(data stored in ACNUC7421 zone)

EMBL: CP000356

ID   CP000356; SV 1; circular; genomic DNA; STD; PRO; 3345170 BP.
XX
AC   CP000356; AAIP01000000-AAIP01000028;
XX
PR   Project:PRJNA13907;
XX
DT   19-MAY-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Sphingopyxis alaskensis RB2256, complete genome.
XX
KW   .
XX
OS   Sphingopyxis alaskensis RB2256
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Sphingomonadaceae; Sphingopyxis.
XX
RN   [1]
RP   1-3345170
RX   DOI; 10.1073/pnas.0903507106.
RX   PUBMED; 19805210.
RA   Lauro F.M., McDougald D., Thomas T., Williams T.J., Egan S., Rice S.,
RA   DeMaere M.Z., Ting L., Ertan H., Johnson J., Ferriera S., Lapidus A.,
RA   Anderson I., Kyrpides N., Munk A.C., Detter C., Han C.S., Brown M.V.,
RA   Robb F.T., Kjelleberg S., Cavicchioli R.;
RT   "The genomic basis of trophic strategy in marine bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(37):15527-15533(2009).
XX
RN   [2]
RP   1-3345170
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Munk A.C., Chertkov O., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Cavicchioli R., Robb F., Ertan H., Schut F., Ting L.M., Richardson P.;
RT   "Complete sequence of chromosome of Sphingopyxis alaskensis RB2256";
RL   Unpublished.
XX
RN   [3]
RP   1-3345170
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Munk A.C., Chertkov O., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Cavicchioli R., Robb F., Ertan H., Schut F., Ting L.M., Richardson P.;
RT   ;
RL   Submitted (20-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f3874c65ad5384b7d7c5990422a1cdf2.
DR   BioSample; SAMN02598319.
DR   EnsemblGenomes-Gn; EBG00001157916.
DR   EnsemblGenomes-Gn; EBG00001157917.
DR   EnsemblGenomes-Gn; EBG00001157918.
DR   EnsemblGenomes-Gn; EBG00001157919.
DR   EnsemblGenomes-Gn; EBG00001157920.
DR   EnsemblGenomes-Gn; EBG00001157921.
DR   EnsemblGenomes-Gn; EBG00001157922.
DR   EnsemblGenomes-Gn; EBG00001157923.
DR   EnsemblGenomes-Gn; EBG00001157924.
DR   EnsemblGenomes-Gn; EBG00001157925.
DR   EnsemblGenomes-Gn; EBG00001157926.
DR   EnsemblGenomes-Gn; EBG00001157927.
DR   EnsemblGenomes-Gn; EBG00001157928.
DR   EnsemblGenomes-Gn; EBG00001157929.
DR   EnsemblGenomes-Gn; EBG00001157930.
DR   EnsemblGenomes-Gn; EBG00001157931.
DR   EnsemblGenomes-Gn; EBG00001157932.
DR   EnsemblGenomes-Gn; EBG00001157933.
DR   EnsemblGenomes-Gn; EBG00001157934.
DR   EnsemblGenomes-Gn; EBG00001157935.
DR   EnsemblGenomes-Gn; EBG00001157936.
DR   EnsemblGenomes-Gn; EBG00001157937.
DR   EnsemblGenomes-Gn; EBG00001157938.
DR   EnsemblGenomes-Gn; EBG00001157939.
DR   EnsemblGenomes-Gn; EBG00001157940.
DR   EnsemblGenomes-Gn; EBG00001157941.
DR   EnsemblGenomes-Gn; EBG00001157942.
DR   EnsemblGenomes-Gn; EBG00001157943.
DR   EnsemblGenomes-Gn; EBG00001157944.
DR   EnsemblGenomes-Gn; EBG00001157945.
DR   EnsemblGenomes-Gn; EBG00001157946.
DR   EnsemblGenomes-Gn; EBG00001157947.
DR   EnsemblGenomes-Gn; EBG00001157948.
DR   EnsemblGenomes-Gn; EBG00001157949.
DR   EnsemblGenomes-Gn; EBG00001157950.
DR   EnsemblGenomes-Gn; EBG00001157951.
DR   EnsemblGenomes-Gn; EBG00001157952.
DR   EnsemblGenomes-Gn; EBG00001157953.
DR   EnsemblGenomes-Gn; EBG00001157954.
DR   EnsemblGenomes-Gn; EBG00001157955.
DR   EnsemblGenomes-Gn; EBG00001157956.
DR   EnsemblGenomes-Gn; EBG00001157957.
DR   EnsemblGenomes-Gn; EBG00001157958.
DR   EnsemblGenomes-Gn; EBG00001157959.
DR   EnsemblGenomes-Gn; EBG00001157960.
DR   EnsemblGenomes-Gn; EBG00001157961.
DR   EnsemblGenomes-Gn; EBG00001157962.
DR   EnsemblGenomes-Gn; EBG00001157963.
DR   EnsemblGenomes-Gn; EBG00001157964.
DR   EnsemblGenomes-Gn; EBG00001157965.
DR   EnsemblGenomes-Gn; EBG00001157966.
DR   EnsemblGenomes-Gn; EBG00001157967.
DR   EnsemblGenomes-Gn; EBG00001157968.
DR   EnsemblGenomes-Gn; EBG00001157969.
DR   EnsemblGenomes-Gn; Sala_R0001.
DR   EnsemblGenomes-Gn; Sala_R0002.
DR   EnsemblGenomes-Gn; Sala_R0003.
DR   EnsemblGenomes-Gn; Sala_R0004.
DR   EnsemblGenomes-Gn; Sala_R0005.
DR   EnsemblGenomes-Gn; Sala_R0006.
DR   EnsemblGenomes-Gn; Sala_R0007.
DR   EnsemblGenomes-Gn; Sala_R0008.
DR   EnsemblGenomes-Gn; Sala_R0009.
DR   EnsemblGenomes-Gn; Sala_R0010.
DR   EnsemblGenomes-Gn; Sala_R0011.
DR   EnsemblGenomes-Gn; Sala_R0012.
DR   EnsemblGenomes-Gn; Sala_R0013.
DR   EnsemblGenomes-Gn; Sala_R0014.
DR   EnsemblGenomes-Gn; Sala_R0015.
DR   EnsemblGenomes-Gn; Sala_R0016.
DR   EnsemblGenomes-Gn; Sala_R0017.
DR   EnsemblGenomes-Gn; Sala_R0018.
DR   EnsemblGenomes-Gn; Sala_R0019.
DR   EnsemblGenomes-Gn; Sala_R0020.
DR   EnsemblGenomes-Gn; Sala_R0021.
DR   EnsemblGenomes-Gn; Sala_R0022.
DR   EnsemblGenomes-Gn; Sala_R0024.
DR   EnsemblGenomes-Gn; Sala_R0025.
DR   EnsemblGenomes-Gn; Sala_R0026.
DR   EnsemblGenomes-Gn; Sala_R0027.
DR   EnsemblGenomes-Gn; Sala_R0028.
DR   EnsemblGenomes-Gn; Sala_R0029.
DR   EnsemblGenomes-Gn; Sala_R0030.
DR   EnsemblGenomes-Gn; Sala_R0031.
DR   EnsemblGenomes-Gn; Sala_R0034.
DR   EnsemblGenomes-Gn; Sala_R0035.
DR   EnsemblGenomes-Gn; Sala_R0036.
DR   EnsemblGenomes-Gn; Sala_R0037.
DR   EnsemblGenomes-Gn; Sala_R0038.
DR   EnsemblGenomes-Gn; Sala_R0039.
DR   EnsemblGenomes-Gn; Sala_R0040.
DR   EnsemblGenomes-Gn; Sala_R0042.
DR   EnsemblGenomes-Gn; Sala_R0043.
DR   EnsemblGenomes-Gn; Sala_R0044.
DR   EnsemblGenomes-Gn; Sala_R0045.
DR   EnsemblGenomes-Gn; Sala_R0046.
DR   EnsemblGenomes-Gn; Sala_R0047.
DR   EnsemblGenomes-Gn; Sala_R0048.
DR   EnsemblGenomes-Gn; Sala_R0049.
DR   EnsemblGenomes-Gn; Sala_R0050.
DR   EnsemblGenomes-Gn; Sala_R0051.
DR   EnsemblGenomes-Gn; Sala_R0052.
DR   EnsemblGenomes-Tr; EBT00001746736.
DR   EnsemblGenomes-Tr; EBT00001746738.
DR   EnsemblGenomes-Tr; EBT00001746741.
DR   EnsemblGenomes-Tr; EBT00001746745.
DR   EnsemblGenomes-Tr; EBT00001746749.
DR   EnsemblGenomes-Tr; EBT00001746752.
DR   EnsemblGenomes-Tr; EBT00001746754.
DR   EnsemblGenomes-Tr; EBT00001746757.
DR   EnsemblGenomes-Tr; EBT00001746760.
DR   EnsemblGenomes-Tr; EBT00001746764.
DR   EnsemblGenomes-Tr; EBT00001746768.
DR   EnsemblGenomes-Tr; EBT00001746771.
DR   EnsemblGenomes-Tr; EBT00001746773.
DR   EnsemblGenomes-Tr; EBT00001746775.
DR   EnsemblGenomes-Tr; EBT00001746778.
DR   EnsemblGenomes-Tr; EBT00001746781.
DR   EnsemblGenomes-Tr; EBT00001746785.
DR   EnsemblGenomes-Tr; EBT00001746787.
DR   EnsemblGenomes-Tr; EBT00001746790.
DR   EnsemblGenomes-Tr; EBT00001746792.
DR   EnsemblGenomes-Tr; EBT00001746795.
DR   EnsemblGenomes-Tr; EBT00001746796.
DR   EnsemblGenomes-Tr; EBT00001746802.
DR   EnsemblGenomes-Tr; EBT00001746804.
DR   EnsemblGenomes-Tr; EBT00001746806.
DR   EnsemblGenomes-Tr; EBT00001746809.
DR   EnsemblGenomes-Tr; EBT00001746811.
DR   EnsemblGenomes-Tr; EBT00001746813.
DR   EnsemblGenomes-Tr; EBT00001746816.
DR   EnsemblGenomes-Tr; EBT00001746818.
DR   EnsemblGenomes-Tr; EBT00001746820.
DR   EnsemblGenomes-Tr; EBT00001746822.
DR   EnsemblGenomes-Tr; EBT00001746824.
DR   EnsemblGenomes-Tr; EBT00001746826.
DR   EnsemblGenomes-Tr; EBT00001746828.
DR   EnsemblGenomes-Tr; EBT00001746830.
DR   EnsemblGenomes-Tr; EBT00001746832.
DR   EnsemblGenomes-Tr; EBT00001746835.
DR   EnsemblGenomes-Tr; EBT00001746837.
DR   EnsemblGenomes-Tr; EBT00001746839.
DR   EnsemblGenomes-Tr; EBT00001746842.
DR   EnsemblGenomes-Tr; EBT00001746843.
DR   EnsemblGenomes-Tr; EBT00001746845.
DR   EnsemblGenomes-Tr; EBT00001746847.
DR   EnsemblGenomes-Tr; EBT00001746849.
DR   EnsemblGenomes-Tr; EBT00001746851.
DR   EnsemblGenomes-Tr; EBT00001746853.
DR   EnsemblGenomes-Tr; EBT00001746854.
DR   EnsemblGenomes-Tr; EBT00001746856.
DR   EnsemblGenomes-Tr; EBT00001746857.
DR   EnsemblGenomes-Tr; EBT00001746858.
DR   EnsemblGenomes-Tr; EBT00001746859.
DR   EnsemblGenomes-Tr; EBT00001746860.
DR   EnsemblGenomes-Tr; EBT00001746861.
DR   EnsemblGenomes-Tr; Sala_R0001-1.
DR   EnsemblGenomes-Tr; Sala_R0002-1.
DR   EnsemblGenomes-Tr; Sala_R0003-1.
DR   EnsemblGenomes-Tr; Sala_R0004-1.
DR   EnsemblGenomes-Tr; Sala_R0005-1.
DR   EnsemblGenomes-Tr; Sala_R0006-1.
DR   EnsemblGenomes-Tr; Sala_R0007-1.
DR   EnsemblGenomes-Tr; Sala_R0008-1.
DR   EnsemblGenomes-Tr; Sala_R0009-1.
DR   EnsemblGenomes-Tr; Sala_R0010-1.
DR   EnsemblGenomes-Tr; Sala_R0011-1.
DR   EnsemblGenomes-Tr; Sala_R0012-1.
DR   EnsemblGenomes-Tr; Sala_R0013-1.
DR   EnsemblGenomes-Tr; Sala_R0014-1.
DR   EnsemblGenomes-Tr; Sala_R0015-1.
DR   EnsemblGenomes-Tr; Sala_R0016-1.
DR   EnsemblGenomes-Tr; Sala_R0017-1.
DR   EnsemblGenomes-Tr; Sala_R0018-1.
DR   EnsemblGenomes-Tr; Sala_R0019-1.
DR   EnsemblGenomes-Tr; Sala_R0020-1.
DR   EnsemblGenomes-Tr; Sala_R0021-1.
DR   EnsemblGenomes-Tr; Sala_R0022-1.
DR   EnsemblGenomes-Tr; Sala_R0024-1.
DR   EnsemblGenomes-Tr; Sala_R0025-1.
DR   EnsemblGenomes-Tr; Sala_R0026-1.
DR   EnsemblGenomes-Tr; Sala_R0027-1.
DR   EnsemblGenomes-Tr; Sala_R0028-1.
DR   EnsemblGenomes-Tr; Sala_R0029-1.
DR   EnsemblGenomes-Tr; Sala_R0030-1.
DR   EnsemblGenomes-Tr; Sala_R0031-1.
DR   EnsemblGenomes-Tr; Sala_R0034-1.
DR   EnsemblGenomes-Tr; Sala_R0035-1.
DR   EnsemblGenomes-Tr; Sala_R0036-1.
DR   EnsemblGenomes-Tr; Sala_R0037-1.
DR   EnsemblGenomes-Tr; Sala_R0038-1.
DR   EnsemblGenomes-Tr; Sala_R0039-1.
DR   EnsemblGenomes-Tr; Sala_R0040-1.
DR   EnsemblGenomes-Tr; Sala_R0042-1.
DR   EnsemblGenomes-Tr; Sala_R0043-1.
DR   EnsemblGenomes-Tr; Sala_R0044-1.
DR   EnsemblGenomes-Tr; Sala_R0045-1.
DR   EnsemblGenomes-Tr; Sala_R0046-1.
DR   EnsemblGenomes-Tr; Sala_R0047-1.
DR   EnsemblGenomes-Tr; Sala_R0048-1.
DR   EnsemblGenomes-Tr; Sala_R0049-1.
DR   EnsemblGenomes-Tr; Sala_R0050-1.
DR   EnsemblGenomes-Tr; Sala_R0051-1.
DR   EnsemblGenomes-Tr; Sala_R0052-1.
DR   EuropePMC; PMC2668395; 19201802.
DR   EuropePMC; PMC2739866; 19805210.
DR   EuropePMC; PMC3318814; 22327600.
DR   EuropePMC; PMC3792999; 24116085.
DR   EuropePMC; PMC4247871; 25420622.
DR   EuropePMC; PMC5989583; 29620507.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000356.
DR   SILVA-SSU; CP000356.
DR   StrainInfo; 66673; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634495
CC   Source DNA and bacteria available from Rick Cavicchioli
CC   (rcavicchioli@unsw.edu.au)
CC   Contacts: Rick Cavicchioli (rcavicchioli@unsw.edu.au)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Notes:
CC   Sphingopyxis alaskensis RB2256 appears to have about a 28.5kb
CC   extrachromosomal piece of DNA with significantly lower coverage
CC   than the chromosome.  It appears to be of F plasmid origin because
CC   of the presence of traA gene, a conjugal transfer protein.  It can
CC   be integrated into the genome between 856688 and 859197, excising a
CC   piece of chromosomal DNA 2517 bp long. Perhaps a fraction of the
CC   population has this 28.5 kb fragment integrated.  Within 2 kb of
CC   the excision point is an IS21 element with ORF1 and ORF2 of
CC   transposase and perfect inverted repeats.  However, we have been
CC   unsuccessful in circularizing the 28.5 kb fragment with pcr,
CC   perhaps because of the low representation in the genome.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3345170
FT                   /organism="Sphingopyxis alaskensis RB2256"
FT                   /strain="RB2256"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:317655"
FT   gene            173..1534
FT                   /locus_tag="Sala_0001"
FT   CDS_pept        173..1534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51727"
FT                   /db_xref="GOA:Q1GN68"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GN68"
FT                   /protein_id="ABF51727.1"
FT                   /translation="MSGDAAALWPRVAEGLRRDLGARTFDHWLKPVRFADYCALSGVVT
FT                   LETASRFSANWINERFGDRLELAWRQQLPAVRSVSVRGGVAATERAATLASVPLPTFDA
FT                   PAAPAANPALLGFDPRLSFDRFVVARSNILAANAARRMAMVERPQFNPLYLCSGTGQGK
FT                   THLLQAIAQDYAAAHPTATIILMSAEKFMLEFVGAMRGGDMMAFKARLRAADLLLLDDL
FT                   QFVIGKNSTQEELLHTIDDLMTAGKRLVVTADRPPAMLDGVEARLLSRLSGGLVADIEA
FT                   PEDDLRERIIRQRLAAMPMVEVPDDVIAWLVKHFTRNIRELEGALNKLLAYAALTGARI
FT                   DLMLAEDRLAENVRSARPRITIDEIQRAVCAHYRLDRSDMSSKRRVRAVARPRQVAMYL
FT                   AKELTPRSYPEIGRRFGGRDHSTVIHAVRTVEALRVADSELDAEIAAIRRSLNS"
FT   gene            complement(1682..2353)
FT                   /locus_tag="Sala_0002"
FT   CDS_pept        complement(1682..2353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0002"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51728"
FT                   /db_xref="GOA:Q1GN67"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034339"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN67"
FT                   /protein_id="ABF51728.1"
FT                   /translation="MKLFIGNKAYSSWSLRGWLAARHSGLPFEEVTVPLYNEEWNQRRE
FT                   GDEFAPSGGKVPILWDGADIVVWDSLAIIDYLNEKTGGTRGYWPDDMAARAMARSMAAE
FT                   MHSSFAALRREHSMNIRRIYPAAELTPEVQADVIRILQIWAEARARFGGEGDYLFGDWS
FT                   AADMMFAPVVTRFITYSIPLPRFALPYAQAVISHPHMQEWIGGAQAEDWVIEKFEGPVE
FT                   G"
FT   gene            complement(2549..3208)
FT                   /locus_tag="Sala_0003"
FT   CDS_pept        complement(2549..3208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0003"
FT                   /product="GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51729"
FT                   /db_xref="GOA:Q1GN74"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GN74"
FT                   /protein_id="ABF51729.1"
FT                   /translation="MSEIELEPGADPERAERARKLFSGPIAFLKSAPALQHLPVPSVPE
FT                   IAFAGRSNVGKSSLLNALTNRNGLARTSVTPGRTQELNYFDVGEPPVFRLVDMPGYGFA
FT                   KAPKDVVRKWRFLINDYLRGRQVLKRTLVLIDSRHGIKDVDRDVLEMLDTAAVSYRLVL
FT                   TKADKIKASALADVHAATEAEARKHPAAHPEVIATSSEKGMGIAELRTAVLEAVEL"
FT   gene            complement(3205..4959)
FT                   /locus_tag="Sala_0004"
FT   CDS_pept        complement(3205..4959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0004"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51730"
FT                   /db_xref="GOA:Q1GN73"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN73"
FT                   /protein_id="ABF51730.1"
FT                   /translation="MDDKRNLIAAILLSVAILIGWNFVAERFFPTPDQPDVTKTVAGAN
FT                   GAPATAPTAQGQPSALPAPTAATPAAAQAIRPVDVVLAEGQRIPIETPAIRGSINLVGA
FT                   RIDDITLTKYRQTIKKDSPAVRLFAPGGTPAAYFASLGWTAQGIQLPGAGTVWTANGTK
FT                   LTPTTPVTLSWTNTTGQTFRIEYSIDANYLITAKQTVVNAGTAPVSLSSFALIDRLGKP
FT                   TDPHEVDSWTIHVGPTGYLDGKSVFDIDYDDLEEAPNRSVRYTSAGWLGFTDKYWLAAI
FT                   VPAKGERVTAAISSPATNNYQTLFARDFTQVAPGQQLTATSRIFAGAKEVEILETYQDD
FT                   QGITRLSNAIDWGWFEFFEVPIFKLLHWLFEKVGNFGLAIMALTLIIRLLMFPIANRQF
FT                   SSMAQMRVVQPKMKALQERYKDDKPRMQQELMKLYKDEKINPLAGCLPIVIQIPIFYAL
FT                   YKVLMLAIEMRHQPFILWIKDLSAPDPLHILNLFGLLPFTPPSILAIGLLAVILGVTMW
FT                   LQFRLNPAPADPVQAQVFKIMPWLFMFIMAPFAAGLLLYWITNNILSIGQQQWMYRKFP
FT                   ALKAAPAK"
FT   gene            complement(5006..5218)
FT                   /locus_tag="Sala_0005"
FT   CDS_pept        complement(5006..5218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0005"
FT                   /product="protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51731"
FT                   /db_xref="GOA:Q1GN72"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GN72"
FT                   /protein_id="ABF51731.1"
FT                   /translation="MIARLLILIARAWQLGPSRVLPPTCRYAPSCSEYAIVALRRHGAI
FT                   KGGWIATKRLLRCHPWGGHGYDPVP"
FT   gene            complement(5439..6161)
FT                   /locus_tag="Sala_0006"
FT   CDS_pept        complement(5439..6161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0006"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51732"
FT                   /db_xref="GOA:Q1GN71"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN71"
FT                   /protein_id="ABF51732.1"
FT                   /translation="MSASSGGTPAMAHGPTGLCAASAPRGGVRAARRKRQMAIDFGPTL
FT                   AYPRPQRWPPTLGGPFLLQHLTRSRENRDEAHLSTEPPRAQAPSRLPRPQGHRRRSQGS
FT                   GRPPRPRPQEAVGLTADASPPARLVRTLNKRSEFLAANRGLRFPMPGFVLLVRPRGDDS
FT                   DALGIGYTVSKKVGNAVTRNRMKRRFRELARALLPESGIAGADHVLIGRPGANDIAFAE
FT                   LGEQLDSALKRAAKKLAR"
FT   gene            6361..6693
FT                   /locus_tag="Sala_0007"
FT   CDS_pept        6361..6693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0007"
FT                   /product="Entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN70"
FT                   /protein_id="ABF51733.1"
FT                   /translation="MGETAACYKTKAVAVPPRRTIILPGRAVFSNASAGAAPIDGTIGS
FT                   GRCCPSCRPFAGASHCCRRERMKRILTIFAISGSILFLSACNTVEGAGKDIESVGDCAD
FT                   GVKGNC"
FT   gene            complement(6735..7511)
FT                   /locus_tag="Sala_0008"
FT   CDS_pept        complement(6735..7511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0008"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51734"
FT                   /db_xref="GOA:Q1GN69"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN69"
FT                   /protein_id="ABF51734.1"
FT                   /translation="MASPSALLRTLIVAALAAVLAFAPAQAQRVTVVTTTVTWTHADAG
FT                   DDDLGYIEEDAALLDDEALAEEEAFAATRRYAPTATLATPGQAKASFGPFSVIDAATAR
FT                   MAGDVTSATPRQFAAMLAAFPGLKRIEMIDCPGSLDEDANLALARAIRRAGLETVVPAG
FT                   GSIRSGAVELWLAGATRRAAPDAEFGVHSWADEYGREANDYPANDPVHADYIALYREMG
FT                   MDAAKAREFYALTNATPFDEVRYLTRDDMARFVALN"
FT   sig_peptide     complement(7428..7511)
FT                   /locus_tag="Sala_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(7591..8253)
FT                   /locus_tag="Sala_0009"
FT   CDS_pept        complement(7591..8253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0009"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51735"
FT                   /db_xref="GOA:Q1GN80"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN80"
FT                   /protein_id="ABF51735.1"
FT                   /translation="MTLIFYGHPFSSYTWKALIALYEKGIDFDYRALETEAPFTHYDEL
FT                   RAHWPVGQFPLIVHDGQALFESSIIIEYLDQIVPEPCMVAADPKVALDVRFLDRIFDNH
FT                   FQARFQAVVAEYLPFITATPDLARVERARDLLEKAYGWLETRLPNDGWATPHGFSLADC
FT                   AAAPALFYADWVHPIDPRHVRVRAYRARLNARPSVARCIEEARPYRAFFPLGAPDRD"
FT   gene            complement(8250..8702)
FT                   /locus_tag="Sala_0010"
FT   CDS_pept        complement(8250..8702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51736"
FT                   /db_xref="GOA:Q1GN79"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN79"
FT                   /protein_id="ABF51736.1"
FT                   /translation="MARRSPALFAWALCGTLDIVYAAVSSVLQGGTVPGMLRGVASGPF
FT                   GDAARDWGAVGAAAGLATHFAIMGAMVAAWFFVARRWNALTLWPWWLTGTLYGLLLYLV
FT                   MNAVVLPLRFGSPFPPADPAQGLIALLPHIMFVGWPLAWMKRKERR"
FT   sig_peptide     complement(8634..8702)
FT                   /locus_tag="Sala_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.636) with cleavage site probability 0.477 at
FT                   residue 23"
FT   gene            complement(8689..9192)
FT                   /locus_tag="Sala_0011"
FT   CDS_pept        complement(8689..9192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0011"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51737"
FT                   /db_xref="GOA:Q1GN78"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN78"
FT                   /protein_id="ABF51737.1"
FT                   /translation="MMSKPPLTLCLWYEGDAEEAASFYAETFADSHVGAVHRAPGDTPG
FT                   GKEGDVLTVEFTLLGTPCLGLNGPPIFKHSEAFSFIVHTDTQEETDRLWDAIVGNGGQE
FT                   SMCGWCKDKWGVSWQITPRVLIEATTSSDKAAAKRAFEAMMTMKKIDIAAIEAAVRGEA
FT                   VGAA"
FT   gene            complement(9228..10031)
FT                   /locus_tag="Sala_0012"
FT   CDS_pept        complement(9228..10031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0012"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51738"
FT                   /db_xref="GOA:Q1GN77"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN77"
FT                   /protein_id="ABF51738.1"
FT                   /translation="MTNPPGSFIWYELMTSDPDGAARFYGAVVGWTIAAHSDPGAPGGV
FT                   DYRMIVRTNGGNAGGVLALNADMIAGGARPGWLGYLYTPDVDAAVAAITADGGTVHMPA
FT                   HDLPVGRIAMVADPQGAPFYIMNPIPPEGEPDKVADAFSVTEAQHIRWNELATSEPDTA
FT                   ITFYQRHFGWGQEGAMDMGELGQYRFLQHGGDMIGAVMPLMEGIPAPTWTFYIGVDDID
FT                   RARGAVAANGGTITNEPMEIPGGEYAMNAIDPQGAAIGFVGPRKG"
FT   gene            complement(10071..10370)
FT                   /locus_tag="Sala_0013"
FT   CDS_pept        complement(10071..10370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN76"
FT                   /protein_id="ABF51739.1"
FT                   /translation="MGRTNDRVDMLNVNSPNHVVRVERVKYEAMRDAMLTVVPTEAPGL
FT                   TAAEIKERLLPLLPEVLFPGGAKAGWWQKGVQLDLEARGQMARSDTRPLRFYRP"
FT   gene            complement(10373..11044)
FT                   /locus_tag="Sala_0014"
FT   CDS_pept        complement(10373..11044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0014"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51740"
FT                   /db_xref="GOA:Q1GN75"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GN75"
FT                   /protein_id="ABF51740.1"
FT                   /translation="MMIKLYGTPPTRALRAIWLLNELDLPHEIIPIDLGAGEQLTPDFM
FT                   ALNPAAKLPVLVDGAMVVSESAAIQLYLADKYGERFPGGGLIPATAEDRGRMYHWLFFL
FT                   MTEIEAPLWRIALHNFIYDPEEKSEAEIALAKRDAARMVAVLEQHMQGRDVLVGDALTV
FT                   ADFNAAFTLDWAREEALLDDAPALRAFLDRMYARPRAPVTIAAAFAALEAVAADADGAR
FT                   A"
FT   gene            complement(11093..11815)
FT                   /locus_tag="Sala_0015"
FT   CDS_pept        complement(11093..11815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0015"
FT                   /product="protein of unknown function DUF1428"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51741"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX81"
FT                   /protein_id="ABF51741.1"
FT                   /translation="MTYVEGFVVAVPTANKDAYRRHAADAAPLFREFGVTRMVEAWGDD
FT                   VPDGKVNDFKGAVQAKADETVVFSWFEYPDKQVRDAANERIMSDPRMQQMGSDMPFDGK
FT                   RMIVGGFETILDDRGTGATGYVDGFVAPVPDANKDRYRAMAKMASEIFIEHGATRVVEN
FT                   WGDDVPDGKITDYARAAHKKDGETVVFSWVEWPSREARDSGWERVMADERMNPGPEEER
FT                   PFDARRMIYGGFVPIVEA"
FT   gene            complement(11849..12523)
FT                   /locus_tag="Sala_0016"
FT   CDS_pept        complement(11849..12523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0016"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51742"
FT                   /db_xref="GOA:Q1GX80"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX80"
FT                   /protein_id="ABF51742.1"
FT                   /translation="MMPINPDAAIVLTAFDWVPDFARGFVRDLRPRWACEEIGLDYAEH
FT                   LISAVNRPADHFLFQPWGQVPVLNDGGIRLFESGAILLHLAEKDERLMPRDAQGRANTL
FT                   AWLFAAYNSVEPMLFELGNVDIFSKDEEWAKLRRPGLIDFIRGRLGRLNDAMGDKPYLT
FT                   GDFTVADIAMATVLREAVEAGLIAEQPRLQAYLDRCLARPAFRRALDAQLAAFREEAGP
FT                   PA"
FT   gene            complement(12546..13529)
FT                   /locus_tag="Sala_0017"
FT   CDS_pept        complement(12546..13529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0017"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51743"
FT                   /db_xref="GOA:Q1GX79"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX79"
FT                   /protein_id="ABF51743.1"
FT                   /translation="MTGFSPPRIFRRRHSGVAAALALLASAAVVAALPQPAYAQQPATT
FT                   TASASAARTGHATVNGVRIAYAVHGDPTSKQTPLLVLHGAFMSGEAMAPFVTPFVASRP
FT                   VITIDARGHGRTGKVGGAFSYDQMADDAAAVLASLRVERADVLGYSMGGSTAIAMAVRH
FT                   PERVGKQVIISGAARLDGWVPEVLEGIAKMTPEMFAGTPMETEYKRLSPTPDAFPDLVA
FT                   AIKHIDSTPFAYSDAQLRAIPGKTMIILGDADGITFEHAIKLFKLRGGADIATATQGFM
FT                   TQPPKARLSILPATSHIGVMAEAPTIAEQAIAFLDDAMPPMPEGFF"
FT   sig_peptide     complement(13410..13529)
FT                   /locus_tag="Sala_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.882 at
FT                   residue 40"
FT   gene            complement(13559..13777)
FT                   /locus_tag="Sala_0018"
FT   CDS_pept        complement(13559..13777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51744"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX78"
FT                   /protein_id="ABF51744.1"
FT                   /translation="MSFQAYLDNVRTKTGQSADDLRAQATQKGLADDAGLAPGVKAGAV
FT                   IDWLKADYGLGHGHAMSVVAFIKGKRS"
FT   gene            complement(13851..14285)
FT                   /locus_tag="Sala_0019"
FT   CDS_pept        complement(13851..14285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0019"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51745"
FT                   /db_xref="GOA:Q1GX77"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX77"
FT                   /protein_id="ABF51745.1"
FT                   /translation="MPRMIFVNLPVTDLDRSKAFYEAVGAVNNPAFTDETAACMVVEEG
