLK
FT                   VDVLALGMLTAIRRALTMIPNPDPERAGLPTRMEDLPDGDVKTYDMICKADTIGVFQIE
FT                   SRAQQSMLPRLQPREYYDLVVEVAIVRPGPIQGGMVHPYLKRREAFRLTRKLPTYFDDV
FT                   IRRVLGRTLGVPIFQEQVMQLAIEAAGFTPGQADQLRRSMAAWRRRGDLKKHQDALVRA
FT                   LTGRGYPESFALAICKQIEGFGEYGFPESHAASFAKLVYVSAWIKCHYPEAFLCALLNS
FT                   QPMGFYSPSQLVQDARRHGVTSQPVDVTISNWESTLEPRREGQNFRDVRLGMNRVKGMR
FT                   EAAALRIEAARVARPFDSVEDLARRASLDRHDIDALAAADALVSLAGHRRQARWHARGA
FT                   AVQTAHRDLLHDAPPQEHALQLPEPKLGEDVAADYASLGLSLKCHPLTLLRHRLRALKF
FT                   ATARQLANCANGRRVRACGIVTVRQRPSTASGTIFTSIEDETGAVNVIIWPDLVERQRK
FT                   EVLGATLLGVIGTWQRQGEVRHLVADELVDLSPLLGRLMVGSRDFH"
FT   gene            complement(705457..706110)
FT                   /locus_tag="Rmet_4131"
FT   CDS_pept        complement(705457..706110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4131"
FT                   /product="1-Cysteine peroxiredoxin (thiol peroxidase)"
FT                   /EC_number="1.11.1.7"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10998"
FT                   /db_xref="GOA:Q1LFS8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFS8"
FT                   /protein_id="ABF10998.1"
FT                   /translation="MAIRLGEEAPDFTADTTEGKIHFHEWIGDSWAILFSHPKDFTPVC
FT                   TTELGYMAKLKPEFDKRNTKIIGLSIDPVGDHSRWVKDIEETQGATVNYPMIGDHDLKV
FT                   AKLYDMIHPEASGGPRTAADNATIRAVFMIGPDKKVKAMLVYPMSAGRNFDEVLRLLDS
FT                   LQLNAKHTVATPVNWKPGDDVIIPTSVSDDDAKKKYPQGFKTLKPYLRTVAQPK"
FT   gene            complement(706284..707417)
FT                   /locus_tag="Rmet_4132"
FT   CDS_pept        complement(706284..707417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmet_4132"
FT                   /product="putative di-hydro-lipoamide acetyltransferase (E2
FT                   component of pyruvate dehydrogenase complex)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF10999"
FT                   /db_xref="GOA:Q1LFS7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFS7"
FT                   /protein_id="ABF10999.1"
FT                   /translation="MRIFKLPDLGEGLQEAEIVNWHVKPGDTIAADQPLLSVETAKAIV
FT                   EIPSPFAGQVAKLFAQPGDIVHLGAPLVGFEGAGASDDAGTVVGAVKVGTHVVNEGVTR
FT                   VGAAGIPGGHGIKATPAVRALARKLSVDLSMVTPSGHDGVITATDVQRVATTLADVGAP
FT                   DVLRGVRRAMAQNMARAQSEVAAATVMDDADLHAWQATGASVTGQDITIRLVRALVAGV
FT                   RAEPALNAWYEGRTGRRHLLERIDVGIAADLPEGLFVPVLRNVGKRDAADLRAGLDRMR
FT                   ADVVARTIAPEEMRGNTITLSNFGMIAGRYAAPIVVPPTVAILGAGRVRDEVVASGGVP
FT                   AVHRVMPLSLTFDHRVVTGGEAARFLRAVIEDLERPE"
FT   gene            complement(707434..708414)
FT                   /gene="pdhB"
FT                   /locus_tag="Rmet_4133"
FT   CDS_pept        complement(707434..708414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="Rmet_4133"
FT                   /product="putative oxidoreductase (puryvate dehydrogenase
FT                   E1 component, beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF11000"
FT                   /db_xref="GOA:Q1LFS6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LFS6"
FT                   /protein_id="ABF11000.1"
FT                   /translation="MAELHMVEAVNLALAHALANDPDVVLLGEDIGVNGGVFRSTVGLQ
FT                   SRFGEARVIDTPLAEGAIVGAAIGMAAMGLKPVAEIQFAGFIYPAIDNILNHAGHMRHR
FT                   TRGRITCPMVVRAPSGAGIHAPEHHSESPEALFAQMPGIRVVMPSSPARAYGLLLAAIR
FT                   DPDPVIFLEPTRLYRLFRQEVADDGQALPLDACFTLREGTDLTLVSWGAMLRETLAAAD
FT                   VLADDGVSAAVIDVATLKPLDMETILESVAQSGRCVIVHEAPRTAGLGAEIAANLADAG
FT                   LYSLSAPVQRVTAPDTVVPLARLEHSYMPSVARIVDAARRALEAA"
FT   gene            complement(708407..709510)
FT                   /gene="pdhA"
FT                   /locus_tag="Rmet_4134"
FT   CDS_pept        complement(708407..709510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="Rmet_4134"
FT                   /product="putative oxidoreductase (puryvate dehydrogenase
FT                   E1 component, alpha subunit)"
FT                   /EC_number="1.2.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Rmet_4134"
FT                   /db_xref="EnsemblGenomes-