FT                   SIHVMLLSHEKWASFTSKMIPDARTTAQVLLCVSADSREAVDGQVDKAVKAGGKADPTP
FT                   TQDFGFMYGRSFEDPDGHIWEVMWMDPAAIPAGEPAEAAA"
FT   gene            complement(14357..15097)
FT                   /locus_tag="Sala_0020"
FT   CDS_pept        complement(14357..15097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0020"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51746"
FT                   /db_xref="GOA:Q1GX76"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX76"
FT                   /protein_id="ABF51746.1"
FT                   /translation="MGSLGCLTTYQPVGMSIRMTTNQTPPSPDAVARSAPRAGGGTSAG
FT                   RAPRGSARAALIAAAHQLVRRQGYAATTVDQICAAAGVTKGAFFHHFASKEALAVAAAE
FT                   GWTDRARPLFELPPHTRLDDPLDRLLGHIDFRLSMLSGPTEEYTCFVGTMVQEAYATSD
FT                   AIREACEASLNAYCEALVPDIEAAFDRHGRPEGVSAIGLARHVQAVLQGSFILAKSANA
FT                   PAIARESVTHLKRYVAMLFERSAA"
FT   gene            15206..16714
FT                   /locus_tag="Sala_0021"
FT   CDS_pept        15206..16714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0021"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51747"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX75"
FT                   /protein_id="ABF51747.1"
FT                   /translation="MVAIVSTAAYLGIEARGVEVQCQITPGVPRFVLVGLPDKAVGESR
FT                   ERVRAAIAAIGLSLPPKVITVNLSPADLPKEGSHYDLPIALALLGAMGVIDAETLASYV
FT                   VVGELGLDGRVAASPGVLLAALHAGSVERGLICPAAQGPEAAWAGNVEVIGAPDLLSLL
FT                   NHFKGNALLPPPVPGEVAAPARGADLAQVKGQETAKRALEIAAAGGHNLLMSGPPGAGK
FT                   SLMAACMPGILPELTPAEALEVSMIASVAGQLDGGRLVRARPFRSPHHSASMPALVGGG
FT                   LRVRPGEVSLAHLGVLFLDELPEFQRGVLDSLRQPLETGEVSVARANAHVTFPARVQLV
FT                   AAMNPCRCGHLGDPALACSRAPRCAADYQAKLSGPLLDRIDLHVEVQAVSAADLTLPPP
FT                   AEGSAEVAARVAAARDVQTRRYAELRARTNAEIDGELLEAVAMPDEAGRKLLAQAAEAM
FT                   RLSARGYTRILRVARTIADLAGSETVGRIHIAEALSYRRQAPRN"
FT   gene            16724..17023
FT                   /locus_tag="Sala_0022"
FT   CDS_pept        16724..17023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51748"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX74"
FT                   /protein_id="ABF51748.1"
FT                   /translation="MEAIDFESAIIEWRGPAPFLFAAIPDEHVGALRHAAMTASYGWGV
FT                   VPVARVGATQFTTSLFPRDGGYLLAIKLAVQRAEGVGPGDRVAVSLRVGRDGKC"
FT   gene            17078..18832
FT                   /locus_tag="Sala_0023"
FT   CDS_pept        17078..18832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0023"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51749"
FT                   /db_xref="GOA:Q1GX73"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX73"
FT                   /protein_id="ABF51749.1"
FT                   /translation="MTGGCSPLATRCGRLWGLLGLMLLTMPATPAQARALDVERDLCHA
FT                   VSGTALGDDALPRLRFACRGTPDDYQKQSLWLRTTLDERPVQGGLALMLHNSRFDRLAV
FT                   GFSYADGTTRWQRVRSGDFGSHWRAGGQILFDAPPRAVPVTAVTMRFDGLAAHQLVRAR
FT                   ILPADEAGVQASGMAAAIGAALTLLLVSGIYSLSLAVAVRRQYLAWQAGWSATMLLWGT
FT                   LWSQAHLALLPTMAGTATAQICTFLACLAIAVATASAVTAVERGRGVRGLRIVALLLGV
FT                   GVGLAGIPLALIRRGDLSLLADLLGFAILADLIVVAIYLALAWRRGSVEARDFLAAWGL
FT                   PMAVLAFIHIVDVNKDFWGGGSQFVMLVAATWQALWLAAAATRRLAQLRIERDHARDAE
FT                   ARAQTLARRDPLTGLANRRGFIDSVTPLLDRARVGNLPAALLLVDIDRFKSINDIHGHE
FT                   AGDAVLCTIGQRIERWEGPMCTVARLGGEEFGLLTIGMEGIVLSRFAESIRRGLADCDH
FT                   SVIVGDRPVTASIGVAEVRPACDFKQLYRVADEALYDAKRGGRNRVIVQRYRDGPPRAP
FT                   SREIVLLK"
FT   sig_peptide     17078..17179
FT                   /locus_tag="Sala_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.905 at
FT                   residue 34"
FT   gene            complement(18852..19247)
FT                   /locus_tag="Sala_0024"
FT   CDS_pept        complement(18852..19247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0024"
FT                   /product="protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51750"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX72"
FT                   /protein_id="ABF51750.1"
FT                   /translation="MATGARHTTFSILGSDVVVTGNVAASVDLHVDGKIEGDLKCANLV
FT                   QGEASEIKGAVTAETAKIAGLLDGSIEAKTLIVHATARITGDVTYETITIENGGKVDGK
FT                   LSHRRHGAMAAKAPPPLEVVENKAASL"
FT   gene            complement(19249..20457)
FT                   /locus_tag="Sala_0025"
FT   CDS_pept        complement(19249..20457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0025"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51751"
FT                   /db_xref="GOA:Q1GX71"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX71"
FT                   /protein_id="ABF51751.1"
FT                   /translation="MSSKPTGLRDVRQRFNALFQDHEIFVRTHGHVRFLRVSALWQKRV
FT                   ALIAGLVLLAWAGATLAVLVNQLLTADERAAVAAQKAAAAASEARIAKYRDRVAETAAD
FT                   LEERQALLESVAESHFGIDPADMATAAQKTHTSDAAPAEPVKTSAIDPNLPPEAQVLAR
FT                   LAARQEAFAARLLGAVKDRVAKAETAVAALGLNPDTLVRNAAAGRGGPFIPFRGRGGQA
FT                   KALGASFAALDGALFRMEVLERTLVAVPSGNPANVLMMSSGFGYRRDPFTGAGAMHAGV
FT                   DFRGPIGTPILAAAPGRVSFVGVKSGYGNVVEVDHGQGIMTRYAHLSGFTTRAGVKVAA
FT                   GQQIAKMGSTGRSTGSHLHFEVRLNGVAVNPRRFLEAKADVLEVKNDARQRVVSVAAAR
FT                   GDR"
FT   gene            20688..22094
FT                   /locus_tag="Sala_0026"
FT   CDS_pept        20688..22094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0026"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51752"
FT                   /db_xref="GOA:Q1GX70"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX70"
FT                   /protein_id="ABF51752.1"
FT                   /translation="MHIMAESAPIRAAEAASDPVVPAPARPRSAVSAGVGLVGLAGLLT
FT                   YLLLARFAPEVAAFLGIDWGDRGPMSGPNSAVASVLACGVPMVLWSVFVDKVHRNPSTG
FT                   IDWALRRPWRDTLDISLTKLAGLWATWGLIALIYGTMRYYWEGNYAFSMNLLERVAPWL
FT                   LLVSVPYMLWLDRRMIEPRDGCYQFGRWLIAPGKPVDGRAIGHHLRAWAVKGFFTAFML
FT                   SIVPGNFSALVTVPMAEVLANPYLTGIWAINLLYLVDVHIATVGYILTLKPLDAHIRTA
FT                   NPYGMAWVAALVCYPPFILMSGGPLDYQVHGADWGHWLAGHDGLLVLWGAVLVLLTAVY
FT                   SWATMAFGIRFSNLTHRGIITHGPYAFTRHPAYVAKNLTWWIGALPFLVTAGGWVEAAR
FT                   NVVLLGLVSGIYYWRAKTEEKHLLGDPAYVAYWNWAQAQAPVPRLIAKLTGRARPLVRL
FT                   EPDARVGPVA"
FT   gene            complement(22212..24476)
FT                   /locus_tag="Sala_0027"
FT   CDS_pept        complement(22212..24476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0027"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51753"
FT                   /db_xref="GOA:Q1GX69"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX69"
FT                   /protein_id="ABF51753.1"
FT                   /translation="MRHLPSALAMSVALAAAAVAPAAAQEASVVAAEEGSGLGDIVVTA
FT                   QRREESLQDVPVSVSVLSGDTLGAITSTGADIRALAGRVPSLNIESSYGRSFPRFYIRG
FT                   LGNTDFDLNASQPVSLVYDEVVLENPILKGFPIFDLDRVEVLRGPQGTLFGRNTPAGIV
FT                   KFDTVKPGKTGGYARASYGRYGTSQVEVAAGAADDNGFSVRLSGLYQHRDDWVDNIATT
FT                   AKDDLGGYDDIAARLQLQYENGPFTGRVTGQVRVFDGSAIIFRANTQLPGSNRLVGLGG
FT                   ADTAFERDKVWQDGINFQKLNTYNAALNLEYDFGAVTAYSITSYWNGNFKSRGDIDGGF
FT                   GAVFLPVSGPGLIPFAAQSQDNVPSLDQFTQEIRIASNNSGGLGYQFGAFYFDEGLDIT
FT                   SFDFGGPTDAAPAAIAVQRQDSEAYGIFGSVNYAFEGGLTLQAGARYNHDTRDFVAARP
FT                   VETRPIFVVNPNTPVPPQSARVKGKLLTWDASATWEASDAVTFYARVARGYRAPSVQGR
FT                   LTFSRVISTADQEETMSYEAGIKTAFLDDRVRFNLTGYYFDTKDLQLTAVGGTANVASL
FT                   LNVDAKGHGIEAELQAAPARGLTFSVGGAWNVAEIDDANAFVAGCGSATPCTVLDPQRP
FT                   GSPGIFSIDGNQLPQSPKWTLNATAGYEIPVGDGAIYAFTDWYYRSKVQFFLYQSVEFS
FT                   DDKMIEGGLRVGYRTDRFDVAAFVRNITNDESPTGGIDFNNLTSYVNEPRIWGVEAGVK
FT                   F"
FT   sig_peptide     complement(24402..24476)
FT                   /locus_tag="Sala_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 25"
FT   gene            complement(24779..25867)
FT                   /locus_tag="Sala_0028"
FT   CDS_pept        complement(24779..25867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0028"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51754"
FT                   /db_xref="GOA:Q1GX68"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX68"
FT                   /protein_id="ABF51754.1"
FT                   /translation="MMKLLDTLHRWTGGLIGLVLALLGLSGTILLYEHLWIGVPGAGDP
FT                   LRGDLATVAAATEKLMAAQGTQGIIYADERFGLHQLRLAEGAGAYASQSGEIVTRWASQ
FT                   WERPELWLFDFHHHLFVGDNGEWVIGVAGLAGLFFVISGVILWWRTRRTFQLRLWPKRM
FT                   SRPSVLMHHRDLGIVAAPLLLISIVTGTMMIFRPFALGVVAPFGSPAETAKALDLPKYM
FT                   GGPLAEKPDYTAMLTKAHRRFPDAEFRILSLPRKDGDPISLRMKQPAEWLPNGRTTLWF
FT                   DAATGDVLGARDALAMPPGAQAFNMAFPLHASRVGGWAWRSLLTVSGLSLTLLGSLAVW
FT                   TFWFRRPKTAKRAAKKTALASA"
FT   gene            complement(25868..28018)
FT                   /locus_tag="Sala_0029"
FT   CDS_pept        complement(25868..28018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0029"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51755"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX67"
FT                   /protein_id="ABF51755.1"
FT                   /translation="MNRKWLAAALLSGALPFPALAQDAPPVDEALAGDAGETIIVTAAR
FT                   TILPPNALPLTIDIIEKDALDQQIAIAGSVTDAVATLSPSFSPTRQKLSGAGETLRGRS
FT                   PLYAINGIPQSTPLRDGSRDGFTIDGFFVDRVELIFGSNALQGIGGTGGIVNQVTVGAP
FT                   TDEGVSGRALLQASADNDFSDEGMGGKVAGLVQYKAGRFDASVGAAWERRGVFFDGEGR
FT                   RVGINLTQGETQDSETLSLFGRFGYAVTDTMRLDLIASRFELEGDGDYAAVAGNKAAGL
FT                   PTSARPGTPPGVPATNRTESVSLSLTDSNLGGGNFISQIFWNRSRDTFGGEPNPIATFQ
FT                   DAAIAPIGTLFDQSQNRSRKYGGKLSYERAVPGLEALTLIAGFDALWDSTEQRLIATDR
FT                   VWVPPTDFRSLAPFGQANLQLAGGLVRLAGGVRYENVKISIDDYTTLASAGRTFVSGGS
FT                   PTFDDVLLNGGVIVEPMPGIRAYASYAEGYTVPDVGRITRAVRTPGVDIDSFLDISPIV
FT                   SNNRELGVEVKRGPLDASATYFWSSSKKGQLLIARPDGIFDVQRQRVEIEGLEINLAVK
FT                   MPIDGLTLSAGYAHIVGQFDDDADGLVETDLDGANISPDRLNLAAAYANGPLSARVQTQ
FT                   FYLARTFRGPNRDARNDFEGYNLTDAIVRYQTSLGGVSLAVSNLFDRQYISYASDTQRP
FT                   TDNFFNFAGRGRTFTLGWDYRF"
FT   sig_peptide     complement(27953..28018)
FT                   /locus_tag="Sala_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            28222..30534
FT                   /locus_tag="Sala_0030"
FT   CDS_pept        28222..30534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0030"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51756"
FT                   /db_xref="GOA:Q1GX66"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR019894"
FT                   /db_xref="InterPro:IPR024282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX66"
FT                   /protein_id="ABF51756.1"
FT                   /translation="MREKELRFALICYGGISLAVYMHGVTKEVWRLAAASRAFHDGGAI
FT                   GGTGAVYRDLLGAIAAHGNVRLRVFTDIVAGASAGGINGIFLARALATGESLDPLTDLW
FT                   LDSADVDNLLDPDARPLSRMTKFWAVPIAGWAMKRRGNSIDRTVGEAAQDEVRAKLSRF
FT                   VRARWFEPPFGGETFSHLLFDAFAAMDAAPRGPVLVPDGQPVDLFVSVTDFAGHSVPLA
FT                   LNSPPRVTENEHRLILHFREDGRTGKRLDDVPGLAAAARATASFPGAFPPFTLREIDRV
FT                   LEKRGLDWPGRDAFVRAQLPRGEAGDAADRVLIDGSVLANAPFRPAIAALKQRPARREI
FT                   DRRFVYIDPKPDFRSISFGRPGDAADSDDPRLPGFVPTILGALSEIPREQPIRDNVEVI
FT                   EGMSRRIRRMQHIVDAMKVEVEEQVAALFGTTFFLDTPTLARLRKWRAKAQEQAAARAG
FT                   FAFAPYGHLKLSAVVEELARLIDRLLPAEGAIHRANRRLALWDEVRARGLDRISGKKGA
FT                   GASGDAIAFFRTHDLGFRIRRLRFLGRELDTAVEAKRDARDPACDAMRDAIFAALGLYL
FT                   DRQGDAWLADLDLPADAGPGDWIDAIAARRDLAIVDSEADALIAAGLAAMPKDDRRVLL
FT                   LAYLGYPFYDIATLPLLQGEGFDEYDPIKIDRISPSDATAIRSGGAAAMLKGIEFNSFG
FT                   AFFSRAYRENDYLWGRLHGADRLIDIVASSVTGEGALPAAELAAMKRRAFHAILDQEEK
FT                   RLPKVAALIAQLRQEIG"
FT   gene            complement(30847..31545)
FT                   /locus_tag="Sala_0031"
FT   CDS_pept        complement(30847..31545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0031"
FT                   /product="ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51757"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX65"
FT                   /protein_id="ABF51757.1"
FT                   /translation="MTDMSATNIVFLLFPGVTQLDFTAPAQALSRMPGAVVAGAASSLA
FT                   PIATDSGFAIVPTHDFASAPQADILCVPGGHGVAEALGDAATIHFIARQAARAAWVTSV
FT                   CTGAFLLGRAGLLAGKRATTHWAYTHLLPLVGAEHQPGRVVEDGQIVTSGGVTSGLDFA
FT                   LTLIARLKGAAVAQAIQLAIEYDPAPPFAGGHPDRAPDAVTTGLKQRVYDAAAARMEAA
FT                   LRGEGVIVLD"
FT   gene            complement(31966..32262)
FT                   /locus_tag="Sala_0032"
FT   CDS_pept        complement(31966..32262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0032"
FT                   /product="Entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51758"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX64"
FT                   /protein_id="ABF51758.1"
FT                   /translation="MRKIIIASMAAAAFSLAACSEQTQDAAADTAASAGEDVEAAGEAM
FT                   AEGAADAAAATAEAADDAGNAVEGTVNAAGDAVEAAGDKVAEETAKAEANDKQ"
FT   sig_peptide     complement(32200..32262)
FT                   /locus_tag="Sala_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.867 at
FT                   residue 21"
FT   gene            complement(32447..32764)
FT                   /locus_tag="Sala_0033"
FT   CDS_pept        complement(32447..32764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0033"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51759"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX63"
FT                   /protein_id="ABF51759.1"
FT                   /translation="MKKSITLSLVLAASLGLAACAEKAADDAAATDDAAATVEGAADGA
FT                   MEAAEGAADAAAAAGDAADAAGDAAAAGDAATAADKAAEAADAAKEATDAAKGAMEEAK
FT                   K"
FT   sig_peptide     complement(32699..32764)
FT                   /locus_tag="Sala_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.512 at
FT                   residue 22"
FT   gene            32993..33979
FT                   /locus_tag="Sala_0034"
FT   CDS_pept        32993..33979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0034"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51760"
FT                   /db_xref="GOA:Q1GX62"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX62"
FT                   /protein_id="ABF51760.1"
FT                   /translation="MSELIDICRALADPTRLRVVALLREMELAIGELAVVLDQSQPRVS
FT                   RHVRILVEAGIVERRREGSWVFLRIVADGPIAAIIAQADKWPFSAREMRVIAHDARRLA
FT                   AVRAERAAAAARYFAEHAAEWDAIRSRHVAESEVEAAMLAMMHNRRLGHLLDIGTGTGR
FT                   MAEIFAPTARRITALDRSPEMLRIARAKLERQPVPVDLIQGDFLELPVGDASVDSIVIH
FT                   QALHFAHEPDRVIAEASRVLRGGGHLLIVDFAPHEDEELRTLAAHARLGFSDAQIRGWF
FT                   ASAGLLLETTQTLEGGKLAVKLWLGRRRSDQDQPPVSDGGPTKRLAA"
FT   gene            33976..34914
FT                   /locus_tag="Sala_0035"
FT   CDS_pept        33976..34914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0035"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51761"
FT                   /db_xref="GOA:Q1GX61"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX61"
FT                   /protein_id="ABF51761.1"
FT                   /translation="MTANLDALAEARRAAASPLFANLDGDVGVSFEFFPPKSEKMEAQL
FT                   WDTFRTLEPLAPSFVSVTYGAGGSTRERTHATVARIAAESRVPPAAHLTCVEASRAEID
FT                   EVARAYWDAGVRHIVALRGDVPGGGPYRAHPDGYANAVELVAGLKAIAPFDISVAAYPE
FT                   VHPDADCPQSDLDNLKRKLDAGANRAITQFFFSPDSFLRFRDTAAAAGIDAPIIPGILP
FT                   VSNVSQTRRMADMCGTAIPAWMVSLFDGLDDHPAARQLVAATVAAEMCRRLYAGGVRDF
FT                   HFYTLNRAELSYAICHLLGLRPVSTLKDRAA"
FT   gene            34911..35978
FT                   /locus_tag="Sala_0036"
FT   CDS_pept        34911..35978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0036"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51762"
FT                   /db_xref="GOA:Q1GX60"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX60"
FT                   /protein_id="ABF51762.1"
FT                   /translation="MTSSLASSARDALKEAAKQRILIKDGPFGTAFQHRNAYVGVDGAE
FT                   HGLSIDPRGNGDYLNLARPDIVADIMRDYLVAGADIIATNTFSANRISQADYGAEHLVA
FT                   GINLASARLARREADAMQQKDGRRRFVAGAVGPTNKTLSLSPDVNNPGFREIDFDELKD
FT                   VYLEQVVALAEGGADFILIETIFDTLNAKAGIAATLEAEAALGRELPLMISMTLTDLSG
FT                   RNLSGHTVEAFWYAVRHAKPMTIGLNCSFGAAQLRPHVKVLSDIADALVMVYPNAGLPN
FT                   ELGEYDELPETTAELVREWAEHGQVNILGGCCGSTPDHIAAMAKAVEGLAPRQVPEVPV
FT                   RTRLAGLEPFTMAAA"
FT   gene            36101..38722
FT                   /locus_tag="Sala_0037"
FT   CDS_pept        36101..38722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0037"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51763"
FT                   /db_xref="GOA:Q1GX59"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX59"
FT                   /protein_id="ABF51763.1"
FT                   /translation="MTETLSSSTFVNIGERTNVTGSAAFKRLILADDYAAAVEVARQQV
FT                   ENGAQIIDVNMDEGLLDAEHAMTTFLKLIAAEPDIARVPVMIDSSKWSVIEAGLKCVPG
FT                   KPIVNSISMKEGEEQFLDHAKKCMAYGAAVVVMAFDEVGQADTRERKVEICERAYKLLM
FT                   TIGFPPEDIIFDPNIFAVATGIEEHDNYAVDFIEAVKEIRVRCPHAHFSGGLSNLSFSF
FT                   RGNETVRRAMHSVFLYHAIPAGLDMAIVNAGQLDVYDTIDPELRTACEDVILNRKVEGE
FT                   ELSPTERLIALAERYKGTNAAQEKAAEEWRGWAVEKRLEHALVKGIDAHIVEDTEEMRR
FT                   AMDRPIEVIEGPLMDGMNVVGDLFGSGKMFLPQVVKSARVMKKAVAHLLPFIEASKEPG
FT                   AKGKGKIVMATVKGDVHDIGKNIVGVVLQCNGFEIIDLGVMVPWSKILEAANENDADMI
FT                   GLSGLITPSLDEMVTVAEEMQRAGMTIPLLIGGATTSKVHTALRIDPAYQGPVLHVLDA
FT                   SRAVGVATALVSDTGRDAYVKGYKNDYAHVRDVRAGKGQSVLLSIEEARANYYDAYLSD
FT                   KPAPPLQPGLHRFDDWSLADLRDYIDWTPFFRAWELHGTWPSILQDEVVGETARALKAD
FT                   ADAMLDQIIAEQWLTARGVCAFWPCARHGDDIVIHLAEEERHVTLPFLRQQIKKSRDRA
FT                   NMCLADFIDPAGDWIGGFAVGIHGIEPHSERFRADKDDYSDILLKALADRFAEAFAERL
FT                   HQHVRTTLWGYAPGEQLTNEALIKEEYRGIRPAPGYPACPDHSLKPILFDLLGAGENAG
FT                   LVLTESFAMLPTAAVSGFYFGHPESQYFGVARIGSDQLEDYARRRGVDLETATRWLRPN
FT                   LD"
FT   gene            38833..39786
FT                   /locus_tag="Sala_0038"
FT   CDS_pept        38833..39786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51764"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX58"
FT                   /protein_id="ABF51764.1"
FT                   /translation="MIRSLLRRPLLPLLALPLLLAPAPLPAQSGGAPYHVDGRGFTRLQ
FT                   DAVDAIGEGEGTIRIAAGYHRDCAVQTAGRIAFVASEPGRAIFDGVTCEGKAALVLRGQ
FT                   GARVDGLVFQNMRVPDGNGAGIRLETSDLDVVNAMFRNSEQGILTADDPEAALTIDRST
FT                   FSRLGRCDRGLSCAHSVYTGLYGRVTVTRARFEKGSGGHYLKTRAARVDVSDNSFDDTQ
FT                   GTGTNYMIDLPSGSTGRIIGNLFVQGRDKENYSAFIAVAAEERKNPSRGLVIEGNRASL
FT                   PAGMGRRSVFVADWSGEALAIGANELGAGLARFEKR"
FT   sig_peptide     38833..38922
FT                   /locus_tag="Sala_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 30"
FT   gene            complement(39789..40247)
FT                   /locus_tag="Sala_0039"
FT   CDS_pept        complement(39789..40247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51765"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX57"
FT                   /protein_id="ABF51765.1"
FT                   /translation="MDMLASYFAAHDWPHEMVGEDEIVATAQGSWTTYELRAVWRADDG
FT                   VIQLLAFPDIRVADDKRAVAHEALAMINEQLWLGHFELWSNSGTILYRHGMLLGADAAL
FT                   PLDLTETLVESAIDECERFYPVFQFVLWGGKTPAEALAASLIETRGEA"
FT   gene            complement(40437..40757)
FT                   /locus_tag="Sala_0040"
FT   CDS_pept        complement(40437..40757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0040"
FT                   /product="protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51766"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX56"
FT                   /protein_id="ABF51766.1"
FT                   /translation="MQSENRFFDDLAKMVNGIAGTVAGAGREAEAAMRERAKEFVGRMD
FT                   FVSREEFEAVKQMAATARAEAEALKARLDKLEGAAKAAAKPAAATKSATKPAAKPKAAP
FT                   KA"
FT   gene            complement(40793..41344)
FT                   /locus_tag="Sala_0041"
FT   CDS_pept        complement(40793..41344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0041"
FT                   /product="TspO and MBR like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51767"
FT                   /db_xref="GOA:Q1GX55"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX55"
FT                   /protein_id="ABF51767.1"
FT                   /translation="MTEIATPGQLRMSYLRWALVTVPAIVLIGSLMGILSNSGYDNRWF
FT                   AALDLPAITPPGWVFGIVWPILYIMLGLSLAMILHARGAKGRGFALLLFFVQLIANFAW
FT                   SPLFFGQHQVTNALYLIIFILMVSIATAFAFAPIRKAAAWLLVPYMAWLSFAAILNFQI
FT                   DQRNPGAETLVPAAATTQIG"
FT   gene            complement(41406..42146)
FT                   /locus_tag="Sala_0042"
FT   CDS_pept        complement(41406..42146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0042"
FT                   /product="hemolysin A"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51768"
FT                   /db_xref="GOA:Q1GX54"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX54"
FT                   /protein_id="ABF51768.1"
FT                   /translation="MAKVRADQLLVDRGLAESRTRAQALILAGLAFVGDRKIDKAGQQI
FT                   AADAALSVKGRDHPWVSRGGIKLDHALSHLGWDVTGAVAIDVGSSTGGFTDVLLSRGAA
FT                   RVYAVDSGTNQLAWKLRQDDRVIVHEQTSARILTAKHIPEPVSLVVCDASFIALSKVLP
FT                   VPMSFTGPGARLVALIKPQFEAERHEVGKKGVVRDVAVHARVCADVRAWLTGKGWDVVD
FT                   LVESPITGPEGNVEFLIAAIKRAG"
FT   gene            complement(42262..44322)
FT                   /locus_tag="Sala_0043"
FT   CDS_pept        complement(42262..44322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0043"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51769"
FT                   /db_xref="GOA:Q1GX53"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX53"
FT                   /protein_id="ABF51769.1"
FT                   /translation="MASEAFVTRIGRALAALLAALLLAAGPARAQATHISPRLVAESAM
FT                   PAPGGTTTLALTMTPEKPWHGYWVNGGDAGFGLTVEWNLPDGVSVAPFRYPVPDALILF
FT                   GMMNHVYEHPYALLAELRVDRSVAPGSDLTLSGVANWLACTDKVCVPERAVISVELTAG
FT                   DGTIPAGARARFDGWRALLPQPLDRAGRWERRGGSVRFAIPLPASVAIDAPHLFVETQD
FT                   VIDYAAPQRFSRRGDHIIVETSAKGAREGPVTALLRTGEGRGLSLRLVPGPVPAAGEPV
FT                   ATDAAGINMGLFWTAFGGAILGGLILNLMPCVFPILSLKALSLARSGGDARTARIEALA
FT                   YTAGAILTALLLGGALLALRAAGEQVGWAFQLQHPVSVLALLLLALAITLNLLGFYELP
FT                   SFSGGQALADQGGAAGGFWTGALAAFVATPCSGPLLGAALGATLALPAWAALPVFGGLG
FT                   LGLALPFLAIGFVPALRNRLPKPGPWMSRFRRWMALPMGLTTLALVWLLWRQLGNGDQL
FT                   IWPAVAVAMALVLLTHYGAIQRGDRRSWLLIASGLLFTVSLGATVAEVARAERTAEGSG
FT                   STFSPDALAKARASGKPVFVYFTADWCLSCKANEAGAINRAAVQAAFDKAGVVTLVGDW
FT                   TNGDPVITRTLAEHGRNSVPLYLWYAPGADKPEILPQILTPGMLIDKVGAK"
FT   sig_peptide     complement(44230..44322)
FT                   /locus_tag="Sala_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            44414..46099
FT                   /locus_tag="Sala_0044"
FT   CDS_pept        44414..46099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0044"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51770"
FT                   /db_xref="GOA:Q1GX52"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR026263"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX52"
FT                   /protein_id="ABF51770.1"
FT                   /translation="METPPVKLKYPIAALVGALCLAGAGTTVAQEAAPAARRATAAIQA
FT                   PKLLVVIAVDQLSADLFAEYRGRFRGGLARLATGVVFPSAYQAHGATETCPGHSTILTG
FT                   SHPARTGVVANNYFDLSVARADKRVYCAEDETVPDTSSGSGKYAPSVKHLLVPTLGDLM
FT                   KARDPQAQVVSVAGKDRAAIMMGGHRADETLWLAPTGLTSYRGKALSPTAERAATVIAA
FT                   AINQPRGPLTLPAECAAQDIAIPLANGASVGTGRMARDAGDFRRFLASPEADGAVLATA
FT                   AALRQARRMGQGSGTDLLIIGLSATDYVGHGTGTEGSEMCLQLAGLDRELGDFLARLDA
FT                   TGMNYAVVLTADHGGHDLPERNRQNAWPDAQRIDTALDPEALGNEVAEKLGLPQPLLHG
FT                   EGGDYYLSKALTAAQRKAALAEILPRLRAHPQVEMVATRDELAAHPISRRAPDMWSVMD
FT                   RLRASFHPDRSGDFIVALKPRVTPIAEPGVGYVATHGSVWDYDRRVPMIFWRKDLAGFE
FT                   QPNAVMTVDIMPTLAALIGLPVDAGAIDGRCLDLVSGPDSSCQQ"
FT   sig_peptide     44414..44503
FT                   /locus_tag="Sala_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.951 at
FT                   residue 30"
FT   gene            46087..46947
FT                   /locus_tag="Sala_0045"
FT   CDS_pept        46087..46947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0045"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51771"
FT                   /db_xref="GOA:Q1GX51"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX51"
FT                   /protein_id="ABF51771.1"
FT                   /translation="MPTINEDQGIMTKRLKDFQGRMLLVGCGNMAGAMLDRWLASGLGA
FT                   DRVAIVDPLAAPREGVVQFASLAEWCAAGGGADWIMLGMKPQQLGEVAGDLADVVTGDT
FT                   HLLSILAGVSLADLAARFPAAKAQVRILPNLAARIGAGVSAVASSGEADMAAVTALLDP
FT                   LGTIVALADDSTMDLVTAFTGSGPAFVFRLIESYAAAGERLGLSAEDALKLATATFGGA
FT                   TALLADSGEKPGTLIAQVASKGGTTQAGLDVLDSDGQLAALLTNVLRAARDRGRELAEI
FT                   ARGEG"
FT   gene            complement(46964..47527)
FT                   /locus_tag="Sala_0046"
FT   CDS_pept        complement(46964..47527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0046"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51772"
FT                   /db_xref="GOA:Q1GX50"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX50"
FT                   /protein_id="ABF51772.1"
FT                   /translation="MERASCQRPARRATVATMPDDNFLSQVPAASALFLREEEVRRGIE
FT                   FLFFAHASLWRAIDTPLAEKALGRAHYRALYFIARQPGLTISDLLALLGITKQSLGRVV
FT                   KELEARGLVATRPGNRDRRAKELRLTDAGRAAERELFGALRDAMSRAYTHAGQQAVTGF
FT                   WQVSEALVPPRDRRRIATLGKEAG"
FT   gene            47553..48638
FT                   /locus_tag="Sala_0047"
FT   CDS_pept        47553..48638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0047"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51773"
FT                   /db_xref="GOA:Q1GX49"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX49"
FT                   /protein_id="ABF51773.1"
FT                   /translation="MSAPAFARLPHPSPVADDVRAAAIADPAFGRVFTDHMVSIRYTEG
FT                   QGWHDAQVMPRGPLTLDPATAVLHYAQEIFEGLKAYRLDDGSMALFRVEANAARFNASA
FT                   RRMAMAELPEELFIAAVKEAVAADAHWFPPVDGGALYLRPFMFASEVFLGVKPASEYQF
FT                   LVITSPVGNYFKSSAPAISLWVSEDYTRAAPGGTGAAKCGGNYAASLIAQREAIAKGHD
FT                   QVVFLDAAEHRWIEELGGMNMFFVFDDGSLVTPPLTGTILPGITRDAIITLAHDAGLTV
FT                   REEAYAIDQWQADAESGRLTESFACGTAAVVTPVGKVTRGEKSFTIGAGGQGQVTEMLK
FT                   ARLVDIQRGRAADPHGWVTRI"
FT   gene            48696..48770
FT                   /locus_tag="Sala_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            48696..48770
FT                   /locus_tag="Sala_R0001"
FT                   /product="tRNA-Gln"
FT   gene            48884..50962
FT                   /locus_tag="Sala_0048"
FT   CDS_pept        48884..50962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0048"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51774"
FT                   /db_xref="GOA:Q1GX48"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX48"
FT                   /protein_id="ABF51774.1"
FT                   /translation="MPAIENVNRRGATYWWRRRVRFVGRLERPITIVTTVSLLTKDQSV
FT                   ARRRAVAMTSRSEVVRMSLYERIEQEGLTSEQVNHLFREEMVRYRNMLAHQLAVIEKDG
FT                   EGNVTARFHQMLSIYAAFNGDFIANGFDDYMGIDYIGSFDKRFPSLDEEARANLYAMLS
FT                   QAGDVPGNLLNEAKALLERLGIEPAADRIEIARQVMCGARLTAAATYDSPEVRAIEHSL
FT                   ALMNALGRAPLQTSMPPPISAPAPPNAWNASTIVPASASTLTDVQTHYATLSPVQAVEK
FT                   YMELKPKARGREDAPVLAEGANPKKRKSQPKVWGASQKRQFKAAPFLFGKSNNGKAMAA
FT                   TCQEDLNQFYDLLNRLPSSHHKSPRHEAMSLEEICSEALDRLTEEEERGEEISFAIGLD
FT                   VGTINRHFANLKRLCAWLATKTPMAPLDFSDFILDEDDRDERDERDPYTIAQGEELFRL
FT                   GIWTGGTGVDLPQRLSVTPGGSIWHDAAYWVMPLVWYSGMRREEACKLLVDDIGEEDGI
FT                   FFVNIRKTSAGGVKNATSVRKIPVCEELRRLGFMHYVQAMKEAGEQYLFPEIQPGRTGR
FT                   ALGDVFFKNIWLHIKPRLKLVKPGQAVHSGRHMVSTELKMLQTFEEFRSDLLGQKHGGE
FT                   NANRYASATRLQILLDVVNQIPKVTAHLQDTVEIRLLPVCMRGARPTRESAGRRKRG"
FT   gene            complement(51177..54644)
FT                   /locus_tag="Sala_0049"
FT   CDS_pept        complement(51177..54644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX47"
FT                   /protein_id="ABF51775.1"
FT                   /translation="MRFQLLDLVRYGGFADRVVTFGPGRPDLHLVMGPNEAGKSTMLEA
FT                   IGDLLFGIHAQTAQGWRFDYGELRIRAVLEHQGSVVEITRRKGSRNTLLATDGTALPED
FT                   ILVPFLGGIDRTTFERMYGLDHQKLRSGGLAILEGKDDAARLVLEAGSGLSVVGAELAR
FT                   LERVAGELFKPNAQIPPVNRLMRERGEAQAIVRSSALTDSAWSAIIAAERRAGEQRSEL
FT                   QVESRELATRAAALERTNRARAPLARIGEIDAELEALGDIKLFPADAASRLNAAIANRN
FT                   TAQELQNQHSIQLDRAKNVLSSITLPELLLAERERAEALEERRPVVEKAVADIARRTGE
FT                   LERSEARIETARSEARLPAGAALPSAGWRKRAREYLQDRRALAERRVRLSLALSEAALA
FT                   KAKAETDLAALPPPIELAGLTDAITAVPADFAERVTSAEERLIRAERRMQIERASLSPW
FT                   AGEIDGLGTMSLPVDVVVSEHQARIEVANAQLAQAKLAISNSSEASVKATARLAGLSAA
FT                   GDLPTPEAVLAARELRDSAVEDVRGRLARPREPGDEDAGVALSLAVERADAVADRRDAE
FT                   ADRIAELLLARTTSAEADAFHQANRLLVEEAEAALEEAKADWASLLAPLGLVLPPAALA
FT                   AWRASRERVLEAFEEQAAAKTGLDRLKATAAAALTKLAQISSAAGFQIEAEMELADAVR
FT                   AAKARLSALEVADRLRAAANVVMAGVATTLDELAREEREIVSRGAVLDEDRGALMVEAG
FT                   LLEDAGDPAISDAIEATEAVAAEIATADGLRRQINGMKKDIDAFEADANTLFAAVGHDA
FT                   PTRHSEDVHALTLTLKAGLAEKLKVERAREDIIAAQAGIQESEARAAAANAVVAELLGI
FT                   GDITEEAALLPAIATSTHSIALGTARQTALNDLVEISGGRSVEELTADVAVIGADEATA
FT                   ELEAIADRQHEIGAEREAIGKVLRESELAHDNAATETLAADAQQRVKEIEAALLDAAER
FT                   HVGAAATAAMLRWLIGKHRAESQGPLIARAGSLFQEMTHGSFAGLGLDYGADDQPRMVG
FT                   LRQGGERVGVDGMSEGTRDQLYLALRLASIDERAAGGMPFICDDILITADEPRSASMLS
FT                   ALGAISRRTQVIVFTHHEHIVDLARRTLGDDGFTLHRLDAEIAVIAAA"
FT   gene            complement(54644..55894)
FT                   /locus_tag="Sala_0050"
FT   CDS_pept        complement(54644..55894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0050"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51776"
FT                   /db_xref="GOA:Q1GX46"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX46"
FT                   /protein_id="ABF51776.1"
FT                   /translation="MTGTFTFVHAADVHLDSPLGGLAKRDKAFSGLALNATRRALANVV
FT                   DLAIAEGAAFVVVAGDLYDGTWKDQSTGQFAVSQFARLSRAGIRVAIAFGNHDAESRIT
FT                   RHLTMPEGVFGFSNRKCETVLFEDLGVALHGRSYKDVATLENIAAEYCPPVTGMFNLAV
FT                   LHTALEGHPDHARYAPCSVGELVASGHDYWALGHVHDASIRSEHPHIVYPGNTQGRNVR
FT                   ETGVKGAMVVRVEEGVVRSVEHRACDEVRWARPEFDGRQASDMHELLSGIGGVLQEAIA
FT                   GAGDRPTAVRLHVKTSGGLQNKLLADPDWFNAEVGARAMTVSESLWIERVKVESSEDAA
FT                   TRGLPPELIELLNGALADPDCLRAVEDAVAPLVGKMPAGTIDADLAPLLAAASARDGNS
FT                   LLAAAKRAVEASLSVDA"
FT   gene            complement(55994..57361)
FT                   /locus_tag="Sala_0051"
FT   CDS_pept        complement(55994..57361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0051"
FT                   /product="UBA/ThiF-type NAD/FAD binding fold containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51777"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX45"
FT                   /protein_id="ABF51777.1"
FT                   /translation="MHHSDFTAFLDGFNRLAKLDLDLGDASCPETAMARLRGYRAHIAA
FT                   GPEVTESIAHQIALLTFVNIASRFALGGVTVSGIADVPLLAPWHGDSLASAVEMLGGAT
FT                   ADLAEETPVVLLGSATTPAERGGCQITFAGWRGGVVPLGGSRLDEKETVAAAAVLAGSL
FT                   AAAEIFAMLRDEIGAGCRDHGLSIWRPDGDEDWRSPASDGPPVSVLPNHLWVLGLGHLG
FT                   QAFLWTLAMSPYSDRASVKLVLQDTDVVTGSTASTSILTRPETTGRKTRTVAALLENLG
FT                   FATSIIERPFDGAFSRRSDDPSVLICGVDNALARTQLELPRFELVIEAGIGRTASDFRA
FT                   VRLHSFPSQRAAAELWKAGAAAGVATAGNMPGYQRLRESGVDDCGLALLAGTAVGAPFV
FT                   GGVAGALMFGQILKLLHGERPDAVVDLDLRALEARRAVPSSVPLVHNPGFQPCDNC"
FT   gene            complement(57375..57854)
FT                   /locus_tag="Sala_0052"
FT   CDS_pept        complement(57375..57854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51778"
FT                   /db_xref="InterPro:IPR020232"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX44"
FT                   /protein_id="ABF51778.1"
FT                   /translation="MVSSADSFRLSWLGWWRLVGQLRRRGRGIRESGAFLLGHRHSGPG
FT                   VVTDFVFYDEIDPDALSRGHVHLSGQALGKVWDRCGVRGLEVLADVHTHPGSAGQSDSD
FT                   RAYPMIAIKGHTALIIPAFARSATNLRGVGVYRHLGAGNWISLPSPKAGWRGITF"
FT   gene            complement(57838..58296)
FT                   /locus_tag="Sala_0053"
FT   CDS_pept        complement(57838..58296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX43"
FT                   /protein_id="ABF51779.1"
FT                   /translation="MTPDRVIFERDIAAAPFLEGAARNRWALRTLEWPHGMFDVTARDG
FT                   RLFHLRLDFTGYPAASPTGGLWDPDTGAILALDKWPIGDVAFASVFRRDWQDGRALYMP
FT                   LDRISLTGHHDWPTQYPHLVWRPDVGLIQYLAEVHRLLNMRGYHGIVG"
FT   gene            complement(58298..58759)
FT                   /locus_tag="Sala_0054"
FT   CDS_pept        complement(58298..58759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51780"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX42"
FT                   /protein_id="ABF51780.1"
FT                   /translation="MPIDIFIKRGGSLEVQHQKAESFDLAHIKRKLDEVFGAGHLFLED
FT                   GDEPIAADHKVEGGSIFVHHNRCKQIEVTVRYAGKAFEHGFTPGTTLKKIKRRAEKKLD
FT                   IDPADAVELSLQLAGTTERPDEATHVGSLAQPKTCAVAFDLVPSDRING"
FT   gene            complement(58843..62181)
FT                   /locus_tag="Sala_0055"
FT   CDS_pept        complement(58843..62181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0055"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51781"
FT                   /db_xref="GOA:Q1GX41"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX41"
FT                   /protein_id="ABF51781.1"
FT                   /translation="MAAFDLARLHARALREAKIAGRATGPAAVKSAAAAEGFVIKPVPP
FT                   GDPVIGTSDAKLLREWCSIYVRNDVSDAEAAAFVAHELGHLKLHRPQDNCTGPNPDAGT
FT                   SRALSRVEAYGPRERRELQANVFARELLLPRALARQLFLVERLGAGSIAQLLELPVPLV
FT                   RRQLFDSLLGPDASAPTVNAQKPKFGRDDSQEAAAGFADPALLLEAGPGSGKTRTLVKR
FT                   IEHLLDFDEAVPNEILALTFSNKAAGELADRIATARPDAAADMWIGTFHAFGLDLIRRY
FT                   YELLDLPSNVQLIDKAQAIELLEDQLPLMGLNHYHDLRNPDQGLVKILSAISRAKDELV
FT                   THAEFTRRAREALAAAVSAEQVEVAERACEAARVYEIYADALGKAGAVDFGDLVMLPTL
FT                   LMMRNDCVRAQVAQRHSMVLVDEYQDVNRASARLLMELYREGARLWVVGDARQSLYRWR
FT                   GASSANMAQFERDFSGGKRLPLDRNYRSTEHIVGLGRGFARDMRAGKNGLAYNAKSARE
FT                   EPGSATRLLVGLDDRCEGELLAAEITSLKQAGVPLSQQAVLAPTNNRLDIVAGILAEHG
FT                   IATTHLGSFFEREEVRDLLSVIALLAEANGGALVRVAALREIGVGASDIGVIVRAAQAA
FT                   RVPLLSLLATASTLTGMSPTGGEALEQLGLQMAGLDQFTPAFEVAASWLLDRSDYLRDL
FT                   AVAPDASGSLSRAALLALLGFLDQRELGGQPLTPARALKRMRSTVLLADDRDLRDATLG
FT                   ADADAVRLMTIHGAKGLEFPAVHVVGLHDQCLPGAFRRDDSPLPPGLVEPETREGHLEE
FT                   EECLFFVAISRAEDHLRLYHSELANVRGRKPSPFLGRLGALERRHLPAAATAAGAAGSP
FT                   LSPISTDRINLFDVRDFDSCPLRIAYRRFFGVEGRRHETPYLKTSGVLYALVDRITEVS
FT                   GPGVEERLQVLLGEIWAIRGPAEHGLAADYLAHAAGRAAALGRLMSGFDSPGYSQIELP
FT                   INGGLLTVAAPLVRSTAAGTEIRFLEAGRVRSKTGNDLTAGLLLAAARHTFGPNVSVTI
FT                   GHVTDGATVPVKRQDDKAAGDVEAAAAILAAINKGALPAKPAMRVCGRCPHFVACPAVG
FT                   RAETA"
FT   gene            complement(62186..62770)
FT                   /locus_tag="Sala_0056"
FT   CDS_pept        complement(62186..62770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51782"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX40"
FT                   /protein_id="ABF51782.1"
FT                   /translation="MKNINPNLGRLAEDYIVSGAWDPELVDKLGPDELDQLFSHLTARA
FT                   AVETAAATLEPESLELDEDAQAAVLRLQSFYLGEVARVRTAKPDAAAMLLKPATWLAIE
FT                   PVLRDRDFLIRLAQRRLRGMQSRCTQDIADLLGYSRRAVADFFRGEAGEGLTLAENRNT
FT                   GKPDDGGDEEFSTALARSDIPEAFKRRWREE"
FT   gene            complement(62767..63480)
FT                   /locus_tag="Sala_0057"
FT   CDS_pept        complement(62767..63480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0057"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51783"
FT                   /db_xref="GOA:Q1GX39"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX39"
FT                   /protein_id="ABF51783.1"
FT                   /translation="MKEDTVDPEAPRHPGFVRKALDWAEDLSAQEILTAARIKDRTASG
FT                   YLPSAALVRLVRRYRTEGDDDSSTRLSTLLIARAYEYVRGIYARMGVDGQDVVQETMQT
FT                   FLTELAEQDGVDWWEATFERELRRRAADAYRHLFKRHRSRSLVLPEDHDRGDDGEEAHE
FT                   IARRAALAAFAEVRIPTEKKRRLFLLLMLNELPIDAPEAPNDLVRLTGIPRSTLANLKT
FT                   EFGRMLKSALAEKTS"
FT   gene            63977..64852
FT                   /locus_tag="Sala_0058"
FT   CDS_pept        63977..64852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51784"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX38"
FT                   /protein_id="ABF51784.1"
FT                   /translation="MTEPAPTRFLLYIDILGFSEMTKSDPRSVARTYAILNKLNVHRDK
FT                   AFKTIVFSDTVLVYNPIGARNDEDRNFYVWYLAEAAEDLYSRLVGQDIWFRAVLIAGEF
FT                   NHYQLENLDAFYGKALIDAYQSEKRLPLIGLALHSSCLPYNRFFRVSPFTDDFSFVYLS
FT                   RPLEYLHAASGDGYPFANRIVSDHSPALPEGVRYLSDIYRLMRTHPEPLVRAKALTTWD
FT                   FHARRYPGMVAALVANNFSLDALAPPGTWDIAVKTLEENIRHNKRAGAGSQMSVSITPQ
FT                   RPRKPGKAIF"
FT   gene            65272..67644
FT                   /locus_tag="Sala_0059"
FT   CDS_pept        65272..67644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51785"
FT                   /db_xref="GOA:Q1GX37"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX37"
FT                   /protein_id="ABF51785.1"
FT                   /translation="MAGLRWIFDRASGTPRVGYRSAMAGSVATLWKQLDIRSKGWPARL
FT                   RGLIVVRTGHLAADARQSAGNHRGKIEGLGWLAVAAGAIFSVPPLQSLIAPLLGSEGVA
FT                   TLRDMIIAASGAMIGATAIVASFILFAMQVNVERLPYGLFHRFSSDARLLGGFAAAFML
FT                   SLGTMALAFIEDPGHSSAVVVAAILAVALILRLLLHAYRRSLRLIDPVSQLSMIEADAA
FT                   AKLRRWDRRVRWLQPLLAEDPGPGEPAARREGMRLDVRRAAILEGSKGWDGPLRTAIGQ
FT                   AAAFSRQAAERGDLEVSAAALNSLLALNRAYVAVKGRSFHARTLLFENPQVTDGTINAT
FT                   LEELRRLRVAALAGLDEPHLEQLFKAHLGLVRAYLGIEYPGLNPSPSHALLAAHYLESA
FT                   VEAVIPTQMTDTLMEGVKCLGDAARLFASAGHASAASSLFGKIAKIGVAGAMQRDGFPV
FT                   AVVAIEQLASLQLSLFYGDGANHGYATRQLRSAIFTTATAMFALPDLPLASKQITALAP
FT                   FFSGSDPRGFRSSLTSLVNALHEPGADAAMAAKVAHNIVEWADKLYVDVRALLKLAIEK
FT                   RSQFVIDLIHWITGMSELLFFAAKAPATAHHDRSTLEKQAHFLIGSLTFIPRDPETAKW
FT                   IEAFSLIDILFEFGSMASEREWLEGFDTAFDALLRWGFEAGAENTGWNTLDSALAALAA
FT                   LTIGEDAALQTRLIAAVQAAVAAEGAPAAPVRERAARFLRGRADHLHSSDFDTDAVNLA
FT                   LCADIPAARALLAEIAELLAPLLPPPPIPPAPAPPDG"
FT   gene            68024..69100
FT                   /locus_tag="Sala_0060"
FT   CDS_pept        68024..69100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0060"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51786"
FT                   /db_xref="GOA:Q1GX36"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX36"
FT                   /protein_id="ABF51786.1"
FT                   /translation="MLGASVASREASAQMAKAPMRKIATEEAFATPELAKAWLEIARSE
FT                   PNSSLDIPTGILSIFDNPRPGSNQDRFRRQLLDVDAERIRDMDEAGVDMQLLSVTIPGV
FT                   QIFEPARAGELAVTTNDHLAAAIARRPTRFAGLACFAPHDPVQATREMERAVNALGLKG
FT                   FIVNSHTQDLYLDDPRFAPVLEAAQSLDCPIYLHPRAPSNGMAAPFRDYSMGGSIWGFG
FT                   VEAGTHAVRMILSGVFDRYPRLRIVLGHMGEALPFWMWRLDHMAARRAKDGRMKPLSLA
FT                   PSEYFKRNFAVTTSGFESPDVLDLVIKVAGIENIMWAIDYPYESSRDAVTFIEGADLTA
FT                   SQRASIFHRNAVRHFRLS"
FT   gene            69196..69759
FT                   /locus_tag="Sala_0061"
FT   CDS_pept        69196..69759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX35"
FT                   /protein_id="ABF51787.1"
FT                   /translation="MHRFFWGMLLSIAVVTPANAEYGWCTIQKDTSYDTYLSAVVDIGE
FT                   GGNVHQEVLTRQFGRAFQGYVAQFETIVREPDCHSSKRLSDAEEGNRRYSMSVGQVIRT
FT                   NWRGAWPAPGAPSGPAAASGSHLTVSSPPAPAAPEWSEVQQQQQRQAAAELARNIAASA
FT                   KARAESEAALTAFLDAMRKRGRAQ"
FT   sig_peptide     69196..69258
FT                   /locus_tag="Sala_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            69756..70496
FT                   /locus_tag="Sala_0062"
FT   CDS_pept        69756..70496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51788"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX34"
FT                   /protein_id="ABF51788.1"
FT                   /translation="MKHHLKLLMLAIAAAMIGGPAMAQIESAQPLPVGQPLTLAAGERN
FT                   AVRYFYFAGVPGETRSIDVSLAGKVIIEVYDAAGTLLMVRSASAGRSFDFIPSYAETYV
FT                   IAVIRPGAPIEAVLRTSVVAPTLQQSIMAIGVGYEFATEHGISRSCWSEQGAEVTHTGT
FT                   LRKGDAFTMRIRLGADRLSQTNETLVGAIASRSSVRSWLEGANRVSEVDTNGSVSVSKQ
FT                   VNDPASFRWLPGVARKWYRYTCPS"
FT   sig_peptide     69756..69827
FT                   /locus_tag="Sala_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            70663..71181
FT                   /locus_tag="Sala_0063"
FT   CDS_pept        70663..71181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51789"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX33"
FT                   /protein_id="ABF51789.1"
FT                   /translation="MHSVTSGGKTIGIGEHRSAASRMGGEVSKKAPRRARPFRSLRFQS
FT                   KRKPHLSPGSRILETSGIARSLPIASELLFDGFLGGVADVLRGIAYLLRRLRDRACFGL
FT                   FVPEKLEAEEGRDSERNDDDERYAPSASRFTPHDRCRVRSPVGFADRMNFISHAILHPL
FT                   LSPKDAFGG"
FT   gene            71489..72214
FT                   /locus_tag="Sala_0064"
FT   CDS_pept        71489..72214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51790"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX32"
FT                   /protein_id="ABF51790.1"
FT                   /translation="MKRLLLSLAISAAAITGPAVAQAPDNRYQDRPGSYRDDDGGRGNI
FT                   SSRIEQLRERIEEGVRSGAISRREALSLRSSLRSLTELERRYSRNGLTNGELQDLQLRL
FT                   RSLRQEVRQADDGARGRYDDWDRQGGRDDDRYDDRDGRRDDGRGYDRDDSRYDDADNRY
FT                   REPEQRGGLGGVFDGVLGRNTTSLQIGQRAPTDLYGVPYEYRDRYRDTDQSYFRSDGRQ
FT                   IYQIDARTQAVVRIHAMNR"
FT   sig_peptide     71489..71554
FT                   /locus_tag="Sala_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            72355..72810
FT                   /locus_tag="Sala_0065"
FT   CDS_pept        72355..72810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0065"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51791"
FT                   /db_xref="GOA:Q1GX31"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX31"
FT                   /protein_id="ABF51791.1"
FT                   /translation="MLPHECFVQPQFGSVRLSLSVHRRRRELKKYIAAAVLAAVAIPNA
FT                   PALADPPPWAPAHGKRAKDRGLYDGSGRYYEPRRLSQNDRIWRAKDGRYYCRRENGTTG
FT                   LIIGAAVGALVGRELDGGRDRTVGTIIGAAGGGLLGRAIDRGELKCR"
FT   sig_peptide     72355..72504
FT                   /locus_tag="Sala_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.979 at
FT                   residue 50"
FT   gene            complement(72897..73181)
FT                   /locus_tag="Sala_0066"
FT   CDS_pept        complement(72897..73181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0066"
FT                   /product="protein of unknown function DUF1153"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51792"
FT                   /db_xref="GOA:Q1GX30"
FT                   /db_xref="InterPro:IPR009534"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX30"
FT                   /protein_id="ABF51792.1"
FT                   /translation="MLDLKTKPTSVAGPLGPVTVGDLPSSSTTYWTARRKAEVLAAIDG
FT                   GLMDFEEACERYRLSREELAAWRRMLDRAGVPGLRITNRQRLRDQYIFE"
FT   gene            complement(73686..74876)
FT                   /locus_tag="Sala_0067"
FT   CDS_pept        complement(73686..74876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0067"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51793"
FT                   /db_xref="GOA:Q1GX29"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX29"
FT                   /protein_id="ABF51793.1"
FT                   /translation="MRTSLEVADVFRTAGPAYRTAHAGHLSLHQLKIMSAIEHCRTAAL
FT                   GGHVEACTDCGHWRIAYNSCRNRHCPRCQGAAARTWLEAREADLLPVGYFHVVFTLPAE
FT                   VAAIAFTNKALVYDLLFKAAADTMLTIAADPKHLGARIGITAVLHTWGSALTHHPHIHM
FT                   IVPGGGISRDGTRWISARPAFLLPVRVLGALFRRLFLTRLRALHDDGKLAFFGSLTHFA
FT                   ERRAFLRHLSPVRKKRWVVYAKPPFAGPEAVLAYLSRYTHRVAISNSRLLRFDEAGVTF
FT                   RYKDYRQGGANRQQVMTLAADEFIRRFLLHALPRGFHRIRHYGLLASARRKDHLERARR
FT                   LLNVAPAPADDLPAELEAQPLCPCCGGTMAIIEVFERRYQPRAPPPPSLSSGTQAP"
FT   gene            complement(74882..75790)
FT                   /locus_tag="Sala_0068"
FT   CDS_pept        complement(74882..75790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0068"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51794"
FT                   /db_xref="GOA:Q1GX28"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX28"
FT                   /protein_id="ABF51794.1"
FT                   /translation="MNELIQIGPISPLRQRLLDDMAMRRFGPETQRNYLRDVGRFATWL
FT                   GRSPHTASAEEVRQFQIDQQQAGVPVPTMNSIVSALRFFFTETLDRPDLARKLIRAKQV
FT                   RKIPVVLTMAEVKRLLDATRCLKHQAALSVAYGAGLRVAEVSALKVSNIDSKRMLLRVE
FT                   RGKGGRDRNAMLPEGLLLLLRDWWRAGRQQGILYRDGWLFPGQGAAAHISTRQLHRVVV
FT                   EAAEAADIDKRVGPHTLRHSFATHLLEDGVNIRVIQALLGHANLNTTAFYLQVATKTTR
FT                   KVTSPLDRLALASPIEEPPDG"
FT   gene            complement(75977..76849)
FT                   /locus_tag="Sala_0069"
FT   CDS_pept        complement(75977..76849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51795"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX27"
FT                   /protein_id="ABF51795.1"
FT                   /translation="MKAFLAAASLFAIPIAGAQVPTGSAQTFPDLRETTPPEPSPPRGS
FT                   PPRIIPGTLVKMSGGDANLRQFVALAGSEITITLRGTGLIAAVLYDADGTALAVREATT
FT                   VARIRQKLPKDGVYYLAPIAPPGSQLELSLDLALPPPPPEPDWMRRITKLPTIATDYGP
FT                   AFPIAPGQLISGNFAQAAVSRFEPARAAVLYRLEGRLAQRVKVAVRSSDAHSLVWIARG
FT                   PSDPKMLRSSDAQYKGDVGYDSVLDRYLPADGTYFIIVQAYADGPKGQRDLSAPGPSAG
FT                   EFTIEMQLK"
FT   sig_peptide     complement(76793..76849)
FT                   /locus_tag="Sala_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.809 at
FT                   residue 19"
FT   gene            complement(76846..77403)
FT                   /locus_tag="Sala_0070"
FT   CDS_pept        complement(76846..77403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX26"
FT                   /protein_id="ABF51796.1"
FT                   /translation="MRARPILVSICLISMPAQAAEKTTYGWCERREPTDIYRMSGLMQK
FT                   SPSTSTVDIENAFRASLGTEESVTCWFYYSSPSEGEDYFNRRQYVIATEEKRQFTLTGW
FT                   TGPYAITGKPAPKPAGAVLTVEAAPVAQPDAEAAARAAIIVQRREVDARVGAAARAAQA
FT                   DAEYQAKLSKFFEELRRRGRAQ"
FT   sig_peptide     complement(77344..77403)
FT                   /locus_tag="Sala_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            77512..78048
FT                   /locus_tag="Sala_0071"
FT   CDS_pept        77512..78048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX25"
FT                   /protein_id="ABF51797.1"
FT                   /translation="MTNAGDAKAAGILSGEVMPIVSRSLLALFFPSMLMVTPAFAAPPP
FT                   PRIDVIAYSADLGEEGLAEAYVTLAAYSGAFERAAPGTDRSKVRACAASNSEACIRAIL
FT                   TARGGAAVIIVVQGAGVGIQKWTCFGSGGTPVDAAKQTATINLQVAFFGERQAKFQQSL
FT                   SATACIMSAAAESGW"
FT   sig_peptide     77512..77637
FT                   /locus_tag="Sala_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.939 at
FT                   residue 42"
FT   gene            complement(78229..79272)
FT                   /locus_tag="Sala_0072"
FT   CDS_pept        complement(78229..79272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0072"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51798"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX24"
FT                   /protein_id="ABF51798.1"
FT                   /translation="MSGLPLRAKDAAFRVPVVDSLTLTVLTDSGTFGPFLPDLDLPGLK
FT                   VLRAGNGSPPGYTRMSPKALMGEFGLSLLADSRVGDASRRVLVDFGYTAEVLANNMGML
FT                   GIDPSSIDASVLSHGHLDHYGGFPAMTGSAEKRGRPLPLYVGGEETFCERVAMIGDPPP
FT                   VMGILDRAALTKAGYEVRISPTPQIVADQAFTTGIIPLETFERTAIPTRMRPGAGCERT
FT                   GLRSDKRDLAEVTDDGEHELATCYAIKGLGLVVIASCSHRGVLNSVRRAQAISGISKVQ
FT                   MVIGGFHLVRPRTEEEARQTVSAFKVIDPDYIVPMHCTGEVFIEEAIRQMPSKVIRPYV
FT                   GTRLAMA"
FT   gene            complement(79659..79934)
FT                   /locus_tag="Sala_0073"
FT   CDS_pept        complement(79659..79934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51799"
FT                   /db_xref="GOA:Q1GX23"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX23"
FT                   /protein_id="ABF51799.1"
FT                   /translation="MAASTRRWWDRIFWAVVVVDAIGALTLIFASEGNQDAAGRGVQSG
FT                   LGIILLIIVAVLAGLGWLFKTPFVRVPVFIAMALPGLWLASAYLSQ"
FT   gene            complement(80291..81436)
FT                   /locus_tag="Sala_0074"
FT   CDS_pept        complement(80291..81436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0074"
FT                   /product="Thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51800"
FT                   /db_xref="GOA:Q1GX22"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX22"
FT                   /protein_id="ABF51800.1"
FT                   /translation="MKGWHASEGNRSMLRKRRGLGFAAIAVTAAIGAVVYCFGDIPGGR
FT                   LNPTPSPIPSAAAAEYPGQPLVALAGNGPWLNTTERTPQALRGKVVLVNFWTYSCINSL
FT                   RPLPYIRDWAAKYKDDGLIVIGVHTPEFAFEKDGDKVRRAVAELGVTWPVKLDSDYATW
FT                   RLFGNDGWPGFYFIDAKGQVRHHRLGEGDYAASERLLQQLLAEAKAAPINEKLTGDIGK
FT                   GIEAAPDWDQLRSPETYVGYRQADRLAAPQRLKRDAPLTYSLPSSVPANQWGLGGAWTV
FT                   GAESARADAASAKIRYRFEARDLHMVLGARGDGTPARFRVTLDGLPPGTDHGVDTDANG
FT                   MGTVTKDRLYQLVRQSAAVRARTFEIEFLDPGARAYVFTFG"
FT   sig_peptide     complement(81317..81436)
FT                   /locus_tag="Sala_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.839) with cleavage site probability 0.587 at
FT                   residue 40"
FT   gene            complement(81527..82579)
FT                   /locus_tag="Sala_0075"
FT   CDS_pept        complement(81527..82579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0075"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51801"
FT                   /db_xref="GOA:Q1GX21"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX21"
FT                   /protein_id="ABF51801.1"
FT                   /translation="MTDHSDTDRRLFLQTAGLGAAGMAMTALGLPGTSQAALLAPTRPM
FT                   AAGSSPTLGPLRQIRAGELDIAYIEMGPPKGQVAILLHGWPYDIHCYEEVAPLLAKAGY
FT                   RVIIPYLRGYGATRFVAADTLRNGQQAALAQDVIALMDALRIQTTTVAGCDWGARTACI
FT                   VAAIWPERVTALVSVSGYLIGSQQANVMPLPPKAELSWWYQFYFATDRGERGYEANRKE
FT                   FAKLIWHTASPEWKFDDATFDRSAQAFDNPDHVAIVIHNYRWRLGAAAGDPKYDALEKR
FT                   LAESPTIGVPTITLEGDANGAPHPDPAAYAKKFTGKYAHRNITGGIGHNLPQEAPKAFA
FT                   DAVLQAATPA"
FT   sig_peptide     complement(82469..82579)
FT                   /locus_tag="Sala_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.974 at
FT                   residue 37"
FT   gene            complement(82625..83080)
FT                   /locus_tag="Sala_0076"
FT   CDS_pept        complement(82625..83080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX20"
FT                   /protein_id="ABF51802.1"
FT                   /translation="MPRQMKYALALLVAFAFAAPASAQTARDIVGPAGVVPWSAPQLPA
FT                   RIIVDPPLPGPLARGQVFIQYRADNLRIQPVFGPNALDVSPRIGHIHVTVDRAPWHWAD
FT                   ASGEPVILVGLPPGPHEVEFILADANHMPLDRAVVAFTVPATTTPHH"
FT   sig_peptide     complement(83009..83080)
FT                   /locus_tag="Sala_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(83189..83740)
FT                   /locus_tag="Sala_0077"
FT   CDS_pept        complement(83189..83740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0077"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51803"
FT                   /db_xref="GOA:Q1GX19"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX19"
FT                   /protein_id="ABF51803.1"
FT                   /translation="MARPKSEQKRNAILAATTGLIAEQGLGAPTAEIAKQAGVPHGSVF
FT                   AYFNTKAELLRTLYVELSAEMTDTVMADMPGDESARDQFRHLWVRWTHWGASNPSKRRA
FT                   QAILKLSVERRQADDYASPVFKIIERASEHGTLGDGPPLYVIELVDAWVSTTIDFMIGH
FT                   PKEADEYCERGFNAMWHALN"
FT   sig_peptide     complement(83657..83740)
FT                   /locus_tag="Sala_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.795) with cleavage site probability 0.787 at
FT                   residue 28"
FT   gene            83846..84697
FT                   /locus_tag="Sala_0078"
FT   CDS_pept        83846..84697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0078"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51804"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX18"
FT                   /protein_id="ABF51804.1"
FT                   /translation="MTETYFVTGSSVGLGRSIVEAALAQGHNVVATARNPAVLEDLAAR
FT                   YSGQLLAVRLDVTDAEGARDAVRQAVDKFGRLDVLINNAGFSGVGSIEDMPLELIEAQL
FT                   STNFLGAVNLTRAVLPTMRARARGRILLVSSIGARIATAGAGVYYASKAAVSALAETLA
FT                   LEVGPLGIQVTAVEPGAMRTRFAEAGSLQVSPFGPAYEATVGTTIGMMQSPEYNNILRD
FT                   PDGVAAMILQVAALDDPPSRILAGADSFEMGIGSGDARRASDLHWEKLSRSATVEERLL
FT                   SA"
FT   gene            complement(84803..85024)
FT                   /locus_tag="Sala_0079"
FT   CDS_pept        complement(84803..85024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51805"
FT                   /db_xref="GOA:Q1GX17"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX17"
FT                   /protein_id="ABF51805.1"
FT                   /translation="MNTQLKRKIAFALLMGVVTTGIISFSLLAINFGFPTDFVAKWLRS
FT                   WAVAYAIVIPAILLISPRLQAQVDRVIH"
FT   sig_peptide     complement(84935..85024)
FT                   /locus_tag="Sala_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.783 at
FT                   residue 30"
FT   gene            complement(85075..85491)
FT                   /locus_tag="Sala_0080"
FT   CDS_pept        complement(85075..85491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0080"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51806"
FT                   /db_xref="GOA:Q1GX16"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX16"
FT                   /protein_id="ABF51806.1"
FT                   /translation="MSKPDKILYTAKTHTTGGRDGKSTSSDGRLDVKLSSPGGPGGGTN
FT                   PEQLFAAGWSACFEGAMGLAAKKLDVKLPADLAIDAEVDLGMTGDAYLLQARLNISLPG
FT                   VDKETARAIVDMAHQTCPYSKATRGNINVEINLV"
FT   gene            complement(85527..86873)
FT                   /locus_tag="Sala_0081"
FT   CDS_pept        complement(85527..86873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0081"
FT                   /product="Epoxide hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51807"
FT                   /db_xref="GOA:Q1GX15"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX15"
FT                   /protein_id="ABF51807.1"
FT                   /translation="MSPAKSISLRRLLSTAISVAALGMTLQSSPSFASSAGPSTAITVS
FT                   AAAAVAAPQDESIRPFHVSIPEEALTDLRRRLAETRWPDREKVSDASQGVQLDRLEPLV
FT                   RYWGTDYDWRKGEARLNAVPQFITTIDGLDIQFIHIRSKHKGAMPLLMTHGWPGSPFEL
FT                   LKTVGPLTDPTAHGGKAEDAFDLIMPTYPGYGFSGKPNEAWDPARVARAWDVLMKRLGY
FT                   KNYVSQGGDWGAIISQVLAVQAPEGLLGIHTNMPGTVPPGVLKLVRAKQPAPDSYSPEE
FT                   KIAYAGLETFYGKGFGYAEMMNTRPQTLGYGLSDSPVGLAAFLYEKIATWTDSGGNPES
FT                   VLTRDEILDNITLYWLTNTGTSSSRSYWDAAQGPGGPFNAIEISKVPVAVTVFPGEIYR
FT                   APRSWGEKSFKKLIYWNEVDKGGHFAAWEQPELFAAEIRAAFRPLREKK"
FT   sig_peptide     complement(86772..86873)
FT                   /locus_tag="Sala_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.812 at
FT                   residue 34"
FT   gene            complement(86908..87717)
FT                   /locus_tag="Sala_0082"
FT   CDS_pept        complement(86908..87717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0082"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51808"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX14"
FT                   /protein_id="ABF51808.1"
FT                   /translation="MNEAKGTALITGGSTGIGAIYADRLARQGYDLILVARNAAKLDQV
FT                   AATIRTATGRNVDTVPADLSNPGELRLIEARLINDRRITMLVNNAGIGAPVPTWQADID
FT                   QMESMIDINATALARLTYAVAQRFAAAGNGTIINIASTVAIAPEFMLNGVYGATKAFVV
FT                   ALTASLHAELADKGVRVQVVLPGATATEFWDLSGVPLSGVPAEIVMSADAMVDAALAGL
FT                   ELGETVTIPALPDAAEWTAFEAARTAMLPNLSLTNPADRYRAVAAAA"
FT   gene            complement(87851..88753)
FT                   /locus_tag="Sala_0083"
FT   CDS_pept        complement(87851..88753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0083"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51809"
FT                   /db_xref="GOA:Q1GX13"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX13"
FT                   /protein_id="ABF51809.1"
FT                   /translation="MDRLDAMRVLLAVVDAGSLSAGSRALGSPLPSVSRKVAELERYLG
FT                   TNLLVRTSRNIQLTDAGRDYVEAARRIIADLEETERRASGEYQTPRGELSITMPIEFGV
FT                   RHVIPIALAFIDEYPEVTLNLITSDRLVHMVDEHVDVAIRLGHLPDSALFAVKAGEFRL
FT                   IACASPAYLDRRGAPTSPRELSGHDGIMFGPLPMFWGYRIDGEDVMCTPRPRVSVNSAA
FT                   GNLAAVLSGVGVARLFDYQVSEHLQSGALVRILPDADGEPRPVHIVYPRQGLLPLKVRA
FT                   FIDWASPRLRASCTGLDCG"
FT   gene            complement(89025..89618)
FT                   /locus_tag="Sala_0084"
FT   CDS_pept        complement(89025..89618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0084"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51810"
FT                   /db_xref="GOA:Q1GX12"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX12"
FT                   /protein_id="ABF51810.1"
FT                   /translation="MVTTNRSRTRGRPRKFDPEAAVATAQQLFHERGYDAVSVADVTDA
FT                   LGINPPSFYAAFGSKAGLYQRVLDYWTDTEAIPLADILRPDVPVADAVAAMLEEAARRY
FT                   AFNPAAGGCLVLEGTRCNDDDAREAARALNLGAETFIHDYIAARHPEAADQVTDFVATT
FT                   MSGLSAKARSGHDLSRLLATARLAGSVLTQVLPA"
FT   gene            89692..90405
FT                   /locus_tag="Sala_0085"
FT   CDS_pept        89692..90405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0085"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51811"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX11"
FT                   /protein_id="ABF51811.1"
FT                   /translation="MSNFQGKSVLVLGGSRGIGAAIVRRFASDGAKVVFTYNGSREAAE
FT                   QLATETGTSAVATDSGDRDAVIARVRESGPLDILVVNAGFALFGDALDLDPDDVDRLIR
FT                   VNVTAPYHASVEAARQMPDGGRIIVIGSVNGDRMPLPGMASYALSKSALQGMARGLARD
FT                   FGPRGITINIVQPGPIDTDANPEDGPMRELMHSFMAIKRHGRPEEVAGMVAWLAGPEAG
FT                   FVTGAMHTIDGAFGA"
FT   gene            complement(90499..90834)
FT                   /locus_tag="Sala_0086"
FT   CDS_pept        complement(90499..90834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX10"
FT                   /protein_id="ABF51812.1"
FT                   /translation="MPRNVAGLLPERRLDRADRAKTTDHPPPASKNHVEAIEVESERHP
FT                   DKRDPSEDQQSRAELHSPSALVPDTQQEMPECCREQVAADPLFRVDSRIEHLFRPHGIE
FT                   PLDGHIC"
FT   gene            complement(90958..91749)
FT                   /locus_tag="Sala_0087"
FT   CDS_pept        complement(90958..91749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51813"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX09"
FT                   /protein_id="ABF51813.1"
FT                   /translation="MDIAAIGLIEDEDILLDLASLALSQLDHENADIAHYLDMLEDIED
FT                   RVCAEGRSAFLPEERAAALSRVLHGELGFVGDDETYDAPVNADFIRVLDRKRGLPIALS
FT                   ILYVAMARRTGWSAYVLNLPGKVLVQLGEKNPVVLDPFAGGAVLSAGQVAAVYRASLGQ
FT                   EGGAAALSAVRMSNRDVLARLLNNQGIRAEQEKDHQRGLAIYQRITRVAPRRLEAWQNL
FT                   ARLQLQSRDVEGAKASLFAMSEVAPDRRTRDRIMEAFEALT"
FT   gene            complement(91752..92687)
FT                   /locus_tag="Sala_0088"
FT   CDS_pept        complement(91752..92687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51814"
FT                   /db_xref="GOA:Q1GX08"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX08"
FT                   /protein_id="ABF51814.1"
FT                   /translation="MQQNLVSLREHRELGDVAWLRDLDAGLAVAAEQRKPVLLLFQEVP
FT                   GCSTCVRFGQDVLTHPLMVELIADRFVPVAIFNNRPGADAEILRRFDEPSWNNPVVRFL
FT                   GPDGAELLPKLADRYDAPALHQKIVAVLELLGGDVPGYFRLLGRDLLIENGLSKSATYT
FT                   TPCFWSGETSLAQHPAVITTDAGWIDGEEVVQVHFDPRAAARSELDAYAHEEGFGAIDS
FT                   GGFALDGEPQFYLRKNAARHLPLTPAQRTQINLAIPYRTPLADFLSPQQCAWLANPRLE
FT                   APGENEAYRKDIRESRPVLAQRLGLVEKET"
FT   gene            93158..93844
FT                   /locus_tag="Sala_0089"
FT   CDS_pept        93158..93844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0089"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51815"
FT                   /db_xref="GOA:Q1GX07"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GX07"
FT                   /protein_id="ABF51815.1"
FT                   /translation="MSNFVAEKSIAAVRAVDEVRDGMLVGLGTGSTAAYAVKSLSERIK
FT                   HGLRITAVATSQATEALALRLAVPLVPFQQLSAVDLTIDGADEIDDRFQAIKGGGGALL
FT                   REKITESASTRVIIIADSSKLVAQLGKFPLPVEVVPFATEFVRARLSALGARVTVREAG
FT                   GTPFLTDQGNYILDAALDEIPRPREIAAAITTIPGVLEHGLFLDEIDTIMIARGDMVEV
FT                   RHRGEA"
FT   gene            94088..94663
FT                   /locus_tag="Sala_0090"
FT   CDS_pept        94088..94663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0090"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51816"
FT                   /db_xref="GOA:Q1GX06"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX06"
FT                   /protein_id="ABF51816.1"
FT                   /translation="MLSMPRAHIDAPMDGPRDRNIFGAFALMISDDIVRASSSRAPEAG
FT                   PAASALALLAHQPGLSIRMLAVGVGLSHAGTVRLVDRLATEGLIERREHSSDGRTRALY
FT                   LTPTGKIASDEVLASRDEVIAEGLSILKPDELKILCDMAERVLRDRLENLEHSYRICRL
FT                   CCYEGCTNCPIDAELHERGVERGKSGDG"
FT   gene            complement(94707..95270)
FT                   /locus_tag="Sala_0091"
FT   CDS_pept        complement(94707..95270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0091"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51817"
FT                   /db_xref="GOA:Q1GX05"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX05"
FT                   /protein_id="ABF51817.1"
FT                   /translation="MRADVTNALTRSFFEEWARTGYAGLSLERVARTAGVGKAALYRRW
FT                   PDKVSMASDLLSHVGLTMTDVEEHGSLEADLQAVLLAIRRVLRHPKVRRILTDLHGEIE
FT                   RTPALEMAIRPFQRARRERINGLINRAIKRREVSPLVDREMAADLIAAPLYWRIAVLGG
FT                   RSDRAYIKRLALVTGAALRASAPS"
FT   gene            95423..95848
FT                   /locus_tag="Sala_0092"
FT   CDS_pept        95423..95848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51818"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX04"
FT                   /protein_id="ABF51818.1"
FT                   /translation="MLRKALGDRLAPDAATFLDMVAENGVMEFPYSPPGLPTRLVGKAA
FT                   IARHLESLGDMIAFDRMGEPTIHATTDPDVTIVEFEGFGSGVATGESYDQRYISVIRTD
FT                   AGRIMHYRDYWNPLVALRALRGSAVVDALVGGASDHG"
FT   gene            95841..96686
FT                   /locus_tag="Sala_0093"
FT   CDS_pept        95841..96686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0093"
FT                   /product="NmrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51819"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX03"
FT                   /protein_id="ABF51819.1"
FT                   /translation="MVDRVLVTGGTGKTGALVAQQLTARGVEPRIATRNATMPEQVRFE
FT                   WGDVASHRTALDGVDAIYLVAPTDRTDHLTVMRPLLEQAVAQGVAQLVLLSASSIDEGG
FT                   PMMGEVHGWLNANAPRWTILRPSWFMQNFVTQHLPSIINEGCIYSATKHGRIPFIDAAD
FT                   IAAVAVEALVDPVFGSGERILTGPEALSYDEVADRITAVAQRPVHHCRLSVEQLARRYA
FT                   GFGIPEGYADTLARMDDAISYGSEDRTTTEVEQITGRMPTKLTAFLAAHREAYQGRQSG
FT                   "
FT   gene            96726..97007
FT                   /locus_tag="Sala_0094"
FT   CDS_pept        96726..97007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51820"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX02"
FT                   /protein_id="ABF51820.1"
FT                   /translation="MVAGRQPGADTIFVGHCHGHPYGEIDLVIPVDDAVELAGPGDWQG
FT                   LGWVCAARDTLHFLKVRNGALMTLNYMPAGRILYQFDPAEIRARRGGA"
FT   gene            97276..98235
FT                   /locus_tag="Sala_0095"
FT   CDS_pept        97276..98235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51821"
FT                   /db_xref="GOA:Q1GX01"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX01"
FT                   /protein_id="ABF51821.1"
FT                   /translation="MRRAYLFRLSQERGLSEEASVRRMDRRTMELNQVSYFINLAKTLN
FT                   FTAAARLSGVSQPSLTRAIRRLEEELGGPLIHRDGKNSRLTGLGRDVETEFRRMLVAMR
FT                   SVRNHSENWAMGMHRVLDVAVAPTVGPQEFAAFFESALAEVPSIEIKLHSLQPNEDTSD
FT                   ILSGKYHACIMPRETRPEPKLDVHPLFRERFVLGCSASHPLASREIVRGEDLLEFPFVD
FT                   RLKCEFRDQILDHFARHDLLMQPRFRSDREDWVQHFVADGTAICILPERSATAPGLVTR
FT                   PIEGFALEREVVIATVSGSTAPVEIRKIAQLAAGYAWH"
FT   gene            98380..99364
FT                   /pseudo
FT                   /locus_tag="Sala_0096"
FT   gene            99504..100208
FT                   /locus_tag="Sala_0097"
FT   CDS_pept        99504..100208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0097"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51822"
FT                   /db_xref="GOA:Q1GX00"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GX00"
FT                   /protein_id="ABF51822.1"
FT                   /translation="MPDLSTFPITQRWPALHPDRLQLYAAPTPNGVKVSIMLEETGLAY
FT                   EPHLVDISNNESKDPAFVSLNPNGRIPAIIDPAGPDGNPIAIWESGAILLYLADKTGQL
FT                   NSSAPAQRYETLAWVFFQVSGVGPTFGQLGFFLKFAGKDYEDKRPRQRFIDESKRLLGV
FT                   LDRQLEGREWLVDDYSIADIATLGWVNALAEVYAAGDILGLGEYSNVQTWLRRGLARPA
FT                   VQRGLRIPARPA"
FT   gene            100205..101173
FT                   /locus_tag="Sala_0098"
FT   CDS_pept        100205..101173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0098"
FT                   /product="Mg2+ transporter protein, CorA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51823"
FT                   /db_xref="GOA:Q1GWZ9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ9"
FT                   /protein_id="ABF51823.1"
FT                   /translation="MSVIAAYYYNKGLRVREIAIDEQVQLDKDRSGFCWIALREPTADE
FT                   LKAIQTTYNLHPLAIDNAMHPLCPPKLEAYNEELYVVAQTAELDGDQIRYGKMAIFTGH
FT                   NHLISVRHGNGGALGNLREQLEASPALFGKGVDYVLHAILHRIVDQYLPIFEMIEDDVL
FT                   AMERRSLDDFLGRAEIDRIFGLRSELTRFQRTLGAMAELVRKLVRGHFPCISSEVRPYF
FT                   SDVADHVARVQTMVDGLLQVLSTVFEFSSLLEAQRTGVTTRQLAAWAAILAVPTAIAGI
FT                   YGMNFRNMPELDTVYGYFVVLGLMTMFCLYLFVRFKKAKWI"
FT   gene            101270..101842
FT                   /locus_tag="Sala_0099"
FT   CDS_pept        101270..101842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51824"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ8"
FT                   /protein_id="ABF51824.1"
FT                   /translation="MTSQVTDVLAAVQSFVAKGYDREYRVKDGHLIDLELGSTLDPCAI
FT                   TVDAALRLESGDDGEDASNIYAITDPATNHKGLLIDAFDVFDEICHRDLSERLVADRQT
FT                   TPAGDEDVPSKHGLRKVYKNEFERDPERYVLREGFPDFPPCPFGGAFSILGFDTAEQSY
FT                   VWLVTSIIRDSRLIRAPYQGDDAPGDE"
FT   gene            101928..102380
FT                   /locus_tag="Sala_0100"
FT   CDS_pept        101928..102380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51825"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ7"
FT                   /protein_id="ABF51825.1"
FT                   /translation="MMNWNKSHIRETMLSLETAALHSARTNYLDYVSIAQLDRSEPIEN
FT                   DEQAQAEVASDLAEALDDTLHDYADKLEKLRTIDFGPKSAVEEGAVIKLSGRHFVIAVS
FT                   TSKFTCDGREFMGISTMAPIFEAIEGARTGETVQFNGRDLIVEDVE"
FT   gene            complement(102403..103683)
FT                   /locus_tag="Sala_0101"
FT   CDS_pept        complement(102403..103683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0101"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51826"
FT                   /db_xref="GOA:Q1GWZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ6"
FT                   /protein_id="ABF51826.1"
FT                   /translation="MSPAMDSMRSAGRRGLKLAPVAALLASVAALLLGNGLLGTLLIVR
FT                   AGQEGFSSGAISAMMSFYFAGFTIGALMLPRIIVAVGHVRTFAGFAAIASMTALLHVAL
FT                   VEPIAWIPLRLITGFAYAGMILATESWLNAHAVPSTRGQLLSIFGVVSMGSWAIGQALL
FT                   NVAPPADMTLFLIVSLLISAAVVPITLLPSHPPAQVTQERVAFSDLVRASPLAAAGAFL
FT                   AGLAIGGFWGMGPNFAQRIGLDVGGISAFMAAVLGGTLLLQWPLGWLSDRVSRNLVIAA
FT                   AALASAAAAVGVALAVGAPLPLLLAAGALFGGFGIPIYSLCLAVANDDLPAGRLLGTAR
FT                   GLLLLNGIGTAAGPLIGGAAMTIAGPGGLFLYAAALLAILAVLAIGSSQPRRRIHAKAA
FT                   RSPSTPMITGSLDVMICMESETEAARH"
FT   sig_peptide     complement(103579..103683)
FT                   /locus_tag="Sala_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.622) with cleavage site probability 0.209 at
FT                   residue 35"
FT   gene            complement(103680..103928)
FT                   /locus_tag="Sala_0102"
FT   CDS_pept        complement(103680..103928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51827"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ5"
FT                   /protein_id="ABF51827.1"
FT                   /translation="MRPWLFLTASHLAMLGIGFAAGIYTLPILTAARPPKPAAYQAIVD
FT                   VPVGIDVRDYNTVVIWCEAFDQFISAAAYRPSRQALK"
FT   sig_peptide     complement(103866..103928)
FT                   /locus_tag="Sala_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.860) with cleavage site probability 0.568 at
FT                   residue 21"
FT   gene            complement(103932..104402)
FT                   /locus_tag="Sala_0103"
FT   CDS_pept        complement(103932..104402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51828"
FT                   /db_xref="GOA:Q1GWZ4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ4"
FT                   /protein_id="ABF51828.1"
FT                   /translation="MSMLEPQAPDLRVQKWIGADGESTGPLKLSDLGSGPKILFAFQHW
FT                   CRGCHVHGFPTLQRLHSALSPRGVGFAVIQTVFEGADENTFEKLRVNQLEYALPVAFGH
FT                   DEPLVGATLPTFMEDYRTRGTPWFSIIDAGGRIVFSDFHLDADRIVKDLELV"
FT   gene            complement(104452..104742)
FT                   /locus_tag="Sala_0104"
FT   CDS_pept        complement(104452..104742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51829"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ3"
FT                   /protein_id="ABF51829.1"
FT                   /translation="MIEAEARIATIESSRYLTRLAEAWVHTYPVRYDALTAEIQLPGGE
FT                   LILTADGDSLSLRLVGKDRERFDATKQSVATLVDRVAEHDTGVRCVWNDIS"
FT   gene            complement(104813..105145)
FT                   /locus_tag="Sala_0105"
FT   CDS_pept        complement(104813..105145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0105"
FT                   /product="protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51830"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ2"
FT                   /protein_id="ABF51830.1"
FT                   /translation="MAMAGRSHLAKDLMMEAFVVFTREDTTDVDELAAYSARVGPSFDG
FT                   HDVTFLAAYGAMENLEGSPIEGAVILRFPTMQAAHDWYHSPAYQAVAAHRFAGARYRGF
FT                   IVEGLR"
FT   gene            complement(105166..105597)
FT                   /locus_tag="Sala_0106"
FT   CDS_pept        complement(105166..105597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0106"
FT                   /product="protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51831"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ1"
FT                   /protein_id="ABF51831.1"
FT                   /translation="MTKSIATASINRETAVALIDAAITAARAIGIPAAVAVVDATGYLR
FT                   AFERTDDAPFLTVDVAIDKAWSSASFGYPTHVWNDYVSNDPKVAPLAYRPRMVAVGGGY
FT                   PILEDGKLIGGIGISGGTYQQDQDACVEALQKIGFELPA"
FT   gene            complement(105651..106676)
FT                   /locus_tag="Sala_0107"
FT   CDS_pept        complement(105651..106676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0107"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51832"
FT                   /db_xref="GOA:Q1GWZ0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWZ0"
FT                   /protein_id="ABF51832.1"
FT                   /translation="METLMKAVGYKVPGPIAEDAALVDIELPQPVAAGYDILVEVKAVS
FT                   VNPVDYKVRGSSPPADGEWKVLGWDASGIVREVGPDVTQFQPGDEVYYAGSITRPGTNV
FT                   EFHLVDARIVGRKPASLDWAEAAALPLTTLTAWEAMFDRLDVAKPVPGAAPAILIIGGA
FT                   GGVGSIAIQIARQRTDLTVITTASRAETQEWVKELGAHHVIDHRRPLAAQIAELGIGAP
FT                   AFVFSTTHTEQHAADIAELIAPQGRFALIDDPTAFDIMLFKRKAVSIHHELMFTRSIYG
FT                   TPDMHEQGKILDALAVLVDEGKIRTTLTERLSPINAANLKTVHALIESGAAKGKTVLEG
FT                   F"
FT   gene            107168..107773
FT                   /locus_tag="Sala_0108"
FT   CDS_pept        107168..107773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0108"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51833"
FT                   /db_xref="GOA:Q1GWY9"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY9"
FT                   /protein_id="ABF51833.1"
FT                   /translation="MVTRGFTGRGSSGDQSGRIPPGQHLVENFPVLTAGPTPNVELADW
FT                   KFTVKVGPKPVKVWNWSEFNALPKTKVTKDIHCVTSWSKLDTIWEGVLIEDILADAGLD
FT                   RPTDFVLAHSYDDYSTNVPLADLLSGKAMVALKFAGQPITRDHGGPARLLVPHLYFWKS
FT                   AKWVKALQFTTRDEAGFWELRGYHIYGDPWREQRYTDD"
FT   gene            107862..108512
FT                   /locus_tag="Sala_0109"
FT   CDS_pept        107862..108512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0109"
FT                   /product="Oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51834"
FT                   /db_xref="GOA:Q1GWY8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY8"
FT                   /protein_id="ABF51834.1"
FT                   /translation="MSRPFAHIAGQHVDVRLTAPDGYSAMRSYSIASSAASSPIIELAV
FT                   ERLPDGEVSAYFHDIAIVGDEIELRGPLGGHFLWPEPAVDAVLLIGAGSGLVPLMAMIR
FT                   HRRTQDPAVPTALLLSARTAEDVLFSEELHSVEINDAAFVLALAITREDPIRASDFGRR
FT                   IDSAMVEEVLARLHRKPTQIFVCGSNDFVNIATEGALLAGVDPSIIKTERYGG"
FT   gene            108571..109836
FT                   /locus_tag="Sala_0110"
FT   CDS_pept        108571..109836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0110"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51835"
FT                   /db_xref="GOA:Q1GWY7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY7"
FT                   /protein_id="ABF51835.1"
FT                   /translation="MSRFAEPVFVAAGLRTPFGRGGGALAAYDAVSLSVPLVQAMAAQA
FT                   EPDLLIWGTVIPNLGWSNIARETWLDAKLNPNVPAFSVVLACSTSMTATFAAAGMLGGG
FT                   TDLTMVGGAEVMSRPPIALTADASKRLTDLFAQDPAAALAALQSLALHDYVLPTKGWAN
FT                   RITGRTMGDHMEDTAKAWRISREAQDDWALKSHQRSVAGWERGFFDDLAISLPELARDA
FT                   NPRADTSPERLAALKPVFDRDSGRGTLTAGNSSPITDGAAGCWVANEAGVARLPAGTPY
FT                   ARLIDYEVSAVDFHTEGLLMAPSYGIPRLLARHQLSFSDIALWEIHEAFAAQVLANVAA
FT                   ITDREWVRETAGVQSDLGDFDWDRVNPNGGSVAIGHPFGATGARDLSQAVKELWDMPSG
FT                   SRAIVSICADGGQGTVALLERP"
FT   gene            109889..110170
FT                   /locus_tag="Sala_0111"
FT   CDS_pept        109889..110170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0111"
FT                   /product="protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51836"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY6"
FT                   /protein_id="ABF51836.1"
FT                   /translation="MVSAVWNDTTIAASDETIVVEGNHYFPPSAVNQELLEASAHTSVC
FT                   PIKGTARYFHIRVGSALNADAAWSYPDPNPVAEAIRDHIAFWKGVEVG"
FT   gene            110198..111940
FT                   /locus_tag="Sala_0112"
FT   CDS_pept        110198..111940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0112"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51837"
FT                   /db_xref="GOA:Q1GWY5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY5"
FT                   /protein_id="ABF51837.1"
FT                   /translation="MAVSLHARILDHLARVIGDLQVAGDVPAGLDRAGLTVERPHDPAH
FT                   GDLSTNAAMVLAKLTGTHPRQLAEKLAGRLAMLEDVADVAVAGPGFVNIRLTDQAWQNE
FT                   LAVIADQKDRYGMSPVGAGKTVNIEFVSANPTGPMHMGHCRGAVVGDALANLLAFTGHR
FT                   VIREYYINDAGGQVDILARSAHQRYREALGESLGEIAEGLYPGDYLKPVGEALAADFGG
FT                   RYADAPETDWLAIFRARTVAAMMETIREDLALLGISHDRFASEADLVAAGKPDDAEAWL
FT                   RERDLVYDGVLEPPKGEVSKDWEPIALPLFRSTKFGDDQDRPIRKPDGSWTYFGVDLAY
FT                   HFEKARDADELIDIWGADHAGTVMRIVAAAEALTEGRKRFDVKLVQIVRLLRAGEPVKM
FT                   SKRAGNFVTLADVIREVGKDVVRFMMLTRKAEASMDFDFATVVEASKDNPVFYVQYAHA
FT                   RICSLASRAAEAGIELGDPPDLALLDGPSLTLVKRAAEFPRIVEAAAAAREPHRIAFFL
FT                   EGLAAEFHALWNTGNADPTRRFAYPENLPVSRARLFLAAAIGQVIRNGLALMGVEPTHE
FT                   MERA"
FT   gene            112032..112295
FT                   /locus_tag="Sala_0113"
FT   CDS_pept        112032..112295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51838"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY4"
FT                   /protein_id="ABF51838.1"
FT                   /translation="MELTDFDAAFKRLPEGHSEGIHEGRRFGLIVRRSDDGRRNSLFAR
FT                   ELAGTDIVSFNLYRFTSGKTSLKPCEMSAKKVVDFVLGFQPD"
FT   gene            112555..113532
FT                   /locus_tag="Sala_0114"
FT   CDS_pept        112555..113532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0114"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51839"
FT                   /db_xref="GOA:Q1GWY3"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY3"
FT                   /protein_id="ABF51839.1"
FT                   /translation="MRLAMIGLGRMGANIARRLMRGGHEVVAFNRDPAAVTQLAGEGAI
FT                   GANSLEDVVAKLTAPRIFWVMLPAGAPTQDTVDKLMELSEPGDIIIDGGNSFYKDDIKC
FT                   GAAARDKGLHYIDVGTSGGIWGLERGYCMMIGGDKEIVDLLDPIFDTLAPGYGSIVRTI
FT                   GRDAPDSRAERGYIHAGPTGAGHFVKMVHNGIEYGLMQAYAEGFDILKGKSSERLEPDE
FT                   RFDINLTDVAEVWRRGSVISSWLLDLCAIGLARDPMLEQFTGQVSDSGEGRWTIDAAME
FT                   EAVPAYVLSAALFARYRSRVDHTFGDKLLSAMRFGFGGHVEMPQ"
FT   gene            113771..114109
FT                   /locus_tag="Sala_0115"
FT   CDS_pept        113771..114109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51840"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY2"
FT                   /protein_id="ABF51840.1"
FT                   /translation="MLHLIEPEILPSGAFIFTPMELTVIALARSEKGQRFGSRAGLAQA
FT                   LFKKHQLLPGRRANGTLADPRLEILRAFVNLLHRRGQRLAAATQTLREAGFSSVQETWL
FT                   RSECARPL"
FT   gene            114425..115027
FT                   /locus_tag="Sala_0117"
FT   CDS_pept        114425..115027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0117"
FT                   /product="Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51841"
FT                   /db_xref="GOA:Q1GWY1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY1"
FT                   /protein_id="ABF51841.1"
FT                   /translation="MAKIGFGGGCHWCTEGVFQALRGVAQVDQGFVQSDAPADSWSEGV
FT                   IVTFDPSIIPLATLCEVHLRTHSATRARSPSDKYRSAIYIFDDNQRHEAELAIVRFAEE
FT                   FGNTAHTLVLPFRSFKASDERYQNYYRTDPSRPFCRRFIDPKLDYIRQHFSEVALPEPN
FT                   SVAEHAVDRDNVSQDPASAGIMTDSSSSIATQSRTSP"
FT   gene            115024..116043
FT                   /locus_tag="Sala_0118"
FT   CDS_pept        115024..116043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0118"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51842"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR039344"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWY0"
FT                   /protein_id="ABF51842.1"
FT                   /translation="MMIKKPFTILPLALALLGPISSSPGLAAPTPAAVPDTIAGTVRQT
FT                   APAIYRFTIGDAQITALSDGSVPLDLHQLLRGVSAQTIDEILARSFLANPAEASINAYL
FT                   IDFNGRRILVDVGAGDLFGLGNGGRLLEALAAAGAAPETITDILITHVHSDHSGGLTKA
FT                   GKIVFPRATVYAGGADIRFFSDVANAAKSGIDKRFWTQTEQTLTPYVTAGRVKPIDTDG
FT                   EVVPGIRAELQPGHTPGTAFYTLTSKGQSIVFVGDVIHAGAVQFPRPDVTITFDVRQDE
FT                   ARAVRKAAFTRFARDRMMIAAPHLPFPGVGHIAADGSGYRWYPIEQTDREPMKERLKL"
FT   sig_peptide     115024..115107
FT                   /locus_tag="Sala_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            116111..116647
FT                   /locus_tag="Sala_0119"
FT   CDS_pept        116111..116647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0119"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51843"
FT                   /db_xref="GOA:Q1GWX9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX9"
FT                   /protein_id="ABF51843.1"
FT                   /translation="MRLTKDASPSDRLINLFGALAQGVSDEMRGAISQRFPAGGETAAA
FT                   LSLIGHEPGLSIDQIGKALRLSHAGAARVVERLVAQNFVSKSQSPGDRRVMHVSLTSGG
FT                   ETERRALLNLRSTAITGLLAAVGEKDRAALERVAETILASLPRDEVRARTTCRFCDEEK
FT                   CTNCPTDIVGPGITN"
FT   gene            116689..117183
FT                   /locus_tag="Sala_0120"
FT   CDS_pept        116689..117183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0120"
FT                   /product="protein of unknown function DUF417"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51844"
FT                   /db_xref="GOA:Q1GWX8"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX8"
FT                   /protein_id="ABF51844.1"
FT                   /translation="MSLLEKYSFSVPEHQMRELALLRWALVIVFLWFGGMKFTAYEAQG
FT                   IAPFIEHSPLMSWLHPLFGVQGASQFIGTMELATAAALILGAFKPIFSVLGGAMSVATY
FT                   TITLTFFLSTPGVAEPTAGGFPAISAIPGQFLLKDAVLLAASLVLLSAAIRRKKPADAQ
FT                   V"
FT   gene            complement(117462..118886)
FT                   /locus_tag="Sala_0121"
FT   CDS_pept        complement(117462..118886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0121"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51845"
FT                   /db_xref="GOA:Q1GWX7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX7"
FT                   /protein_id="ABF51845.1"
FT                   /translation="MTDFDYDVAIIGAGTAGMSAYREALKYSDRVVMIDGGPLGTTCAR
FT                   VGCMPSKLLIAAAEARHRAESVGLFGLRAGPVEVDGVQVMNRVRAERDHFVSFATEAIA
FT                   GFAPGGLLREQARFVDDNRLELASGKQISARSIVIATGSRPVVPAGLEPAGDRLIFNDQ
FT                   LFDWTDLPSSVAVFGTGAIGLELGQALHRLGVRTHIYGRGGSVGPLTDPDVAAYAAAQF
FT                   SSEIPIDWMAADASVARDGDAVIVRSAGGEERFDYLLAAAGRRANVDNLGLENTSLTLD
FT                   AHGVPTYDHLSMRASYSDIFIAGDSAVDLSLLHEAADEGRVAGENAARYPHSYRRARRT
FT                   PLTIVFTDPQIAIAGRSHADLLRDRMDFAIGEVSFEDQGRARILGLNRGLLRVYGDRPS
FT                   GLLLGAEIFGPAAEHLAHLLAWSIESRLTVAELLERPFYHPVIEEGLRTALRHLNHHLG
FT                   FGPNPPLRCIDCGPGG"
FT   gene            complement(118968..119867)
FT                   /locus_tag="Sala_0122"
FT   CDS_pept        complement(118968..119867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51846"
FT                   /db_xref="GOA:Q1GWX6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX6"
FT                   /protein_id="ABF51846.1"
FT                   /translation="MVVAAQDLVVRRRPDKFIGFATAACWSGLLLVPLAWTAPAVFHLS
FT                   PGYDQLIQAFLFGCLYGIGAWANQACGFGTLAHLTGGRLGYLLTLAGWVIGASFISKVY
FT                   RPQQIPEPSLLATSPLAAIAAWLAFAAVCWWSWPRLRLLRRRSRWRKMLLGRARMRPFE
FT                   AMLIIGIGGGLLYACAGSWTYLGLLSSYASQLVMHDFAPISPLPALLGTAMMIGGGLFA
FT                   AVRSASFRLRGTNWRQGSRHLVGGTIMGLATQLIPGGNGVIIVYGLPSFAPHALTAYFG
FT                   MTLTLMLIFAATNYSRRA"
FT   gene            complement(119945..120850)
FT                   /locus_tag="Sala_0123"
FT   CDS_pept        complement(119945..120850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0123"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51847"
FT                   /db_xref="GOA:Q1GWX5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX5"
FT                   /protein_id="ABF51847.1"
FT                   /translation="MDRLAVMEQFLAVAEAGSFSAAARRLNVGQPSISKAVAQLEAYLG
FT                   VRLFQRSTRSLTLTEAGRRYRDGAERAIAAAAAAEIAAKEDGGRLAGPVRVVVPTCLAR
FT                   LHLVPRLREFSDRFPEVTLDLEITDRETDVVASGVDIALRIGTLADTALVASRMARTRM
FT                   ALVANKAENGLDAPHNFMGQPAIISRLHHAKNSWVFRHGSARIAIMVHPALILDSDDAA
FT                   RSAALAGLGYAMLPRPFVADLIDTGDLVELLPNHMLEDIDLWALLPAGRDQTARVRAFL
FT                   DWLRPQMNAIFADERPGLLS"
FT   gene            121243..121896
FT                   /locus_tag="Sala_0124"
FT   CDS_pept        121243..121896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0124"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51848"
FT                   /db_xref="GOA:Q1GWX4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX4"
FT                   /protein_id="ABF51848.1"
FT                   /translation="MQKSRMNFRTDMSMIEQAYFQAAGDEGRVAIAEGDRQILAMGIEV
FT                   SAVQAGDVAPEFLLENALGGTVSLRGRLIGGPVVLSFFRGGWCPFCRAELRAMSKAAQA
FT                   VEDRGASLLAISPQPLADSIAMARAEEMTLPLLADRGMTVASDYGLAFELPESMRRAAL
FT                   ADGMVAGDDGADWRIPMPATYVISTDGIIRYSFLDPNYRNRLDPAVLMSILDRL"
FT   gene            121993..122436
FT                   /locus_tag="Sala_0125"
FT   CDS_pept        121993..122436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0125"
FT                   /product="Protein-methionine-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51849"
FT                   /db_xref="GOA:Q1GWX3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX3"
FT                   /protein_id="ABF51849.1"
FT                   /translation="MTYLKTSEAIAKLTPQQRHVTQEGGTERAGSGELLHNKEPGIYVD
FT                   IVSGEPLFASTDKFDSGSGWPSFTKPIVPANVDEIRDDSYGMIRTEVRSAHGDSHLGHV
FT                   FPDGPRDRGGQRYCINSASLRFVHRDDMEAEGYSEFLNQIEEN"
FT   gene            122439..122954
FT                   /locus_tag="Sala_0126"
FT   CDS_pept        122439..122954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0126"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51850"
FT                   /db_xref="GOA:Q1GWX2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX2"
FT                   /protein_id="ABF51850.1"
FT                   /translation="MTERSILAGGCFWGMQDLIRKLPGVVSTRVGYSGGDVPNATYRNH
FT                   GTHAEAIEINFDPDQISYRRILEFFFQIHDPTTRNRQGNDRGGSYRSAIYYADEAQRET
FT                   ALQTIADVNASGLWPGKVASELEPIGPFWEAEPEHQDYLERRPNGYTCHFPRAAWVLPS
FT                   AGERSEAA"
FT   gene            122968..123243
FT                   /locus_tag="Sala_0127"
FT   CDS_pept        122968..123243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0127"
FT                   /product="Glutaredoxin, GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51851"
FT                   /db_xref="GOA:Q1GWX1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX1"
FT                   /protein_id="ABF51851.1"
FT                   /translation="MKPNITLYTKDYCPFCHRAKAHLRAKGVTDWIEIDVEDDPVQFRA
FT                   MQTASGGRRTVPQIFINGTHVGGSDDLVALDADGGLDLLLREKMLV"
FT   gene            complement(123317..124228)
FT                   /locus_tag="Sala_0128"
FT   CDS_pept        complement(123317..124228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0128"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51852"
FT                   /db_xref="GOA:Q1GWX0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWX0"
FT                   /protein_id="ABF51852.1"
FT                   /translation="MGPHSERKEQRLLLFSATGTLALSLVGIAIGLLSGAKSILFDGVY
FT                   SLADAGLTLAAFFAARLIARGADRRFQYGYWHIEPMLGFVNGSVLLLACAYALIDGVDT
FT                   VMMGGRNVSFGPGIGYAGASALIGFGMYIYIRRRARGLGSSLLNIDAAAWLFGALLNAG
FT                   LSAAFVTAVVLEGTQAEKLSAYFDPAILILLAIFLAPLPLRALAAAGREILQIAPADLD
FT                   AQVSSIAREVAARHGFVEHQSYVTQVGRAGFIEIGFVGAAASTTMTLGEQDAIRQEFAD
FT                   AMGGLRPGYWLTIDFTADRRWL"
FT   sig_peptide     complement(124118..124228)
FT                   /locus_tag="Sala_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.636) with cleavage site probability 0.304 at
FT                   residue 37"
FT   gene            complement(124375..125004)
FT                   /locus_tag="Sala_0129"
FT   CDS_pept        complement(124375..125004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0129"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51853"
FT                   /db_xref="GOA:Q1GWW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW9"
FT                   /protein_id="ABF51853.1"
FT                   /translation="MLIAIVAVELMGNAIKTGMSAAAITALLGGAAIFSGINWYLATSG
FT                   AKNRKRCGECVKQTTENEHAGSGVAIAVGTVLDGIPEALVIGLSMVGGGKIGMGVVAGF
FT                   FLANIPQGLSSASGMKLAGRSRRYIYAIWAGIPLLIGLTAAFGNFALGSVSTDATTVIL
FT                   CFAAGTVLAMLAETMIPEAFDHAPPMIGLITVTGFLSAFLLVQHHV"
FT   gene            complement(125193..125585)
FT                   /locus_tag="Sala_0130"
FT   CDS_pept        complement(125193..125585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0130"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51854"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW8"
FT                   /protein_id="ABF51854.1"
FT                   /translation="MAKRDAVFPANRHALYEEHGYSAAIRSDRLLFVSGQVGSREDGSP
FT                   EPEFAEQVRLAFANLEATLLAAGCGFDDIVDLTTFHTDPENQFETIMAVKSKIFTEAPY
FT                   PNWTALGVNWLAGFDFEIKVIARIPD"
FT   gene            complement(125745..126734)
FT                   /locus_tag="Sala_0131"
FT   CDS_pept        complement(125745..126734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0131"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51855"
FT                   /db_xref="GOA:Q1GWW7"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038142"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW7"
FT                   /protein_id="ABF51855.1"
FT                   /translation="MLSAHRNDDLLTGKTIAVICAVALFTTACGKKSDAGAPDDTYASL
FT                   VNKDGTISFPADFPESYMFIGTWSVTAPSGEAEIHSVYSRPADVDAFRSAGKFPDGAVL
FT                   IKEVTIAKSADLVTGRASWAGDRKIWFLMVKDRKGRFAGNPLWGDGWGWAQFDPTDTKK
FT                   QTATNYQTDCKSCHIPAKSSEWVYTYAYPALGEKGQVGLPVNSHRGNPPGIVPAVATQA
FT                   MTSGVASGKMAFDKTCRACHSINPGGAGIGPTLAGVVGRKAGTVPNFDYSDQIRNSGIT
FT                   WTADNIDKHIEAPKSFIPGNRMGNLFPNGIKDPGQRRDIIVYLKSVAQ"
FT   gene            complement(126795..127478)
FT                   /locus_tag="Sala_0132"
FT   CDS_pept        complement(126795..127478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51856"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="InterPro:IPR038142"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW6"
FT                   /protein_id="ABF51856.1"
FT                   /translation="MTPVYNQSFLSVASAAFLLSTLSACGGASGEGEKSDSAEPRTQAA
FT                   VARDPNYPEIDIPPVWDAKGQLVQPKDFRELVFLGAPLTPHGLNGGKASFPEFHNVYTQ
FT                   PAAFKAYRATGKWPEGTMMIKELQLVSDPKGEFPDGSTTAPSGRGYFPGPPNGLDVSVK
FT                   DSKRFADSNGWGYFNFNHSAPPYLATAALKSVDECAGCHIANAEDMVYIKFYKPILDPL
FT                   PLPRG"
FT   sig_peptide     complement(127386..127478)
FT                   /locus_tag="Sala_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.551 at
FT                   residue 31"
FT   gene            128017..128427
FT                   /locus_tag="Sala_0133"
FT   CDS_pept        128017..128427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW5"
FT                   /protein_id="ABF51857.1"
FT                   /translation="MARPGARYRILDCDRVDGWLIPRRGMAGAQIFVLAVQVVQWGYAP
FT                   AASGEEAIFSGATPSTSTRSSPTTMPVMRTRFSIWSTGTRWRSRRHRPPRSRRSENPPA
FT                   SRSKVPVSSILVPIIIMSLAYPKSQHRARNFG"
FT   gene            complement(128453..129115)
FT                   /locus_tag="Sala_0134"
FT   CDS_pept        complement(128453..129115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0134"
FT                   /product="Excalibur"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51858"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW4"
FT                   /protein_id="ABF51858.1"
FT                   /translation="MKWLFVIALALTPLSASAQDISGTGRAKDGDSLDMAGIAVRLHGV
FT                   DAPELYQTCSRQGQSWACGKEAMAKLGQLVNGAELRCEQRDVDDYDRIVASCTARQIDL
FT                   GQAMVEAGLAVALPQFSDRYLGAEARAKALKLGIWSSDFQKPADYRAANPRAHRPKPQA
FT                   SAVRQPIASPAPSGVYYRNCNAAWAAGAAPLYRGQPGYRPEMDGDGDGVACEPFRRR"
FT   sig_peptide     complement(129059..129115)
FT                   /locus_tag="Sala_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            129305..129706
FT                   /locus_tag="Sala_0135"
FT   CDS_pept        129305..129706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51859"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW3"
FT                   /protein_id="ABF51859.1"
FT                   /translation="MGRALEPVLRAPAPLPPGPTVLHSLYNVSKNQAILVIERFQITVH
FT                   DEQMLVIAIFVRLLPDKACDRYLKMIGELSDKFDRRILGGAFLKLPDMRLRRTDGVSHF
FT                   LKRLLLCRAKVLQPHRQRHVHDLPRHNLT"
FT   gene            130031..130900
FT                   /locus_tag="Sala_0136"
FT   CDS_pept        130031..130900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51860"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW2"
FT                   /protein_id="ABF51860.1"
FT                   /translation="MAKTTKSKALVPAGQRKTSVMRKAATVDVAPAMDGTLLPILGSDL
FT                   AVAKLIGDGGDVMREGGVVLVTGRAYATRAGVVAAEEIFYDQAARPDGKGPWLGEADKV
FT                   SWRDEASGYDCIMLRDTDDGFLSGYVGIPHDHPLWGWDDGAVPSDIGIEVHGGLTYSRL
FT                   CEVGPSPARRLAVEARRICHVTLRPAVYHPVAHATDHRVEDPHAWWFGFSCDHAYDLIP
FT                   RHAQVPSRPKSSELARTYRDDAYVVRETVALAAQLRAIADGDAAPQRDDQPPPIGLDPS
FT                   RGGGRGRL"
FT   gene            130887..131660
FT                   /locus_tag="Sala_0137"
FT   CDS_pept        130887..131660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51861"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW1"
FT                   /protein_id="ABF51861.1"
FT                   /translation="MADFDRHVGELPWGWWLRANPRGYEDAAGRNWSSVRDAFWEGELG
FT                   FPPVHFAPEQHELMLRVMTAISASWFGTESNHDVFGGDMMFWRFYQCWLASIGMVETSE
FT                   GRDVFDGVLSSLGKSVLMMLQATREPEFERLPMAAVVAAVSASKGLDAEARERALITFE
FT                   QQVGFRRHLFARENLGRRYLVTLTGLKVGARMPTRNIAWSQSFADANSRDDLFAWLAER
FT                   VHRWDDWGGIAHRKGASALTSHLLSVIVGAGGLAR"
FT   gene            complement(131815..132669)
FT                   /locus_tag="Sala_0138"
FT   CDS_pept        complement(131815..132669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51862"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWW0"
FT                   /protein_id="ABF51862.1"
FT                   /translation="MFAGQYLNGPAFADLRKTLRNPGLKLEATISELRRSEAYFIRAYD
FT                   NYVAGYSDQRAIELRWAELRLAIARLFYDDMIRSVPAKPRTQARPKAERSTSVIGFEMD
FT                   AFSADEQKALRQAIRNREEAIRQLETIIRRGGATSDTTHLICSYLRDPNKIEQVNRWLT
FT                   AEQRKAHHNNPEPEDDVQPMAAVAEPLQMDTPPSRNGQDNEKLWPPRREAPRTDPVVAQ
FT                   RLVEWLRAGPNKIRKLYARSSTGDIRLNARPDAPPVADMFETAVDHPLVQNELSAICAR
FT                   LEL"
FT   gene            132709..132969
FT                   /locus_tag="Sala_0139"
FT   CDS_pept        132709..132969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51863"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV9"
FT                   /protein_id="ABF51863.1"
FT                   /translation="MDDGDFKFARQFFHLGRMRSHTFDDYARHGLGKQVFHDYLLAWSV
FT                   GWSPGERRAILSLIRHGSSLKPDIQARCSTANWCMDITTSI"
FT   gene            133348..136752
FT                   /locus_tag="Sala_0140"
FT   CDS_pept        133348..136752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51864"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV8"
FT                   /protein_id="ABF51864.1"
FT                   /translation="MDPIGTFRRRAAKRIIRDLPLDLAETELDDPLGLLRGKVRASLDS
FT                   AQRWERGKAAPARRAWFGIPSVPDTSRLTSAAGERSFHLARNVTRERSAAAFDDYATGK
FT                   IGDANAEPELAAEERPAATFDRYTQDHGHDDRQILVTTLDPDPVKRSRQWDAVEAHEFG
FT                   RRKNKSAGPPRLNIRYELAPAFLAGAARRDDCPEGLRDILNAEQRRVDGGKALGKKRQL
FT                   VGVPWIDPEAPAALEWLAALPGWPNAAPPVKLSEGRGSYAVIAGEAELPADLDGAAHER
FT                   IFVGANVWVQSLAQSDSGDAGVKRVVPALFVRHKPDALNNSANWHFHFQVGKRAATINA
FT                   DGMLVFDPRVVPQIATSFMKPFRCEIARLINIELEAIGADYRLSPESYAKMGLDAQTMR
FT                   KVGGKATLLERAGDTPDVSLNNATIGWARVLAQQVAKRDADFADADTAFELREARVREV
FT                   RASEERDRLVRLSLDLRARELAAIQLRAEAAEIETLCAMARSHPRIVARFAPGYADKAR
FT                   KDGHDTYLSHAWTRRGNEAEAYLDELDRELVVEQAAMAERREQAKFLERTAADLRERLE
FT                   RDLGLAVQDPEPTRVVDAILSREPSSRTLVDPNAVMKRIAETPLLLSEVDGRLVVLPAD
FT                   DPQDLLHGVDLISPPYRKRLPAIRDTQQKELAQVGALLAKRGPAGLDDDNLVGKSAWLQ
FT                   MAVRRWRDTPEIGRRIKLRDLRIKATREIASDRQREADQEFALSPPRALDQSLPTMASL
FT                   GAHGPDMVGLGEITPGREPQPVPAWLSPRAELPREYDISAEDSVSVAPKQANILRDVRA
FT                   DDYLPIQHNGREKLADMYQRLADTPINGPFPDKPTNDQLQALRSVIETYPVRIVHWRGA
FT                   RQIDLRDDPRRWFDTPYIRSAAGQDLLSTIVDRRAQMFRNLPDIDPARRPTAWEVEQKR
FT                   RASLLDRPATHLAPVPAELMDAHQETDPAALWRRAPVPFLFARCADAEVPDTVETLRDA
FT                   LGPRAAWLTRPDIRARTRAAWFVQQETRNDILHDRLVETGRLPPANSRASEGDRFRHIG
FT                   DPLLDEEWLLVGRGSVRFDPPKEADRLKRAVGLARSSGDNGAAAAIIVFGIKRRTAKQK
FT                   AKWSKSSKGLHPSARGLPGREPGGRGR"
FT   gene            136971..137735
FT                   /locus_tag="Sala_0141"
FT   CDS_pept        136971..137735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51865"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV7"
FT                   /protein_id="ABF51865.1"
FT                   /translation="MNEYQLPKCLQVIGLACIPVNDIPDEHPALARRPVAAAVLTMVDQ
FT                   DDGHRWINTICVSDARKSEIPLPHLLDKTLLPGVVQIASTTDRMTLAMDAMSRRFFVEP
FT                   ALAELCFGETAIDPAAMGDHGFDERTACRRFSIPMPEIGDADIELAWSRSAPAAAEDHA
FT                   LRVATARLMLWAHVEAFRIARPEPFFEIMLALRDWIDASEYLKAALADIGNSRPFRRAD
FT                   SFAHHYRDYRQRLAAGDETARWVSFEDGLFHA"
FT   gene            138017..138661
FT                   /locus_tag="Sala_0142"
FT   CDS_pept        138017..138661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51866"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV6"
FT                   /protein_id="ABF51866.1"
FT                   /translation="MTTIHNIRPFNTRYVIRERSSRYTPELLRTHRTAQASYAYINRQN
FT                   SVDEWGPTPNWASRSDLAAAGRCAPARAAGPKLSGIALWAQADENAVRYRPDEPTIAHC
FT                   VGSLPRHEDLAFWRNLIEGFAEDYLVARGMVVDWAIHHQAETDDQPEIAPHVHFLITLR
FT                   GYDPEHRDYGKVRQNWLRTDNSRKRLAERWWDRTGIVPPEYVMAATAQKSR"
FT   gene            138781..139119
FT                   /locus_tag="Sala_0143"
FT   CDS_pept        138781..139119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51867"
FT                   /db_xref="GOA:Q1GWV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV5"
FT                   /protein_id="ABF51867.1"
FT                   /translation="MSGEGDLKVGGENRMFIVELTAVVIAAYVTALVMREMPRLFALLV
FT                   VQIADRLSGARRTHIVEALNGRQVPVTWAATSEDRNLLHAAMRSTMRVTTFRSLYPLNR
FT                   WNRLLGPF"
FT   gene            complement(139264..140049)
FT                   /locus_tag="Sala_0144"
FT   CDS_pept        complement(139264..140049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51868"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV4"
FT                   /protein_id="ABF51868.1"
FT                   /translation="MKIWPKPQDVLLDQYYTCQQVARKLYGVFQEYFDPNQYQLVEPSA
FT                   GTGSFFRLMPHESLAFDVDPKYPGIRTADFLCVEIRSEREVAVIGNPPFGRNASIAVRF
FT                   FNHAACQASVIALILPRSIRKASIENRLDRNFHLIHEETVQRDAFLFRSKPYDVPAVFQ
FT                   IWERRDDLRELQHVAFHHRDWSWTTPERADFAIQRVGARAGRVHRDLTRSPSSHYFIRG
FT                   NVEPIMKRLNFAKVALNVAGNPSLSKSEIVSLYRQLTGR"
FT   gene            complement(140728..141693)
FT                   /locus_tag="Sala_0145"
FT   CDS_pept        complement(140728..141693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0145"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51869"
FT                   /db_xref="GOA:Q1GWV3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV3"
FT                   /protein_id="ABF51869.1"
FT                   /translation="MPSTHHTKMLILGSGPAGLSAAIYAARAGMQPIVVQGLQPGGQLT
FT                   ITTDVENYPGFAEVIQGPWLMEQMTAQAVHVGTSMIWDTIVDVDLSQRPFKLTGDGGDV
FT                   YLAETLVIATGAQAKWLGVPGEQELGGKGVSACATCDGFFYRGKKVVVIGGGNTAVEEA
FT                   LYLTNHSDDVTLIHRRDSLRAEKILQDRLFANPKIKVLWNKQVERFVAGEGVSGLVGVD
FT                   LIDTVTGAASHEPTDGGFVAIGHSPSTELFRGKLPLDADGYLQVTPGTSLTAIPGVFAA
FT                   GDVTDKIYRQAVTAAGMGCMAALDAERYLAEAEYHAMVDA"
FT   sig_peptide     complement(141616..141693)
FT                   /locus_tag="Sala_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.707 at
FT                   residue 26"
FT   gene            141909..142535
FT                   /locus_tag="Sala_0146"
FT   CDS_pept        141909..142535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0146"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51870"
FT                   /db_xref="GOA:Q1GWV2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV2"
FT                   /protein_id="ABF51870.1"
FT                   /translation="MASWWERHGVPRLIKCACSQGQIMKLRSRIVPYARGHVLELGCGG
FT                   GINMAFYRPEQVESFSGIDPSPELLAMSRAAAAGRGMAADIRGGVGEAMPFDSGQFDTV
FT                   VTTFTLCSVADQAAVLAEIRRVLKPGGTALFLEHGGAPDAGVAKWQRRIEPVWKRIGGN
FT                   CHLTRPIGDAYAAAGFAVERQGAAYMPKTPRPFGWVEYGAARVAG"
FT   gene            complement(142661..143389)
FT                   /locus_tag="Sala_0147"
FT   CDS_pept        complement(142661..143389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0147"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51871"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV1"
FT                   /protein_id="ABF51871.1"
FT                   /translation="MTVTVAALYRFAAFDDPAALRQPLLNHCAIEGVKGTLLLAREGIN
FT                   GTIAGTDVGIAAVIDHIRALPGCAALDVKYSVASAMPFRRLKVRLKKEIVTMRVPGLDP
FT                   ARNAAPYVDPADWNALVDDPGTVLIDTRNGFEVGYGSFAGAVDPGTKSFGDFPGWWRAN
FT                   ADRFTGKRIAMFCTGGIRCEKSTAFLRHEGVEDVVHLKGGILAYLEQVPASQSRWHGSC
FT                   FVFDERVSVGHGLVEMGEKE"
FT   gene            143693..144031
FT                   /locus_tag="Sala_0148"
FT   CDS_pept        143693..144031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0148"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51872"
FT                   /db_xref="GOA:Q1GWV0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWV0"
FT                   /protein_id="ABF51872.1"
FT                   /translation="MKKIEAIIKPFKLDEVKEALHEVGVSGITVTEAKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKLEVIVEDGMAERVVEAIAAAAQTGRIGDGKIFVIPVETALRIRT
FT                   GERNEDAL"
FT   gene            144103..145515
FT                   /locus_tag="Sala_0149"
FT   CDS_pept        144103..145515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0149"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51873"
FT                   /db_xref="GOA:Q1GWU9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU9"
FT                   /protein_id="ABF51873.1"
FT                   /translation="MATKPKDIIARIKDNDIEWVDLRFTDPKGKWQHLTMCAGVIDEDA
FT                   LEDGLMFDGSSIEGWKAINESDMILKPDLDAVYDDPFSATPMLVIFCDIVEPSTGEGYA
FT                   RDPRTTAKRAEAYLGSTGIGDTVYVGPEAEFFMFDDVRFETGYNKSGFEIDDIELPTNT
FT                   GRSYEGGNLAHRPRAKGGYFPVAPVDSAVDIRAEMVSTMLEMGLPCDKHHHEVAAAQHE
FT                   LGLTFGTLTQTADRMQIYKYVVHQVAHAYGKTATFMPKPIKDDNGSGMHTHISIWEKGK
FT                   PLFAGNGYAGLSDMCLYFIGGVIKHAKALNAFTNPTTNSYKRLVPGFEAPVLLAYSSRN
FT                   RSASCRIPYGAGAKAKRVEFRFPDAMANPYLCYSALLMAGLDGIQNKIHPGDAMDKNLY
FT                   DLPPEELSEVPTVCGSLREALDSLMADHDFLLKGDVFSKDQIEAYVELKWNEVYRFEQT
FT                   PSPVEFDMYYSA"
FT   gene            145673..146149
FT                   /locus_tag="Sala_0150"
FT   CDS_pept        145673..146149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51874"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU8"
FT                   /protein_id="ABF51874.1"
FT                   /translation="MMRLAVPALVFLVAACGASADPAATVATPEGYREAAAAFDSAIAA
FT                   KDEAALQRLIADDFLWVRGSGAMGDKAAFIAALAAPSIRIEPFRPAEPRWITSGDSALL
FT                   AATNRLQGTADGEPFVDRHRFADHWLWRDGAWQLVYAQVTPVPEAAAADVGGAD"
FT   sig_peptide     145673..145735
FT                   /locus_tag="Sala_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            complement(146162..146833)
FT                   /locus_tag="Sala_0151"
FT   CDS_pept        complement(146162..146833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51875"
FT                   /db_xref="GOA:Q1GWU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU7"
FT                   /protein_id="ABF51875.1"
FT                   /translation="MMTTKASPTAGWKKIAAQALFGAVVGAAGMFAALSLLEGGDGNDW
FT                   PGSIIILLGVGFIYTLMGAFVGIGTLAPRLVGQRLLNVADAEEIVEERSHLGGSAIGCL
FT                   ALGAGLMLLAYATGSEAVGTTPRVSVAAAFWILVAVLGLFTLVSVWMWRDFDELWRQLT
FT                   LEVTAITGNLMMFVAVLWGGAATADLIAGPHPIDLVSLSFGLMLLGCFVATARRGMMAP
FT                   R"
FT   sig_peptide     complement(146720..146833)
FT                   /locus_tag="Sala_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.890) with cleavage site probability 0.348 at
FT                   residue 38"
FT   gene            complement(146835..147116)
FT                   /locus_tag="Sala_0152"
FT   CDS_pept        complement(146835..147116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0152"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51876"
FT                   /db_xref="GOA:Q1GWU6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU6"
FT                   /protein_id="ABF51876.1"
FT                   /translation="METCKECLTDETANCKELLTGTGAAVENRVREYREAAGWSQGELA
FT                   RRLGVSRQTINAVETDKYDPSLPLALRMARLFALEVCELFIDHWNPKE"
FT   gene            147432..148898
FT                   /locus_tag="Sala_0153"
FT   CDS_pept        147432..148898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0153"
FT                   /product="Glucose/sorbosone dehydrogenases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51877"
FT                   /db_xref="GOA:Q1GWU5"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU5"
FT                   /protein_id="ABF51877.1"
FT                   /translation="MPKHIFALLFLLALTSCGGGGGGDTPPPLANTPPVFTSLQTASVA
FT                   ENTANAYQAAASDADGDALTFAIDGGADAARFAITGAGALRFNTPPDFDLPGDADGDNV
FT                   YAVVLRVSDGRASVTQAVNITVTNSREGIAVARVGTGFSQPLYVAPIPGDNRIYVVEKG
FT                   GDVYRFDPADGSRTRVLDITDISTSGERGLLGLAPYPDHATSQRLFAVATAINGNVQVR
FT                   RYTLGQPNSSTSYDLVLDIPHPGFDNHNGGWIGFGPDGHVYVAVGDGGGAGDPNNNAQN
FT                   RNVQLGKILRFAVGTGGSTYAPAPGNPFLAGGGDPYVFALGLRNPFRASFSGSTLLIGD
FT                   VGQNAVEEIDMVATAQPGLNFGWRFLEGTQPFSGTAPAGLTPPVAEYGHGSGPRQGRSV
FT                   TGGYVYRGPVASLQGQYVFGDFVSGNIWTVPFADLVAGQTLPAARFAVRNEDFAPDAGT
FT                   IANIASFGEDSAGNLFIVSIGGDIFMVRPG"
FT   sig_peptide     147432..147500
FT                   /locus_tag="Sala_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.439 at
FT                   residue 23"
FT   gene            149067..150500
FT                   /locus_tag="Sala_0154"
FT   CDS_pept        149067..150500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0154"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51878"
FT                   /db_xref="GOA:Q1GWU4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU4"
FT                   /protein_id="ABF51878.1"
FT                   /translation="MSTETHLKQHYIGGGWVDSKGGKLHEVINPATEEAASTVVLGTAA
FT                   DVDAAVAAAREAFKSFSQTTREERLELLNRIVEEYKKRAGDLAKSMAAEMGAPVSFAGT
FT                   AQVGAGIGGFLGTIAALKDFSFTEQHGANKVVYEPIGVVGMITPWNWPLNQIALKVAPA
FT                   LAGGNTMVLKPSEECPGNAVIFAEILDAAGVPPGVFNLVQGDGPTVGHAISAHPGIEMV
FT                   SFTGSTRAGILVAKAAADTVKRVHQELGGKSPNIVLPDADFEAVLPPTVQGVLVNTGQS
FT                   CIAPTRILVQKEREAEAVGVIKAMFDGTQVGDPMSEGAHIGPVVNKAQFDKIQGLIQSA
FT                   IDEGAKLETGGTGLPSNVNRGYYVKPTVFSGVTPEMRIAREEIFGPVATVMAYDTLDQA
FT                   VEIANDTEYGLSAVVSGDPAKAAEIAPKLRAGMVAVNSWGPGPGAPFGGYKASGNGREG
FT                   GLFGLKDFMEVKAISGIPA"
FT   gene            150674..151900
FT                   /locus_tag="Sala_0155"
FT   CDS_pept        150674..151900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0155"
FT                   /product="glutamate N-acetyltransferase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51879"
FT                   /db_xref="GOA:Q1GWU3"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU3"
FT                   /protein_id="ABF51879.1"
FT                   /translation="MTIRSPLAPAAFPDLPEIAGVTRRVARARYKDWDRCDLTYIELTP
FT                   GTTVAGVFTRNICCSSEVELGREQVRRGTARALIVNAGNSNAFTGYRGRTAVEAIMAQV
FT                   ADHLGCAAGDVFVSSTGVIGVPLPKDKARAGVAAALTAKPCSWEVAAETIGTTDTFAKG
FT                   AAASAIVGGRTVHVAGIAKGSGMIAPDMATMLGYIFTDAAVAPALLQEMLREAAGGTFN
FT                   AITVDSDTSTSDTVLLFATGQAGHAPLAARDDPGADALYAAIRQVALDLAHQVVRDGEG
FT                   ASKFIEVQVTRAVSDDSAKRVALAIANSPLVKTAIAGEDANWGRVVMAVGKAGEPADRD
FT                   RLAIRFGDHWVAKDGLAVDGYDEAPVAAHLKGRDIRIGADLGLGEGRATVWTCDLTHGY
FT                   ISINADYRS"
FT   gene            complement(152009..152329)
FT                   /locus_tag="Sala_0156"
FT   CDS_pept        complement(152009..152329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0156"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51880"
FT                   /db_xref="GOA:Q1GWU2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU2"
FT                   /protein_id="ABF51880.1"
FT                   /translation="MGTKAITDASFQADVLDSETPVLVDFWAEWCGPCKMIGPALEEIS
FT                   DELAGKVVIAKLNIDDHPDAPSKYGVRGIPTMILFKNGEIADTKVGAAPKSALKGWLEG
FT                   AL"
FT   gene            complement(152363..155863)
FT                   /locus_tag="Sala_0157"
FT   CDS_pept        complement(152363..155863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0157"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51881"
FT                   /db_xref="GOA:Q1GWU1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU1"
FT                   /protein_id="ABF51881.1"
FT                   /translation="MTRPATLATLDPHQRAAADPARHVWLGASAGTGKTQVLSARVLRL
FT                   LLDGVSPEAILCITFTKAGAAEMAHRIHQRLAKWVRMEDGELRLDLQALGIDLELHGHD
FT                   DGVPALIARARALFATVIDSPGGAIRVQTIHSFCQTLLASFPLEAKLLPGFRAIEEDEA
FT                   GALQRRVLGDLLDAPDEEQAALRAAAAALAQRLGPDAAIGFLSRCASVFGGPGALLPPA
FT                   AHDLRAAFGLPGGDPDAWMIDQLAGGAIAEADIKAVAASGAAWGTKTGLACSDVMVGWM
FT                   TGDTAARAAMLDELLGCFLTGKGDLRADFAGDKGRMTDCVDSAVRIVEAASALRGTATA
FT                   MRIADELAAAWKLGSRFAEAYALAKREQGLADFDDLITLAGSLLRVSGFGEWVRFKLDQ
FT                   RTDHILVDEAQDTNMRQWGIVLSLAEEFFAVHGKDMDRARTLFTVGDRKQAIFGFQGTE
FT                   PRAFVAARDLFHALGERAGQDFEAVDLISNYRSTPAILEVADAWLAAGGTALMGLDGAE
FT                   PPHVPHRRAHAGQVELWEPLPVGKALGATEEADEGVDDNGNATAPARDPASMRLAKAIA
FT                   AEVQDWIANGKDGRPVAPGDVMILVRRRRDLAARIVARLQALHVPVAGVDRFALTQPLA
FT                   VQDLMAAMRFAVQPHDDLNLAALLVSPLIGWTQDDLYDRTRGRGRTPIWMYLRAHQDMM
FT                   PPATMATLRQILGMADYTTPFRFLETLLSGPIDGRRKLYARLGREARDPIDELLNQALA
FT                   FEARKTVSLLGFLAEIEGSAADIKRQTEARGGVVRVMTVHGSKGLQAPIVILADATDDA
FT                   AFGHRPFTVDVAAWEKLPVYAIGADERHGALADAYAKAKAAADEEHWRLFYVAMTRAEE
FT                   ILVVAGVTRTAERTVPEASWHAAVSGVLDRLGHDWEDGGAAWGRRRVHRVNAGRWAPQA
FT                   KKAKTAARAPTRLPDWLHRTAPEETRPPRPLAPSTLGEDDVAAPPQGGERGAAVERGLL
FT                   LHALFERLPPVAPDRRRAAALRWLAVQAPALDEPARGAMVDEVLAVLDDPAHAPLFGPG
FT                   SLAEVPLSAVVDGVVVAGIVDRLRVTDDAVTVIDFKTGRHLPGSAAEVQPAYLRQMAAY
FT                   RDALKVIFPGRRIATALLYTAAPRLIALGDALLDAHKPGLLATKANLPGSALEPDAPTP
FT                   "
FT   gene            complement(155860..158835)
FT                   /locus_tag="Sala_0158"
FT   CDS_pept        complement(155860..158835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0158"
FT                   /product="helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51882"
FT                   /db_xref="GOA:Q1GWU0"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWU0"
FT                   /protein_id="ABF51882.1"
FT                   /translation="MATRRPTLFSIPVQRAFADALAAGLIDRYADGVLGLTEGIVLLPS
FT                   NRARSAVQAAFVRAGGAGLLMPRLAVIGDADLDENVALALDAVDMDAPLPPAIEPLRRR
FT                   LLLAELIERYTPAGEPPVTGAAAFQLAGGLARVIDQLHYEEIPAAALVDLDLGAFADHW
FT                   RASLARLRLLVDHWPDVLAATGHIDRAARRNALLDRVAAAWRTAAPARFVVAAGITTAA
FT                   PAIARLLRTVADMERGMVVLPGLDTAMATAEWEALGPTGPDPDRSARPLETHPQYHLKL
FT                   LLDRMGIAREEVAEWEARSPFDGPEARSRFVSLLFAPADYTARWQAAGDLEAATAGIAG
FT                   ATFADDAQEAQGIALLMRHAVETPGRTAALVTPDRALAERIAAALARWGIAVDDSAGQP
FT                   LARTPPGALAMLLAELAADFNPVALIALLAHPLVRRGEPRTAWLDAVRQLDLLLREPGL
FT                   APGWAGVSARIAALAADRDARGHALAVELAPWWHQLGEAFVPLLAPFAGPPVAPDRLLA
FT                   ALRQGLEWLTGEAAWTGPAGRMLAELFDRWTLARGAGPARVAPADFPAMLGQLLGEASV
FT                   RPPYGGHPRLFIWGLLEARLQRADLMILGGLDEGRWPAATQPDPWLAPGIRRLIGLPAT
FT                   ERQQGMAAHDFAGALGAGEIVVTRALRSGGDPAVASRFWLRLAALAGDLPQPALDGVPL
FT                   TDLAARIDLPADDIEPAGKPCPAPPADRRPRRISVTAVDRLARDPFAYYANQILGLSPL
FT                   APLSAAPDPRWRGTRVHALFERWVRAGANAAAFEAELAALRDDPALDAIARAFWLPRIE
FT                   PALRWAARQLIEAEGRTALRAEAWGEIALDGITLTGKADRVDRLRDGRLAIVDYKTGGA
FT                   PNAKAAFDKLDNQLGLLGLIARRGGLAGVDAAEIAALEYWSLRPDRKAGGAGKISSTYG
FT                   PRSDLKSAAEAVDHAADALAGLAARYLFGDAPFAPGDSATYGDYDQLMRRDEWFGRGEE
FT                   GA"
FT   gene            complement(158935..159654)
FT                   /locus_tag="Sala_0159"
FT   CDS_pept        complement(158935..159654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0159"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51883"
FT                   /db_xref="GOA:Q1GWT9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT9"
FT                   /protein_id="ABF51883.1"
FT                   /translation="MSATIESAMVMAAGLGKRMRPLTATRPKPLVRIAGKPLIDHSLDR
FT                   IEAAGIGHVVVNVHYLADALEAHLAAQKRRFTIAISDERGQLLETGGGMVKALPLLTGD
FT                   PILIVNSDNIWTDGPQDSIRHLARHWDDAGMDALLLVIRQASATGHRGRGDFHMDPAGR
FT                   LSRRKPGRIAPFVYTGIQLVSRRLLDGAPDGPFSTNILWDRAIAAERLYGLSHMGQWFD
FT                   VGTPASIAPTEAALSEV"
FT   gene            complement(159651..160622)
FT                   /locus_tag="Sala_0160"
FT   CDS_pept        complement(159651..160622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0160"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51884"
FT                   /db_xref="GOA:Q1GWT8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT8"
FT                   /protein_id="ABF51884.1"
FT                   /translation="MIPPAHAPAFLAAHGWDDARILPLAGDASFRRYFRVVDGERRAVL
FT                   MDAPPPHEDPRPFIAVAEYLCEAGLNAPTILARDLERGLLLIEDFGDVRLRETVDAAPD
FT                   RETAHYSGLTDLLIHLHAQPPMPGLPVHGLEQWLGEVMLFTDWYCPALDIAVDRDSFRA
FT                   AWEAALTPVESDGLPRVTVLRDFHAENIMLVAGQDGIAHYGLLDFQDALVGHPAYDLAS
FT                   VLEDARRDVSPAVEAAMLARYRQATGRDIENAYWALAAQRNTRILGVFVRLWKRDNKPH
FT                   YRQFQPRMWGLLERDLAHPALVPVRQWFDAHIPAAKRAEAWA"
FT   gene            complement(160619..161113)
FT                   /locus_tag="Sala_0161"
FT   CDS_pept        complement(160619..161113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0161"
FT                   /product="protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51885"
FT                   /db_xref="GOA:Q1GWT7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT7"
FT                   /protein_id="ABF51885.1"
FT                   /translation="MGPCLRRGTNTKAGPMSFTLAYNLDEADAIGAAIGGVLAPGDVVL
FT                   LSGDLGAGKTTLARAMLKARGLAGEAPSPTFAIVQPYAPPEVDLPIAHVDLYRIEEPRD
FT                   LIELGLDDYLSDGALLIEWPDRLGGDGWPGALELTISGAGDARVLTARVPPAWEARWPL
FT                   P"
FT   gene            complement(161199..163562)
FT                   /locus_tag="Sala_0162"
FT   CDS_pept        complement(161199..163562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0162"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51886"
FT                   /db_xref="GOA:Q1GWT6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT6"
FT                   /protein_id="ABF51886.1"
FT                   /translation="MSGTLSPTLLFALGLFAALWLLAGLWATLRGIAMQRRAAFAGGQA
FT                   ERLASLVEASPQLPVIVRADWRIEASDRLGRWLGLDRGPRNFDELRGIGSGLDAASHDL
FT                   LRQAILGAQRGAKPFQLSLKPEGSHRTIIVQGAAAPQAVGGAGSVLLWLSDATEGQQAL
FT                   AHARAERDEALAAFEALSGLIEAAPFPMWFRDTDLQLALVNAAYVRAVEARSATAVIDG
FT                   GIELCETVAGVSAADAADAARAAGSAQQRTIPVTIEGERRIMRVVDVPLAPEGGRMIGI
FT                   AGYAIDIQELESERGAHRRFVDTQRELLDRLSAAVAQFGPDQGLAFANLPFRRLFGLDA
FT                   DDVGEARPFARLLDAWRERGRTPEVRDYPEWRQAHVDWFARAEASEEDWRLRDGTHLHV
FT                   VAQPTPDGGLLLIAEDKTEQVQLAGARDTLLRVRTATFDNLFEAVAVFAPDGRLHLWNQ
FT                   RFRRLWGVDEPTLAAHPRVDVLMGGLADRLAKPNQISVVQEVIRAATLERQQRVGEIRF
FT                   ADGRHFDFASIPLPDGNALLIMLDITASRKMEGALRERNEALEAADKAKTAFLSRMSYE
FT                   LRTPLTSIGGFGEMLQAGYAGKLGDQQRAYVDAIMDSVAVLGRQIDNVLDLAQGEAGTL
FT                   AIERAPVDVRALLEKALDDTRPFADAEKVELVGNIAADLGTIEGDAPRLSRLVAGLLDN
FT                   AVRFTAPARKSAGRVLLHADGDKRGIDIIVSDNGPGMPEAAAAVAKGQQAGTDTGGIGL
FT                   ALARQLVAAHGGTMEVVSEAGQGTLVRVSLPRGM"
FT   sig_peptide     complement(163479..163562)
FT                   /locus_tag="Sala_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.372 at
FT                   residue 28"
FT   gene            complement(163757..165175)
FT                   /locus_tag="Sala_0163"
FT   CDS_pept        complement(163757..165175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0163"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51887"
FT                   /db_xref="GOA:Q1GWT5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWT5"
FT                   /protein_id="ABF51887.1"
FT                   /translation="MATLAADTRDYVVADIGLADFGRKEINIAETEMPGLMALRAEYGA
FT                   SQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWATCNIFSTQNHAAAAIAASGVPVF
FT                   AVKGESLADYWDYVGRIFDWESDNDGRTANLILDDGGDATMFALWGAKLEAGETMPPPE
FT                   NEEEVEMQRALKAFIAAKPGYLTKTVKAIKGVSEETTTGVHRLYHIAKKGELPFPAINV
FT                   NDSVTKSKFDNLYGCKESLVDAIRRGTDVMLAGKVATVAGFGDVGKGSAQSLRNGGARV
FT                   LVTEIDPICALQAAMEGFEVVTMDEAVKRSDIFVTATGNADVITAEHMAAMKNMAIVCN
FT                   IGHFDSEIQIAALANYKWTEVKPQVDLVEFPDGKQIIILSKGRLVNLGNATGHPSFVMS
FT                   ASFTNQTLAQIELWTRSEQYQNDVYVLPKHLDEKVAALHLEKLGVKLTKLTQKQADYIG
FT                   VPVEGPFKPDHYRY"
FT   gene            165576..165974
FT                   /locus_tag="Sala_0164"
FT   CDS_pept        165576..165974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51888"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT4"
FT                   /protein_id="ABF51888.1"
FT                   /translation="MKKILLPLITLAFASPVAAQSIVVVTAPQPGSDVLPVAYAELKAG
FT                   ENQAAIDKLTDETRLDARDPSRLINLGTAYARLGRTVEAAAAYDAAINSPIRYDLELSS
FT                   GRYVDSRWAARTALANLEQGRPLLALAR"
FT   sig_peptide     165576..165635
FT                   /locus_tag="Sala_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 20"
FT   gene            complement(166068..166712)
FT                   /locus_tag="Sala_0165"
FT   CDS_pept        complement(166068..166712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0165"
FT                   /product="protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51889"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWT3"
FT                   /protein_id="ABF51889.1"
FT                   /translation="MVSPYPKGAIPPPKTLDRPAPARHDGAMDTAPTWFTGQLLLALPG
FT                   IGDPRFEHSVIAMISHDEDGAMGIGIADPIEGMTVGAVLDQLGIEHEAPLDQPVYLGGP
FT                   VEPSRGFVLHSRDWGGEGAVLVADRWMVSSSHDILRAIGEGRGPSRWLVALGYAGWSPG
FT                   QLEGEMVRHGWHVTPGSDALLFDTPPARRWQAAFAEAGVDARLLTTKGGEA"
FT   gene            166953..167456
FT                   /locus_tag="Sala_0166"
FT   CDS_pept        166953..167456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0166"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51890"
FT                   /db_xref="GOA:Q1GWT2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT2"
FT                   /protein_id="ABF51890.1"
FT                   /translation="MSEKDAKMTIQPGDKLPDATFVKVTENGPEQVSAADYFKGRRVAL
FT                   FSVPGAFTPTCSAKHLPGFVEKADALKAKGVDEIACTAVNDAFVMGAWSKSANAGDAVT
FT                   MLADGNGAFAEAVGLTMDGTAFGMGKRGQRFSMIINDGVVEQLNVEAPGEFKVSSADHM
FT                   LEQL"
FT   gene            167576..169057
FT                   /locus_tag="Sala_0167"
FT   CDS_pept        167576..169057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0167"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51891"
FT                   /db_xref="GOA:Q1GWT1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT1"
FT                   /protein_id="ABF51891.1"
FT                   /translation="MTSRSSQESTDPAARIDAIIAELQDKFRASVSNLKSAIAAYVRDR
FT                   RLPPADAAATGLFDYPAIRLTTTGEQREGQAGHNLSFGRFERAGTFETTVTRPDLFADY
FT                   LREQLLLLARHYDVEIEVTRTGQQIPFPYVLDASDGSDMGGVTPLELARHFPTTELADI
FT                   GDELADGLFGLDPTEPQPLALFDALRTDFSLARLRHYTGTAPEHFQRYILFTNYHRYVD
FT                   EFVAWAGAQVGRGRYTALAGAAGLYVDQPGVNASALVADSAWRRHQMPAYHLIAPDGGG
FT                   ITLVNIGVGPSNAKTICDHLAVLRPEAWLMIGHCGGLRPSQRIGDYVLAHAYLRDDHIL
FT                   DGVLPPEIPIPPIAEVQQALASAAESVSGTSGADLKKRMRTGTVVTTDDRNWELRYTDS
FT                   ALRFSQSRAIGIDMESATIAAQGYRFRVPYGTLLCVSDKPLHGELKLPGQANRFYEEAI
FT                   AAHLQIGIRACETMRDEGAKLHSRKLRAFNEPPFR"
FT   gene            169208..171547
FT                   /locus_tag="Sala_0168"
FT   CDS_pept        169208..171547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0168"
FT                   /product="ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51892"
FT                   /db_xref="GOA:Q1GWT0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWT0"
FT                   /protein_id="ABF51892.1"
FT                   /translation="MPSFSESLEKTLHNALKAASERHHEYATLEHLLFALIDDDHAAEV
FT                   MRACGVALGDLQSAVVHYLDTELDSLKVEGHSDPSPTSGFQRVVQRAILHVQSSGKDEV
FT                   TGANVLVALFSERESYAVYFLQQQDLTRLDAVSYLSHGVGKGGKPAAQAEPEEKEEAKD
FT                   KDSSGKNKKETALDQFTVNLNEKAKTGKVDPLIGRSAEVDRTIQILCRRSKNNPLYVGD
FT                   PGVGKTAIAEGLARKIIEGDVPEVLLPAVIYSLDMGALLAGTRYRGDFEERLKQVVTEL
FT                   EGLPHAILFIDEIHTVIGAGATSGGAMDASNLLKPALSGGVIRCIGSTTYKEFRNHFEK
FT                   DRALLRRFQKIDVVEPTLEDTKKILAGLRSAFEAHHQVRYTPDAINAAVDLSARYINDR
FT                   KLPDKAIDVIDEVGAMQMLVAPSKRKKTITAREIEAVIATMARIPPKSVSTDDKAVLAS
FT                   LETDLKRVVFGQNTAIEVLSSAIKLSRAGLRDPEKPIGNYLFSGPTGVGKTEVAKQLAS
FT                   IMGIPLQRFDMSEYMERHSVSRLIGAPPGYVGYDQGGLLTDAIDQNPHCVLLLDEIEKA
FT                   HPDLFNILLQVMDNGRLTDHHGKTVDFRNVILIMTTNAGASDMARESIGFGQQTREDAQ
FT                   EEAVKRMFTPEFRNRLDAIVPFGYLPPEVVARVVDKFILELELQLADRNVHIQLDDAAR
FT                   EWLTAKGYDKLYGARPMGRLIQEKIKQPLAEELLFGKLVHGGEVKVKMKTGEDAHIGNP
FT                   LAFEITPAAPKGAKAKAKAKPAKAAE"
FT   gene            complement(171643..173307)
FT                   /locus_tag="Sala_0169"
FT   CDS_pept        complement(171643..173307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0169"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51893"
FT                   /db_xref="GOA:Q1GWS9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS9"
FT                   /protein_id="ABF51893.1"
FT                   /translation="MDSRFSWSTEYHHPTDWDQSFAPLSLPDMFAASVARKGEAPMLDF
FT                   MGRQFSYVEVALGVQRVARGLQLLGLGKGSRIGLFLPNVPHYVAAYYGALAAGATVVNF
FT                   SPLYTVAELEAQVEDSGTDTLFTLSAAALLPTAFKVLDGSSLNRLIVGSVAGGLSKTKS
FT                   LLYRLFKRREVAPLPGDPRVIRFSELTDNDGRPEPVAIAPETDVALIQYTGGTTGTPKG
FT                   AKLTHQNLTANARQVNAIDPDTQAEDRILGVLPFFHVFANTCVLNRTVLNGGSITMLPR
FT                   FDAKQALAAIGRTKTTALPGVPTMYQALLDHPDLARTDFSSLRVCISGGAPMPAELREK
FT                   FVAATGASLVEGYGLTESSGVVATNPYDGPVRPGTIGQPIPATHIRLLDKEDPSKDAPD
FT                   GEPGELAVKGPQVMQGYWNRPEADAESFTADGWLRTGDVAVIEEGGYIRIVDRLKDMIA
FT                   VGGFKVYPSVIEAHLHEHPAVKEAIVLGVPDAYRGEAPKAFVTLEEGFEVTGEALAAWL
FT                   NPQLGKHERVIAVEVREALPKTMIGKLDRKALRAEAG"
FT   gene            173440..173970
FT                   /locus_tag="Sala_0170"
FT   CDS_pept        173440..173970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS8"
FT                   /protein_id="ABF51894.1"
FT                   /translation="MQLSRFAIPTLLIAFALAAPTAARDKEPSVAPAQIRELYACRDIG
FT                   DAAQRLACFDREVGELAAADAAREITFTDRETARKARRGLFGFSFPKLGGIFGGDEDEI
FT                   KEIETTIRAVSMNRSGLYTLIMEDDAVWTQIDTTRLPRQPKPGQKVKIKTATMGSYFAT
FT                   IDGGRTIRMKRDR"
FT   sig_peptide     173440..173511
FT                   /locus_tag="Sala_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.741 at
FT                   residue 24"
FT   gene            174007..175845
FT                   /locus_tag="Sala_0171"
FT   CDS_pept        174007..175845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0171"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51895"
FT                   /db_xref="GOA:Q1GWS7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS7"
FT                   /protein_id="ABF51895.1"
FT                   /translation="MADRIPVRGPNSPPFVLLDDARTDGAAWARLFVDPIEVLTAASAA
FT                   DVPELLAELEAAVARGLHVAGFLAYEAGKGLGTAWRGAVDGVVGAMPLGWFGLFTGVQR
FT                   IDSDHVADLLSDPASAWIGCVTPRIDRADYVAAVEAVLAYIRAGDIYQANLTFRADVPV
FT                   AGDPLAVYARLRQTARAGYGGFIWTGEQAIASLSPELFFALRGREVIARPMKGTATRLA
FT                   DGAADAALARALAKDPKQRAENLMIVDLIRNDLSRVAAPGSVAVPDLFRVESFPTVHQL
FT                   VSDVSARLPEGVGAVDVLRAAFPCGSITGAPKVRAMEIIEALESEPRGLYTGSIGFIEP
FT                   GGDAAFNVAIRTLVFPRIATQGGLQDAPSCATLGLGSGIVADSVPDEEWRECLAKGEFV
FT                   GAAGESFDLIETMFFDPVEGIQRLDGHLARMKASAATLGFAFDRHGARNSLQSATFRLR
FT                   NAARVRMRLAPSGALAVEVSPLPRLAELPVPVAVRPAPMGPGDFRVAHKTSLRAPYDMA
FT                   RHDSGAAEVVFVDEPGFVTEGSWSNIFVERDGVLLTPPLALGLLPGVLRGELIDKGRAV
FT                   ESYLRLADLSAGFFLGNSLRGLVPARLAEPADDATG"
FT   gene            175960..177171
FT                   /locus_tag="Sala_0172"
FT   CDS_pept        175960..177171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0172"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51896"
FT                   /db_xref="GOA:Q1GWS6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS6"
FT                   /protein_id="ABF51896.1"
FT                   /translation="MSLKPHISAALGRIQPSATLAMTARVARLKAEGVDVIGLSAGEPD
FT                   FDTPDFVKEAAIEAIRAGQTKYTLVDGTVALKEAIRGKFRRDNDLDYGLDQITVNVGGK
FT                   HTLFNALVATVDKGDEVIIPAPYWVSYPDIVAFAGGTPVFVAASAAQHYKITPGQLDAA
FT                   ITPRTRWVIFNSPSNPSGAAYSPAELDAIGEVIRRHPHVMVMTDDMYEHVWYADFAFST
FT                   IAQRCPDLVDRILTVNGCSKAYAMTGWRIGYAGGPAWLIKAMGKLQSQSTSNPCSIAQA
FT                   AAAAALGGPQQFLDDRNAAFRKRRDMVVAMLNDAPGLNCPVPDGAFYVYPDASGCMGKK
FT                   TPSGQVIDSDEALIDYFLDSARVAAVHGAAFGLSPAFRVSYATSEAVLKEACVRIQQAC
FT                   AALS"
FT   gene            177591..178280
FT                   /locus_tag="Sala_0173"
FT   CDS_pept        177591..178280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0173"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51897"
FT                   /db_xref="GOA:Q1GWS5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS5"
FT                   /protein_id="ABF51897.1"
FT                   /translation="MMARRGGPALRALAALAPAVLLAQCAPAQAENVVKLPAALTDPAV
FT                   PAKRATAVLAGGCFWGVEGVFSHVKGVISVESGYHGGSAATARYELTHDGTSGHAEAVR
FT                   IVYDPTQVSYGTLLRILFSVVADPTLKDRQGPDVGSQYRAAIVPLDATQRQVATAYLAQ
FT                   IGRGGYFARPLVVPIERYKRFYPAEPTHQDFMRRNPRNPYIVRWDAPKLAALKRLFPDR
FT                   LRATPAP"
FT   sig_peptide     177591..177683
FT                   /locus_tag="Sala_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            178424..179590
FT                   /locus_tag="Sala_0174"
FT   CDS_pept        178424..179590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0174"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51898"
FT                   /db_xref="GOA:Q1GWS4"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS4"
FT                   /protein_id="ABF51898.1"
FT                   /translation="MKIEFSGRPLLAMTMSAAVLAGCVSSAAVIPQPRAQAPVEQTSQP
FT                   RAVRGPSGSVTVPIGQPVPSAMPRPAGPLDPGFRRAPAGLQDRIHALWSAFPGKTGIAV
FT                   QRIDGEWTLSHRGGDLFPQQSVSKLWVALTVLDAVDQGRLTLDQRVRIGPEDLTLFYQP
FT                   IAARVRAEGSVTLSVRDLIEIAITQSDNTANDSLLRTVGGPDAVRRFIAKKDLGAIRFG
FT                   PGERLLQAGTAGLKWQQAYSVGRAFQQARAALPDATRRAARNAYLANPPDGASPTAIAN
FT                   ALTRLARGALLSPESTEYLLGVMSRTKSGPRRLKAGLPADWKFLHKTGTGQDYKGSTAG
FT                   YNDIGIATAPDGTRYAIVVLLGDTSAPVPARMELMQAVSSAVAAYHGK"
FT   sig_peptide     178424..178510
FT                   /locus_tag="Sala_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.510 at
FT                   residue 29"
FT   gene            179598..179909
FT                   /locus_tag="Sala_0175"
FT   CDS_pept        179598..179909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51899"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS3"
FT                   /protein_id="ABF51899.1"
FT                   /translation="MNRALPPAAALVLLLSACATPEARLRTGLNNAGLSKAMSACMAER
FT                   MVDRLSLLQLRRLAALGSLKDKRVADLSLAQFLHKVRALKDPEILAVSTSSAAVCALR"
FT   sig_peptide     179598..179657
FT                   /locus_tag="Sala_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.839 at
FT                   residue 20"
FT   gene            179980..181260
FT                   /locus_tag="Sala_0176"
FT   CDS_pept        179980..181260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0176"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51900"
FT                   /db_xref="GOA:Q1GWS2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS2"
FT                   /protein_id="ABF51900.1"
FT                   /translation="MPRNLAYAAPNFSLFLESKGPADLMNIHEYQAKELLAKFGVAVPR
FT                   GIAAMSVEEAVAAAKQLPGPLYVVKSQIHAGGRGKGKFKELGPDAKGGVRLARSIEEVG
FT                   SHAREMLGNTLVTIQTGEAGKQVNRLYITDGADIKKEYYLALLVDRASSRIAVVASTEG
FT                   GMDIETVAHNTPDKIHTITIDPATGLMPHHGRSVAAALELTGDLAKQAAKVLAGLYDAF
FT                   LATDAEQIEINPLAVCEGANGDELLVLDAKLGFDGNAMFRHPDIAELRDLTEEDPAEVE
FT                   ASEYDLAYIKLDGNIGCMVNGAGLAMATMDIIKLNGAFPANFLDVGGGASKEKVTAAFK
FT                   IILKDPAVEGILVNIFGGIMKCDIIADGIVAAAKEVNLSVPLVVRLEGTNVQQGKDILA
FT                   NSGLPIVAANDLGDAAKKIVAEVARAA"
FT   gene            181362..181634
FT                   /locus_tag="Sala_0177"
FT   CDS_pept        181362..181634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS1"
FT                   /protein_id="ABF51901.1"
FT                   /translation="MLRARRKGAGIWIYFKTFRRCHGQNRSNPEGTPKWLQSRTFAALR
FT                   VAMLPAAPAKARYLRHFDASNGELMGPDPSRSGEGGDVGTLTKSD"
FT   gene            181761..182510
FT                   /locus_tag="Sala_0178"
FT   CDS_pept        181761..182510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0178"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51902"
FT                   /db_xref="GOA:Q1GWS0"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWS0"
FT                   /protein_id="ABF51902.1"
FT                   /translation="MKILVPVKRVLDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEE
FT                   AIRLKEKGVATEIVAVSIGPAKAQETLRTALAMGADRAILVQTDDAVEPLAVAKILKSI
FT                   ADAEQPGLVILGKQAIDDDNNQTGQMLAALTGWAQGTFASAVNVEGDHVSVTREVDGGL
FT                   ETVKLKLPAIVTTDLRLNEPRYASLPNIMKAKSKPLDVKAPTDYGVDTTPRVKTLKVSE
FT                   PPVRQAGIKVADVDELVAKLKAMGVHS"
FT   gene            182622..183551
FT                   /locus_tag="Sala_0179"
FT   CDS_pept        182622..183551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0179"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51903"
FT                   /db_xref="GOA:Q1GWR9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR9"
FT                   /protein_id="ABF51903.1"
FT                   /translation="MKTLVWVEHDGKAVKDATLAVVTAASKLGEVHLLVAGSGVDAVAK
FT                   EAAQIAGVGKVHVADNAAFDHNLPENVAPLIAELMSSHDAFLAPATTTGKNIAPRVAAL
FT                   LDVMQISEILSVEGPKTFTRPIYAGNAIATVESSDAKLVLTVRGTAFEKAATSGGAGTI
FT                   EAVAAGSDAGISSFVGAEIAKSERPELTSAKIIVSGGRALGSSEKYQEVIVPLADKLNA
FT                   ALGASRAAVDAGYVPNDYQVGQTGKIVAPEVYFAIGISGAIQHLAGMKDSKTIVAINKD
FT                   EDAPIFQVADLGLVADLFSAVPELTAKI"
FT   gene            183563..184933
FT                   /locus_tag="Sala_0180"
FT   CDS_pept        183563..184933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0180"
FT                   /product="conserved hypothetical protein 341"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51904"
FT                   /db_xref="GOA:Q1GWR8"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR8"
FT                   /protein_id="ABF51904.1"
FT                   /translation="MAGHHPGVPGLGDAPFNAGGRRSARPGAGREVDEDDDGIGDDDVH
FT                   GRALVLASVARDARLNKKFLLLITLSAAIATLGLLQSSAAVVIGAMLVSPLLGPIMGIG
FT                   FGLATLESNLIKRSLVTMAAGMAVAIFVAVLIIWLSPIRDVTPEVRARTQPTLLDLGVA
FT                   VVGGIAGVYAIMRKLSGVMVGVAIATALVPPLSTIGFGLATGRFDFAVGAALLFLTNTL
FT                   AIAFAATIIARFNRFGPSLTPQHTAMQVTGILFTLGILSIPLALTLNNLAGEVRARSIV
FT                   QAELRSLLDESDRVDSMNVRMERDTVAVDGVILVDRYVAKLDTELAVRIRKALDRDARV
FT                   SIVQLRQQTNAAVQVEEQLNRRLATLEQREEDARAILAGLTVGELVRRDRVLIDAQARR
FT                   VVVQRDREAEGEQVAAAVDRIMAAVQASHPRWLVQNGALTAAEEPEKTEAESSPATP"
FT   gene            185217..187952
FT                   /locus_tag="Sala_0181"
FT   CDS_pept        185217..187952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0181"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51905"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR7"
FT                   /protein_id="ABF51905.1"
FT                   /translation="MAQDADPAAEAGGEEEIVVSGFRASLESAVGAKKERDQVVESISA
FT                   EDIGKLPDASIAESIARLPGLTSQRVSGRSNSISIRGFAPDFSTTLLNGREQTSTGDNR
FT                   AVEYDQYPSEVINQVLVYKTPMASIVGQGLSGTVDLRTIRPLEYGKSVISIGARGSLAD
FT                   LGKLNAGSKKYGYRVNGVFVDQFANDTIGVALSASYVDEPYQIQEFNAWGYAGAGTAAS
FT                   PVVIGGSKSYATSTQLTRLGLQGTLQWQPHPNFTSTLDAFYSDFKDDQIKRGIELPLAF
FT                   GGAGVNVTDIDESGEFVFARAGTFTNVEGVVRNDVFERKAKLYSFGWNNRWEGDDGWNV
FT                   TADVSLSKTDRNELIFESNAGTGRGGGVGAVDTIGFRSDRNGTVFSPTLNYGDYDLIQL
FT                   TSPLGWGGDQTSVDGRRILGGQDGYYNNRIIEDELWQYRVEVERELEGFFRSVQFGVNY
FT                   TDRSKSLVPDEAFVGLVANTDGLTSVPVPEQFRLGTTDLEYLGLGPVISYDPRDLLAAG
FT                   LYQLVPNPYGDVVVKAYDVSEKLMTTYVQANIDHEMGSSLLTGNIGVQAIFTDQNSNGA
FT                   SASFIGTNPNGSPNIQGIPQRRSTDYVDVLPSLNLSLRTAGDFVIRFSAAREIIRPRLD
FT                   DMRASLSYGTTVGDPGGMTCPAGRLCAVVRGDAGNPDLRPWRANAVDLTFEKYFGSKGY
FT                   LALQLFYKDLKSYIYNQAIPFDFTGYPIAPVGNDSNGNPIIVNFMGTVNAPINGEGGEL
FT                   YGAEVAGTLPFGEIVGALDGFGVTGGASYTKTKIAPTPGAPAEDIPGYSKWVANGTIFF
FT                   EKWGFNARASARYRSSFVGELSGFGGNRVRRRARPETIIDAQIGYDFQPGSALEGLSIF
FT                   VQGQNLTDEPFVTDDPRDARAVIDYQVYGRRFLAGASFKF"
FT   gene            188026..189534
FT                   /locus_tag="Sala_0182"
FT   CDS_pept        188026..189534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0182"
FT                   /product="tryptophan halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51906"
FT                   /db_xref="GOA:Q1GWR6"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR6"
FT                   /protein_id="ABF51906.1"
FT                   /translation="MTPMRIIIIGGGTAGWMAAACFTRFLPPGWSVTLVESDAIGTVGV
FT                   GEATIPQIRLFNQALGIDEDEFLTATQGTIKLGIEFADWTRPGHRYMHAFGAIGRGLGL
FT                   LEFQHYWLRARAAGVAGELGTYSLNETAAHARRMQRGAPRTSPHLAEMPYAFHFDAALY
FT                   AAYLRRRAEAGGAQRVEGKVADVRLDGDSGNVAGVTLDDGRRIDGDLFIDCSGFRGLLI
FT                   EGALATGYDDWSRWLINDRAIAVPCVHGATPQLPWTGATAREAGWQWRIPLQHRIGNGY
FT                   VYSSHHISDEDAERTLLAHLDGAPQAQPNRLRFVSGKRRKLWNRNVVALGLASGFMEPL
FT                   ESTSIHLVQSGISRLLKMLPVGVADPAVAAEYNRQSDFEWERIRDFLILHFKATERRDT
FT                   RYWQDRAAMPIPDTLAAKIDQFRAQGLIFREHEELFTESGWLQVLIGQGIEPRAWHPLA
FT                   DGIGEAELAKYMAGISLMIEREVAVMQSYDDFLAATRPAAGVAA"
FT   gene            189531..191333
FT                   /locus_tag="Sala_0183"
FT   CDS_pept        189531..191333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0183"
FT                   /product="alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51907"
FT                   /db_xref="GOA:Q1GWR5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR5"
FT                   /protein_id="ABF51907.1"
FT                   /translation="MMRRLAAFALLLAPLPVAADEAALRVRPANDEIIYFVLPDRFENG
FT                   DASNDRGGLKGDRLATGYDPAAKGFFHGGDLAGLTKRLGYIQGLGATAIWFAPIFKNKP
FT                   VQGAPGQESAGYHGYWVTDFTQVDPHFGTNAEFKAFVDAAHARGMKVYMDIIANHTADV
FT                   ITYKEGAATDFRYRSLADYPWSRRGGVDGPAINPGFAGDGVASADNWAKLTDPAFAYTP
FT                   VVPKGEERVKVPAWLNDPIYYHNRGNSDWVGESALYGDFAGLDDLATENPRVVQGFIDI
FT                   FGRWIDEFGIDGFRIDTAKHVNPEFWRAFVPAMQARAKARGIPNFHIFGEVYIDGVDPG
FT                   ALAAWTHSAGLPAVLDFSFARAVIDSVSGTRGTDLFARLFDGDVLYKGGADAALQLPTF
FT                   LGNHDMGRFAMFVKQANPDADDAELLARTMLGHAMLLTLRGVPTIYYGDEQGFVSDGHD
FT                   QLAREDMFASKVAVYNDNDLIGTDATTADANFDTAHPLYRHIAALAGIRRSTPALMRGA
FT                   TKLRAFSDKPGLLAVSRFDPDTGREVVLAYNTSAAPLRATISVDMKSAAFTALHGDCPA
FT                   RPVAPGSLSISLPAFGTLICQASE"
FT   sig_peptide     189531..189590
FT                   /locus_tag="Sala_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            191345..192988
FT                   /locus_tag="Sala_0184"
FT   CDS_pept        191345..192988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0184"
FT                   /product="alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51908"
FT                   /db_xref="GOA:Q1GWR4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR4"
FT                   /protein_id="ABF51908.1"
FT                   /translation="MTPYQPLAQDQLAPAADADTPWWKGAAIYQVYPRSFADSNGDGVG
FT                   DLAGITARLDHIASLGVDAIWLSPFYPSPMDDFGYDIADYCGVDPIFGTLADFDALVAR
FT                   AHALGLKVTTDLVFAHTSDRHAWFAESRASKDNDKADWYVWADARADGSPPTNWQSVFG
FT                   GPAWTWDARRGQYYMHNFLSSQPQLNVHNRDVQDALLGVVRFWLDRGVDGFRIDAINFA
FT                   MHDPEFRDNPPAPPSNKVRTRPFDFQQKIYNQSHPDIALFLERIRALTDEREGCFTVAE
FT                   VGGDDAMREMKLFTAGETRLNSAYGFDFLYADRLTPQLVREAAEAWPDAPGIGWPSWAF
FT                   ENHDAPRALSRWTPQDVDRDAFARMKMALLCALRGNIIIYNGEELGLDQVDIPFDQVKD
FT                   PEARKNWPLTLSRDGARTPLPWAAAAANAGFSEADPWLPLGPSHRDLAVDRQQDDPASL
FT                   LNLTRRLVALRAAHPALRLGGNANWVAEGDLLAFDRVAGEQRIRCLFNFGGGAIGISAL
FT                   ADGRAPLIALNGADTAQLPPCGALWLKMEG"
FT   gene            192991..195033
FT                   /locus_tag="Sala_0185"
FT   CDS_pept        192991..195033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0185"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51909"
FT                   /db_xref="GOA:Q1GWR3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019563"
FT                   /db_xref="InterPro:IPR029483"
FT                   /db_xref="InterPro:IPR029486"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR3"
FT                   /protein_id="ABF51909.1"
FT                   /translation="MLRLAPLALLAAAAAPAAAQQAPAPVTATSPDRSLVLTVTTDNDA
FT                   RPTWSLSRKGKLLIAPSKLGFLMADRVGLQRGFRIEGSETASADSRWEQPWGERRFVRD
FT                   QHNELLVRFRQHESWGGHAMNVRFRLFDDGIGFRYELPEQEGLKTAKIADEITEFDIAA
FT                   EGTAWWIAGGEWNRYEQVYQQTPIDAVSTAHTPITMRLADGTHLAFHEAALVDYAGMWL
FT                   KRVEGRKFRATLAPSSQGPRVVRDLPFATPWRTIRISDDAAGLVESDLELNLNEPNKLG
FT                   DVSWVKPMKYIGIWWGMIRGPWSWAEGPNHGATTERTKQYIDFAAKHGFGGVLVEGWNK
FT                   GWNSNWFGHGDAYSFTEAYPDFDLKAVTDYARKKGVTLIGHHETGGNIAVYEAQLDDAM
FT                   KLYGQLGVRAVKTGYVADAGGIIAPGATPGSKAMEWHDGQRQVQHHQKVVETAAKYKVA
FT                   VNPHEPVKDTGLRRTWPNWVAREGARGMEYNAWGAFANNPDHEPTLVYTRMLSGPMDYT
FT                   PGVFSLKGAEDVPMTSTLAKQLGLYLAIYSPIQMAADFIENLEAHPRELAFVKQVPTDW
FT                   AESHLIAGAVGDYAIFARKDRKSADWYVGGVNDGTERTLTLSFDFLDPGKTYTATIWKD
FT                   GDGATYLTDARRNIAYDTIKVKKGDTYKLWLAPGGGAAMRVTPGR"
FT   sig_peptide     192991..193050
FT                   /locus_tag="Sala_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.881 at
FT                   residue 20"
FT   gene            195234..197504
FT                   /locus_tag="Sala_0186"
FT   CDS_pept        195234..197504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0186"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51910"
FT                   /db_xref="GOA:Q1GWR2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR2"
FT                   /protein_id="ABF51910.1"
FT                   /translation="MAEHRPRYKRYDRPAGGWGAAAATAKVLLEQSVVTKGSRALLSMN
FT                   QPGGFKCPSCAFPDAACTKKLEFCENGAKALAHEATKFRVTRDFFAQHSVTELIAQSDH
FT                   WLEMQGRLTEPMRYDAATDHYVPVGWDDAFALIGRHLRALDSPHRAEFYTSGRTPNEAA
FT                   FLYSIFVREFGTNNFPDCSNMCHEPTSRGLPSSIGIGKGTVILEDFDHAEAIFLIGHNA
FT                   GTNAPRMMTPLVEARKRGVPIVAVNPMPERALIRFTEPQDIVQMATFGSTEISSEFVHI
FT                   KIGGDLALLKGMMKVLFERDAAGEAVLDHDFIAEHTEGLAALCADVEAQSWDAITAAAG
FT                   VDAAQIRRCADIYIRSNATIICYGMGVTQHQRGSELVQQVANLLLLRGNFGKPGAGISP
FT                   IRGHSNVQGDRTVGIDERPAPAYLDRLRDVFGFDPPREHGHHSVEAVEAMLAGEARVFI
FT                   GLGGNFVRAVPDTTRACAAMQRLDLTVGIATKLNRGHLVHGKDALILPVIARSERIETA
FT                   RGEQFVTIEDSMSNVTASRGVLDPASEHLLSEVEIVCRMAMATLPGSKVDWRRYIDDYD
FT                   AIRDKIAAVYPAIYEGFSQRIRAPMGFHLDIPPRRRVWPTPTGKANFLVLPGLAVNAAV
FT                   DDPAMLRLATVRSHDQFNTTIYSYNDRYRGIYGDRMVLFMNADDRTDRGLEAGARVALE
FT                   TIADDGTARRVEGLTLIDYPMSRGSVAGYYPELNPLLPLAFHDRVSGCPAAKAIPVRVV
FT                   AMS"
FT   gene            complement(197506..198018)
FT                   /locus_tag="Sala_0187"
FT   CDS_pept        complement(197506..198018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0187"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51911"
FT                   /db_xref="GOA:Q1GWR1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR1"
FT                   /protein_id="ABF51911.1"
FT                   /translation="MRTLGAILAGGASRRFGSDKALAMLGGRTLLDHVLAALAPHCDAV
FT                   VVVGRAGGIADWPRPGMGPLGAIAGALDRAASEGFAQVLSVPVDCVRLPGDLAALLSPA
FT                   PAFLDSQPVIGLWPVAVLGELKAMLEAEDDLAMRAFARRIAARAVQCDFAPPNINSLAD
FT                   LERLAKS"
FT   gene            complement(198015..198818)
FT                   /locus_tag="Sala_0188"
FT   CDS_pept        complement(198015..198818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0188"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51912"
FT                   /db_xref="GOA:Q1GWR0"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWR0"
FT                   /protein_id="ABF51912.1"
FT                   /translation="MNDAAIDLPVRRLGLGVPGDVALDRCVAVEAPVSVEVGGIAYAVM
FT                   MATPADLEDYAVGFALSEGLIGASADIRRTDVQPIEGGWALRLWLTTERNAAALERART
FT                   RVSESSCGLCGIANIEEVLRPLPPVTAHIGTDRIAIAAALTALDAHQPLGRATGAVHAA
FT                   AFCSPAGAIRLVREDVGRHNALDKLIGALARAGIDAGEGFMLLSARCSYELVEKTVRAG
FT                   CPMLVTISAPTSLAATRAAAAGLTLVALARPDAALVVADPQGMIA"
FT   gene            complement(198870..200369)
FT                   /locus_tag="Sala_0189"
FT   CDS_pept        complement(198870..200369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0189"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51913"
FT                   /db_xref="GOA:Q1GWQ9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ9"
FT                   /protein_id="ABF51913.1"
FT                   /translation="MADTPPPYDIIVVGGGVNGAGVARDAAGRGARVLLLEAGDLAQGT
FT                   SSKSTKLIHGGLRYLEHYEFTLVREALKEREVLWSIAPHIIRPMRFVLPYRDGLRPRWL
FT                   LRLGLFLYDHIGGRRKLPGTRSIDLRRHVAGAPLQSHYVHGFEYSDGWVDDARLVLLNA
FT                   RDAADRGARVRTRTRAEMLRCDGGLWVVDAADDQGHRYRFTGRSVVNAAGPAVLDLLKR
FT                   ADAEPDHQMRLVRGSHIVVRRLFEHHYSYFFQLPDGRIFFAIPYEHDFTLIGTTDVDHD
FT                   GPASEAQASEAEIAYLCEGASLYFRTPVTPADVVWTYSGVRPLVEDGSGRPEAATRGYR
FT                   IDLDMEEGAPLLTIYGGKITSYRHVAEEAVDALARHVPALTGKHWTAKAALPGGDFPMT
FT                   GAAALAAEYRSAHPFLAATTAERIARAYGTGARRWLGDAGDWDALGGEIAHGLSVAEVE
FT                   WMVEQEWARTADDILWRRSKLGLVFGEEDKARFAATLRELQ"
FT   gene            200525..202063
FT                   /locus_tag="Sala_0190"
FT   CDS_pept        200525..202063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0190"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51914"
FT                   /db_xref="GOA:Q1GWQ8"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ8"
FT                   /protein_id="ABF51914.1"
FT                   /translation="MRLTYARCIRGAHPPLLSLLSKGTNVSVKVETLVLFGATGDLAQR
FT                   MLFPSLYNLHMDGLLADALTIVGSGRSAMDRDAFRAQVRAALTEYLPEDRIEAAVVDGF
FT                   LARIDYCAIDAGAGTGYAELAALLGDRMARPIGVYLSTPPSMFGPIAQGLKAANIACAE
FT                   CRIAMEKPIGHDLASSREVNAQVGDAFAEDRVFRIDHYLGKETVQNLLALRFANMLFEP
FT                   LWNAQAIDHVQITVAETVGLEGRVSYYDGVGALKDMVQNHMLQLLAIIAMEPPASVGAT
FT                   AVRDEKVKLLRSLRKMTAEDVKAHSVKGQYSSGAVNGAAVAGYADELGQPSNTETFVAL
FT                   KAFIDNWRWKGVPFYLRTGKRMPQRKSEVLIQFKPVPHNIFARVGAGKLDANMMIINLQ
FT                   PEENIRVKVMAKQPGLDRDGVKLKEVTMDVSLSHSFAGERRRIAYERLLLDFIEGDQTL
FT                   FVRRDEVEAQWEWIDAIRDAWDQVDMTPQSYTAGSWGPSSAIALIERDGASWHD"
FT   gene            202109..204100
FT                   /locus_tag="Sala_0191"
FT   CDS_pept        202109..204100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0191"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51915"
FT                   /db_xref="GOA:Q1GWQ7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ7"
FT                   /protein_id="ABF51915.1"
FT                   /translation="MARSAWAQLDEGRCRRFRRCRSHPHPASTSEQARKSAHPSPPRGE
FT                   DFGIVMTPLHPTIAAVTDRIIARSAPRRAAYLDLMDRQRDAGTNRGNLSCGNLAHGFAA
FT                   AGDDKPVIRTGAAMNIGIVTAYNDMLSAHQPYGRYPEQIKLFAREVGVTAQVAGGVPAM
FT                   CDGVTQGQAGMDLSLFSRDNIAQGTVIALSHAMFEGALLLGICDKIVPGLLIGALRFGH
FT                   LPQILVPAGPMPSGLANKEKQRVRQLYAEGKATRDELLEAEAASYHGAGTCTFYGTANS
FT                   NQMMMELMGLHIPGSAFTNPGTKLRQALTRAATHRIAQIGWDGDDYRPLGRCIDEKAIV
FT                   NAAIGLLATGGSTNHAIHLPAIARAAGIIIDWQDFDELSHAVPLLARVYPNGAGDVNQF
FT                   HAAGGIGFVVRELLGAGLLHGDVLTVGGTMADYAAEPVLVNDELHWQAAPGQSRDDTML
FT                   RPVADPFSPDGGMRLLTGNLGRAIIKTSAVAEDRWTIEAPARIFDDQNQVLAAFKAGEL
FT                   DRDVVVVVRFQGPRANGMPELHKLTPALGVLQDKGYRVALLTDGRMSGASGKVPAVIHL
FT                   SPEALPGPDGMSGPLAYLRDGDMVRVCAVRGEVAALVDETEWAARSPAAAPPPAVGVGR
FT                   ELFALFRHHADEAEKGGSAVLAAMEAVT"
FT   gene            204199..204819
FT                   /locus_tag="Sala_0192"
FT   CDS_pept        204199..204819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0192"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51916"
FT                   /db_xref="GOA:Q1GWQ6"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ6"
FT                   /protein_id="ABF51916.1"
FT                   /translation="MSDSGIEQIMTLAPVIPVIVIDRVEDAVPMAEALVAGGLRVLEVT
FT                   LRTPAALDAIRAMKRVPGAVVGAGTVLNPRMLKDALDAGSEFIVSPGLTDSLGEAAVAS
FT                   GIPFLPGVANASNVMMGLDMGLGSFKFFPAATSGGIPALKALAGPFGGVNFCPTGGISA
FT                   ATAPEWLALEPVRCVGGSWVVPAGPLDPVRIEALAKEAAALRT"
FT   gene            204922..206478
FT                   /locus_tag="Sala_0193"
FT   CDS_pept        204922..206478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0193"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51917"
FT                   /db_xref="GOA:Q1GWQ5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ5"
FT                   /protein_id="ABF51917.1"
FT                   /translation="MPRPQPHLDEVLASEPGSHIAALFDFDGTIIAGYSATAMLREKFQ
FT                   RREMSVEEIAETAQVIAQHSLGQIGFSGLMTAAARFMKGVDEQSFIDFGEELYRKHIAR
FT                   KIYPETRAIIEAHQAKGHRVAIISSATIYQIEPTARDLGITDIKCSAYEIEDGVFTGEI
FT                   IRPLCFGEGKVLAAEDLAADYGLDLDQSYFYSDSDDDIELLERVGKPRPLNPNMKLKAI
FT                   ADERGWPVQRFASRGTPSWIDYARTLYATGSLVGAFAAGLPIWALTRSQREAVNFSMGL
FT                   FGDFATAITGVELEVEGERHLWSSRPCVFVFNHQSKADVMILAKLIRRDMGGVGKKEIR
FT                   DIPILGKLMEWGGTVFVDRADGKSAIKAMEPLIDAIQKEGKSICIAPEGTRSLTPKLEP
FT                   FKKGAFHLAMQAGVPIVPIVIHNATDVAPKNEFVMRPATVRVTVLPPVDTSGWSVRTIN
FT                   NHVRDVRNMFLRTLGQPQESVAESVAREAAVEAKGEKTPKKAATKRAAPKKKATGKSAK
FT                   A"
FT   gene            206601..208952
FT                   /locus_tag="Sala_0194"
FT   CDS_pept        206601..208952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0194"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51918"
FT                   /db_xref="GOA:Q1GWQ4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ4"
FT                   /protein_id="ABF51918.1"
FT                   /translation="MPDGSPRTPIVTEQAADRLYIIDARNGVERRILLDWIHATSDGAG
FT                   SDDEPGWASLDIEDGDHALPVDVLQARLGATPSRLVVPLRVAWRIPGFDKGRALKFRHL
FT                   IFGDPRHPGSLRARLILLRDRRRAQILVGEAATLDALRSRFCAQTGGGDGEGADSPEFA
FT                   RFVARQAALALDVAERGIRGTRYKVPRFVADGLRTSPKFRAALADLAEKTGRPVADLFR
FT                   EARPLMKEVIARPSALFLDLRARLDRMMFGGYAPDMEIDAAELAKLRGILREHPTCILF
FT                   THKTYIDGATPSRLAYENDLPMLHSFGGANLDFAVMGEFFRRSGMIFIRRSFQDQPVYK
FT                   LVLRHYIAWLLAKRFPLSWAFEGTRSRLGKLMPPKYGLMKYVLDAAHATGTRGVHFIPF
FT                   VTSFDLIRDVEEYAAEQTGRNKKPESLSWFIGYMKSLKEPSGRIRLDIGDPVVIDTAPG
FT                   PDDRRALEKIAFAVAVEANRVTPLTVTSVMCLILLGMAPRGATSAELLGAIGAVTGWAR
FT                   ARGIRLSSELESGGDAALSATIDTLVTSGLLARYEAGSETIYSIDPAKHPMASYYRNII
FT                   AHHFLGRAMIELALFALRDADSGDATAAFWDRIDRLRDLFKFEFFYPPRDEHMASLRAE
FT                   LTRIDPVWDRRLASGDRGIAQLIRRCQPVVGHAILLPFAEAYSVVAELLARARPGDAVD
FT                   EKTLLDAALVEGKQAYLLRRISSEAAIGKLLFANGLSLMRHMGLADEATPEIIAQRRAL
FT                   LMELRGLANVMETMRLSTVALADRLMGAGE"
FT   gene            209034..210590
FT                   /locus_tag="Sala_0195"
FT   CDS_pept        209034..210590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0195"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51919"
FT                   /db_xref="GOA:Q1GWQ3"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ3"
FT                   /protein_id="ABF51919.1"
FT                   /translation="MLKQLSAQDAQFLYTQTANNLTHIMGVYIYDPSTAPGGFVRFKDI
FT                   IAHVESRVDTSPLFKRRLHRLPFDIDHPYWVEDEHFDVEAHMSHARLPEPGDWRQFCIA
FT                   VARWFSKPMDMNRPLWDIYVIEGLDRIPGIPKGSFAMLHRVHHAAVDGASGAHAFIAMS
FT                   DIDANGTPAIAEPPPVEDLGDPPSSAEILSRAWSASMQSPVKFMNALMKISPAIVASAR
FT                   RSIAEGGMTAGVPETRFNVPVGPHKMFDGTTVALADVAEIRRKVPGATVNDVVLTTVGG
FT                   ALRKYLAKHKELPKESLVAVAPVNLRGKGGKASTPGNQVSAMSVPIRTDIADPLERLAA
FT                   VRDYTVEAKEAKAGVSARIMTDLSQHIPGATMAAVARLVTSERFAVRGTNLFISNVPGA
FT                   QVPLYLAGARLVQQHGMAPLANNMGLFIATPSYNGRIAFSIISERAIMPDIAFFRTCID
FT                   ESFADLMAADPKPEKPKAATAKPKAAAKPKAKATAKADRKNTSSSSRRRPGSRPRVKSP
FT                   R"
FT   gene            210709..212157
FT                   /locus_tag="Sala_0196"
FT   CDS_pept        210709..212157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0196"
FT                   /product="Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51920"
FT                   /db_xref="GOA:Q1GWQ2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ2"
FT                   /protein_id="ABF51920.1"
FT                   /translation="MLFTPTLSADRDLATAPDYAAWSKAAREHDRKSGMQAWRDADESK
FT                   HFDYKAIRARLEKLRKLSAAGDVKGLLFVLNEGIHGNIDGMGHERLYQKARFGTKKLVE
FT                   AYIAEVVASLDKIAAARSIGREEKRDFFRRAQHCYGRSALLLSGSGSFLFFHIGVVKAL
FT                   WSEGVLPSIMSGASGGSIVAAVVCTRKDADIGAFLESERLANPDRAPDGRRLASDAVRE
FT                   RLAGLIPDLTFQEAYEISGRHLNVSVAPAEKHQNGRLLNAITAPNVLIREAVLASCAVP
FT                   GVFPPVMLMARDDDGARIAYQPDRRWVDGSVTHDIPTRRLERLYGVNHHIVSQANPIAL
FT                   PFATDTRKQMAPIEAIQHASMTTFKAWLNANMVIFQKPLELIPPLNSLANMARSVINQE
FT                   YTGDINIIRPPKFWSPAKILSDLGQDDIDELVDTGMRTAWPKIEMVRTQTAISRALEAI
FT                   LAKIDKAGDDGPGHRSAALKKAVR"
FT   gene            212154..213020
FT                   /locus_tag="Sala_0197"
FT   CDS_pept        212154..213020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0197"
FT                   /product="Acylglycerol lipase"
FT                   /EC_number="3.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51921"
FT                   /db_xref="GOA:Q1GWQ1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ1"
FT                   /protein_id="ABF51921.1"
FT                   /translation="MSADNEPLTLPAWQGGDGSNLNVTRWLPQGDPKAVVLLAHGYAEH
FT                   AGRYGHVAARLTAAGYAVYAVDHWGHGKSSGTMGFVPAFSVYIDGMAALIARVREAWPG
FT                   KPRLLLGHSMGGLIAALLLLGHQRDFAAAALSGPAILTAKPPSRLTIWISRLLSRYFPR
FT                   AGVMALDPTGVSRDPAVVAAYLADPFVHSGKMSARLAAEMFDAMATARDRAPEIGLPLL
FT                   LQHGAEDRLTAPAGSRFLFDHVASTDKRLEIYAGLFHEIYNEPERDAVLDDLIGWFDAH
FT                   VKVEDAP"
FT   gene            213017..213952
FT                   /locus_tag="Sala_0198"
FT   CDS_pept        213017..213952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0198"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51922"
FT                   /db_xref="GOA:Q1GWQ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWQ0"
FT                   /protein_id="ABF51922.1"
FT                   /translation="MKILLFLIVAPLIALALLYFLFPEQLVRMMRALMRKRARVVRRSI
FT                   TVDGRNWPYLEGGDPSKPTLVMVHGFGADKDHWIFYAPWMTRDYHLIAPDLPGFGENDR
FT                   DGALPFDVASQAARLKAFLDALGVDRPHLGGNSMGGWIALRFAIDYPDRLRTLTLMNNA
FT                   GVVGENESELQKLAATRDYNPLVLANLDDADRLIAFVVRKPTYVPARLKPVIYADALRH
FT                   RELLDRIFWIIADEMEQAPLNGELDKVTVPTLILWGRHDKLIDVSCVAVLEKGIANSRA
FT                   HIFEHVAHVPMIEDPKATAEVQRAFLADHP"
FT   sig_peptide     213017..213067
FT                   /locus_tag="Sala_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.694) with cleavage site probability 0.383 at
FT                   residue 17"
FT   gene            214037..215038
FT                   /locus_tag="Sala_0199"
FT   CDS_pept        214037..215038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0199"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51923"
FT                   /db_xref="GOA:Q1GWP9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWP9"
FT                   /protein_id="ABF51923.1"
FT                   /translation="MRLKVGLLGGGSWGTTVAAVVSRNAPIQLWARDAETVEGINRDHE
FT                   NRKYLPGITLPPALGATSDMAEVVAGADVLVMAVPSHSFRSVLEEARDHIRPWVPVISL
FT                   TKGLELASGKRMTELIEDVLPGHPVGVLTGPNLAREIMAGQAAASVLSMADEIVVRALQ
FT                   PLFHSGLFRVYTNTDLLGCELGGVLKNIIAIAVGMGDGLGAGDNTRAGLMTRGLAEITR
FT                   LGVAMGGRPETFAGLTGMGDLIATCTSPLSRNRHVGVELGKGRPIDAIIAGMNMVAEGV
FT                   KSAPTVMALADRHGIAMPIARDVFDVTQGKRTAMDVFRGLLKSSVGDEAHPG"
FT   sig_peptide     214037..214096
FT                   /locus_tag="Sala_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.901) with cleavage site probability 0.444 at
FT                   residue 20"
FT   gene            complement(215170..215739)
FT                   /locus_tag="Sala_0200"
FT   CDS_pept        complement(215170..215739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0200"
FT                   /product="thioredoxin domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51924"
FT                   /db_xref="GOA:Q1GWP8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP8"
FT                   /protein_id="ABF51924.1"
FT                   /translation="MILGLLLAGSVAGCDREKAGGGQAQQGQANVSAGQATGAAKFDYM
FT                   IDRSHRGTAAPTATFTGPDDAPVTLADFRGRPLLVNLWATWCAPCVAEMPTLDALAAAR
FT                   GEAMTVVAVAQDLQGAEVVDPWFRKARLKALQPYLDPENGLLDAANSALPTSIYYDAEG
FT                   REIWRVVGAIDWQGDEAKALLAEGIR"
FT   gene            215765..217171
FT                   /locus_tag="Sala_0201"
FT   CDS_pept        215765..217171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0201"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51925"
FT                   /db_xref="GOA:Q1GWP7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWP7"
FT                   /protein_id="ABF51925.1"
FT                   /translation="MANTPDKSSMWGGRFGGGPAAIMQEINASIPIDKRLWEEDIAASR
FT                   AHAAMLGACRIISADDAAAIDRGLAQIAEEFAENGVPVDLSLEDIHMTVEARLKELIGE
FT                   PAGRLHTARSRNDQVATDFRLWTRTACERIDAGLAALQSALLQRADEHADSIMPGFTHL
FT                   QVAQPVTLGHHLLAYVEMARRDRGRFADARRRLNESPLGAAALAGTGFPVDRDATAAAL
FT                   GFDRPMANSIDAVSDRDFALEFCAAAAIAAIHLSRLAEEIVIWASQPFGFVALPDAWST
FT                   GSSIMPQKRNPDAAELVRGRAGLLLGAFQRLAVIVKGLPLTYSKDLQDDKETLFGAFDA
FT                   LALSLAAMTGMVETLSFRTDRMRALAASGYSTATDLADWLVREAGLPFREAHHVVGACV
FT                   RRAEELGVELPALPAADAAAIHAAVTPDVLAALTVEASVASRMSYGGTAPERVRQAIAA
FT                   ARAAAAQGQD"
FT   gene            217171..217422
FT                   /locus_tag="Sala_0202"
FT   CDS_pept        217171..217422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51926"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP6"
FT                   /protein_id="ABF51926.1"
FT                   /translation="MSHRHHILATLAVAALLGACGAKEDLKPPANQPAPVVPIGADRAP
FT                   TTQELTTPDAQARPARSDELLKRSEQREPDDFDLPPPG"
FT   sig_peptide     217171..217239
FT                   /locus_tag="Sala_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.894 at
FT                   residue 23"
FT   gene            217574..218833
FT                   /locus_tag="Sala_0203"
FT   CDS_pept        217574..218833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0203"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51927"
FT                   /db_xref="GOA:Q1GWP5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP5"
FT                   /protein_id="ABF51927.1"
FT                   /translation="MDHFEYRDGVLHAEDIPLPRIAKEIGTPVYVYSRATLERHAQVFA
FT                   DALRDIPRKHIAFAIKCNPNLGVLRVLARQGYGADVVSGGELERALAAGMAAEDIVFSG
FT                   VGKTRAELAQGLDRGIGQFNIEHEPEGVALSEIAVAKEMTARAVLRVNPDVDAGTHAKI
FT                   STGKAENKFGVGIDSAPAIFDRLSALPGLKMRGVALHIGSQLTSLDPLEAAFERVGRLV
FT                   ADLRAAGHSITHVDLGGGLGVPYRPEDNPPTPAEYGAMVARVTKDWDVTLMFEPGRVIA
FT                   GNTGVLLTEVLWVKPGATHPFVIVDAAMNDLARPALYDAWHDFVAVKPTGEKMIASIVG
FT                   PVCETGDTFARDREIDAVQPGALAVFRTAGAYGATMASTYNSRSLVPEVLVDGDRYITV
FT                   ADRIAAGTIMAAERVPDWID"
FT   gene            218984..219766
FT                   /locus_tag="Sala_0204"
FT   CDS_pept        218984..219766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0204"
FT                   /product="siroheme synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51928"
FT                   /db_xref="GOA:Q1GWP4"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP4"
FT                   /protein_id="ABF51928.1"
FT                   /translation="MHQLPIFLNLTGRTVVLVGEGEAAEAKARLIQRAGGRIISAWEAG
FT                   ATIAFVALGDEAAARAAADALRAHGLLVNVVDRPDLCDFTTPAIVDRAPVTIAIGTGGA
FT                   SAGLAKAIRQRLEALLPARLGDLAGALYAARAAMKARWPVAADRRRAIDAALAPGGALD
FT                   PLDAGAADRVGEWLAAAAPDRPSRLETIRLTSADPDELTLRAARLLGEADHVFHPPHIP
FT                   AAILARTRADAARHIAAAPPRESPPGLSLWLEMQVIAL"
FT   gene            complement(219907..220932)
FT                   /locus_tag="Sala_0205"
FT   CDS_pept        complement(219907..220932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0205"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51929"
FT                   /db_xref="GOA:Q1GWP3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014317"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP3"
FT                   /protein_id="ABF51929.1"
FT                   /translation="MERETQFIGQSAAFQDAVDRASQAALLDRPVLVIGERGTGKELIA
FT                   ERLHRLSTRWDRPYVIMNCAAMPETLIESELFGHEAGAFTGATRSRAGRFEEADGGTLF
FT                   LDELATMSMGAQERLLRAVEYGEITRVGASRPIRVDVRIVAATNEHLPALVEENRFRAD
FT                   LLDRLSFEVITLPPLRAREGDIEVLATYFGQRMAAVVGWDEWPGFGPRALAAMEGHDWP
FT                   GNVRELRNVIERAVYRWGDPTKPIDALSFDPFASPWQPTVRAAKAERANAAASVAAPPA
FT                   APSPSPGPVSDLRAAVDSYEKAILADTMARCRYNQKVAAEALGLSYDQIRHALKKHGLN
FT                   Q"
FT   gene            221032..221277
FT                   /locus_tag="Sala_0206"
FT   CDS_pept        221032..221277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51930"
FT                   /db_xref="GOA:Q1GWP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP2"
FT                   /protein_id="ABF51930.1"
FT                   /translation="MARLLQRFLRTGAQRSGAAHRKVETMKTKIAQAATFAFSAVGALA
FT                   IFVGAINYPAASASAAGLPVVGLVGAASTPAVGPMA"
FT   sig_peptide     221032..221214
FT                   /locus_tag="Sala_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.861 at
FT                   residue 61"
FT   gene            221379..222041
FT                   /locus_tag="Sala_0207"
FT   CDS_pept        221379..222041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0207"
FT                   /product="phage shock protein A, PspA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51931"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="InterPro:IPR014319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP1"
FT                   /protein_id="ABF51931.1"
FT                   /translation="MGIFSRTRDIIAANVTDLLDRAEDPEKMIRQIIFEMNETLVEVRA
FT                   SAARTIADQKEMRRHIAKLESLQDSWKEKAELALSKDREDLATAALVEKQKAGDMAERL
FT                   KAEIAVLDDALSGYEADIAKLQKKLSEARARQSNIVNRLESAENRYRLREMTNGDRVED
FT                   AFSRFEILERRVDEAEGRADALGLGYKKSLDEEIAELQAADKVADELAALKAAQAKK"
FT   gene            222054..222329
FT                   /locus_tag="Sala_0208"
FT   CDS_pept        222054..222329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0208"
FT                   /product="phage shock B"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51932"
FT                   /db_xref="GOA:Q1GWP0"
FT                   /db_xref="InterPro:IPR009554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWP0"
FT                   /protein_id="ABF51932.1"
FT                   /translation="MEEVIIVPIVIGTLFLGLPWLILHYITKWKQAKTLTGEDEQLLDE
FT                   LYDTARRLENRLHTVERIISADHPDFRPAVRSDEELAQLENINRRN"
FT   gene            222331..222711
FT                   /locus_tag="Sala_0209"
FT   CDS_pept        222331..222711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0209"
FT                   /product="phage shock protein C, PspC"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51933"
FT                   /db_xref="GOA:Q1GWN9"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR014320"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN9"
FT                   /protein_id="ABF51933.1"
FT                   /translation="MSASRTKFYLDKQNAKWSGVCSGIADYSGIDVLWVRVGAVLLTLM
FT                   GGFPWTLIAYWMVAWMGSPKPFALYGSQEEAKFWQGVRSNPAASTRDIKSRFRDIDRRL
FT                   ADIELYYTSHNRRLADEIESLR"
FT   gene            222744..223043
FT                   /locus_tag="Sala_0210"
FT   CDS_pept        222744..223043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51934"
FT                   /db_xref="GOA:Q1GWN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN8"
FT                   /protein_id="ABF51934.1"
FT                   /translation="MNFGGTTFVLAIIALSIGGWMFTTWIRAKHGYPVENEWGGTVHRT
FT                   DPDADRKIRLLTDDNAKLASQVSRLEERIAVLERIATEEGGKAAQLADQIDRLR"
FT   gene            223052..223372
FT                   /locus_tag="Sala_0211"
FT   CDS_pept        223052..223372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51935"
FT                   /db_xref="GOA:Q1GWN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN7"
FT                   /protein_id="ABF51935.1"
FT                   /translation="MMNLDVLNAIAPVAALVGLAGVAGWVFTTWLRVKNGYPLENSWGK
FT                   AVYPRTNDEAMERVKLISQENAQLRAELGSVKDRLAVVERIVTDESHRVAAEIEALRRP
FT                   AN"
FT   gene            223385..223648
FT                   /locus_tag="Sala_0212"
FT   CDS_pept        223385..223648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51936"
FT                   /db_xref="GOA:Q1GWN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN6"
FT                   /protein_id="ABF51936.1"
FT                   /translation="METIIILFIVVGLPVTLGIGYAAYERHLKFKERQFQAISSETAEK
FT                   AAQYAVHTERLEQRVRVLERIVTDKGIDVADEIEKLRDAPLN"
FT   gene            223681..223941
FT                   /locus_tag="Sala_0213"
FT   CDS_pept        223681..223941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51937"
FT                   /db_xref="GOA:Q1GWN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN5"
FT                   /protein_id="ABF51937.1"
FT                   /translation="MGPFEMVVGIVLIVTIGSIIRARYGIRRDRHGNGHVAGHDVETKA
FT                   LQAEIRALKERIQVLERIATDHNRAVTLDQEIEKLRDGSKI"
FT   gene            223965..224210
FT                   /locus_tag="Sala_0214"
FT   CDS_pept        223965..224210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51938"
FT                   /db_xref="GOA:Q1GWN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN4"
FT                   /protein_id="ABF51938.1"
FT                   /translation="MAFITPDLTTAAIALTALTIVSLVALRGWRDWIQLKREELAAGHT
FT                   QLAHDPTVPHAGSRIEIADLKERLRKLEAIAAGVDL"
FT   gene            224369..224779
FT                   /locus_tag="Sala_0215"
FT   CDS_pept        224369..224779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0215"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51939"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN3"
FT                   /protein_id="ABF51939.1"
FT                   /translation="MRSLSDIFEEYEFLDGDDRYRLLIELGRELEPMPDALKTDATLVR
FT                   GCSASVWVYPVPRDDGRLHFLADSNAAITKGIVALVLAAVQDKPAAEVADMDVAAALAP
FT                   FDLTRQLSSNRTQGVPNMIALVRDTARRLAAG"
FT   gene            complement(224784..226157)
FT                   /locus_tag="Sala_0216"
FT   CDS_pept        complement(224784..226157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0216"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51940"
FT                   /db_xref="GOA:Q1GWN2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN2"
FT                   /protein_id="ABF51940.1"
FT                   /translation="MRNLSLPLALAAALVAAAPAHAKPADAAAAKQILKDSIAIPTVKG
FT                   RGKVPELAAYYAGVLKAAGYADADIEITPMGETATLAVTLRGTTDKKPILLLGHMDVVE
FT                   ADPKDWTRDPFLPVEEEGYIFGRGSEDNKFDIAMMVATMAQLKRDGFKPKRSIILLLTG
FT                   DEETEMATTRALAAKYRNAEFALNGDGGGGLIGEDGKPQYYSLQAGEKTYADFTLEVTN
FT                   AGGHSSRPSPVNAIVQLADALVKVGAYRFRPQVNELTRIGLPIVADRVGGEIGAALKTF
FT                   AADPTDTKAIATIRADPEYVGQIGTTCVPTLVKGGHAENALPQRATANINCRIFPGVAV
FT                   EAVRSELERVIADPAVKVLTDPDASASDASPLRADVMAAVKKAVHARAPGLPIIPSMSA
FT                   GATDSYHFRMNGVPSYGVAGLFSKASDSFAHGLNERVPVAAIAPALAHWDSLLRELSN"
FT   sig_peptide     complement(226089..226157)
FT                   /locus_tag="Sala_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            226308..227210
FT                   /locus_tag="Sala_0217"
FT   CDS_pept        226308..227210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0217"
FT                   /product="band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51941"
FT                   /db_xref="GOA:Q1GWN1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN1"
FT                   /protein_id="ABF51941.1"
FT                   /translation="MVESGAPALNRSRETRANTQSGYWMLFIWLVLLGIAVWAAITNAN
FT                   ADVVMAWKWIVAATAAVVGTLILCGFYLINPNEAAAIQLFGAYKGTDRQEGLRWVLPWL
FT                   TRKKIAVRANNVISDKIKVNDLRGNPIEMAAQVVWRVTDTAQALFDVDDYKEFVMAQIE
FT                   AAVRSIGSRYPYDDIEHQEVTLRGNHEEVGAELRKALIERLTVAGITVDECGLTHLAYA
FT                   PEIAGAMLRRQQAEAVIAARKKLVEGAVTMVEMALQHLSDKKVVDLDDERKAAMVSNLM
FT                   VVLCGERDTQPVVNAGSLY"
FT   gene            227230..227439
FT                   /locus_tag="Sala_0218"
FT   CDS_pept        227230..227439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51942"
FT                   /db_xref="GOA:Q1GWN0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWN0"
FT                   /protein_id="ABF51942.1"
FT                   /translation="MTGSAKKAFALRLDPALFAAVERMAAADLRSANAEIEVLLREALA
FT                   RRGVPVKPPAPPRRGRPPKTDAQD"
FT   gene            227478..227720
FT                   /locus_tag="Sala_0219"
FT   CDS_pept        227478..227720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51943"
FT                   /db_xref="GOA:Q1GWM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM9"
FT                   /protein_id="ABF51943.1"
FT                   /translation="MLHLFLDDRPWFRAKRRGYGTGLPIAWQGWAMLAAHIALITGIAV
FT                   LLRDQPVALTLAVILAGLAPMPLYRARTEGGWRWR"
FT   gene            complement(227943..229475)
FT                   /locus_tag="Sala_0220"
FT   CDS_pept        complement(227943..229475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0220"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51944"
FT                   /db_xref="GOA:Q1GWM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM8"
FT                   /protein_id="ABF51944.1"
FT                   /translation="MTSLEMLDSGFATLPALVRAHAAERPDAVAAADAERRLTWSDLDR
FT                   LTDRIAARLQRDGLVKGDRTAIAGLNSVEQMAVILGTLRAGGVAGLITNSATGEQMAAM
FT                   IADTGARHLFLDTAAKASLDGQDIAASDLIAMDGGDAGTPLTDWIAPADAAPQPAAIGP
FT                   DDGFNIIYSSGTTGTPKGIIHSHAMRWQHIQRGAPAYGPNAVTILSTPLYSNTTMASFM
FT                   PTVGSGGRVVLMKKFDARGFLELAERERATNCMLVPVQYRRIMALDDFDRFDLSSFVMK
FT                   YCTSAPFPAALKADVLKRWPGGLVEIYGMTEGGAAFILEAHQFPDKLHTVGKPAPGHVA
FT                   KVIDEDGNELPQGSVGEIVGRSPAMMTGYNNRPDATKAMHWYDSEGQLFYRHGDIGRID
FT                   EDGFLTLMDRAKDMIISGGFNIFPSDLEAILLADERVVEAAVVGMPSEEWGETPVAFVV
FT                   LKPGADAESVRETCNAKVGKTQRLSAIRQVDELPRSPIGKVLKRELRDAHGG"
FT   gene            229680..231212
FT                   /locus_tag="Sala_0221"
FT   CDS_pept        229680..231212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0221"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51945"
FT                   /db_xref="GOA:Q1GWM7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM7"
FT                   /protein_id="ABF51945.1"
FT                   /translation="MHPSVHARTNPEKAAIIVAETGEEISYGDLDAASNRAAQLFRANG
FT                   LGHEDVVAFMLDNTPHYYGLTWGAQRAGLRYVCISSRLTQDETDYILDNSGAQILVVSA
FT                   SLADAAQRLTTGIKRFVMGGAIAGYESWEDAVAAMPATPVADERAGVDMLYSSGTTGRP
FT                   KGVRVPLPEDPAIDATNSLVMLASAVFQINADSIYLSPAPLYHAAPLRWSMTIHRLGGT
FT                   VVLMKKFDPEAALAHIERYRVNSSQWVPTHFVRMLKLPEEVRNRYDLSSLKVAIHAAAP
FT                   CPVPVKQAMIDWWGPVLYEYYAGSEGNGMTFISSTDWLTHKGSVGRPILGAVHIMGEDN
FT                   ETELGVGEEGTIFFESENVFEYHGDDEKTASSRNSKGWSTLGDVGRLDEEGFLYLTDRK
FT                   SFMIISGGVNIYPQEIENHLVTHPKVADVAVVGGPHEEMGEEVIAVVQPADMAEAGDAL
FT                   RDELIAYAREKLSGVKIPRRIDFLEALPRHDTGKLYKRLLRDRYWEKAKAEA"
FT   gene            231217..231849
FT                   /locus_tag="Sala_0222"
FT   CDS_pept        231217..231849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0222"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51946"
FT                   /db_xref="GOA:Q1GWM6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM6"
FT                   /protein_id="ABF51946.1"
FT                   /translation="MTAARVEFFFDLSSPWTCLAFHNLPAVLERTGASALYRPILVGGV
FT                   FNAVNPAVYAAREQTDNRRLQHSWKVLKDWARLADVPMNFPSRWHPAKSIAAMRFCCAI
FT                   EADQAALVRFARGAFASYFDRQENLDDPVVLAAVADAEGLDGAALAAAAGSDAVKARLR
FT                   ANTDELIARGGYGSPTIFVDRDDMYFGNDQLPLVEAALKHKTQRTLA"
FT   gene            231846..232649
FT                   /locus_tag="Sala_0223"
FT   CDS_pept        231846..232649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0223"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51947"
FT                   /db_xref="GOA:Q1GWM5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM5"
FT                   /protein_id="ABF51947.1"
FT                   /translation="MKDRISITMLDGGIADVRLIRADKMNALDSAMWEALAEAVDQLKA
FT                   TAGLRVVVLSGEGRAFCAGLDLSSLGGDRDPGASSAGGGLAERTRGIANNAQYAAWGWR
FT                   ELPVPVIAAVHGVAFGAGSQIMAAADIRIVHPDTRIAIMEMRWGLVPDVAGMALWRTQV
FT                   ADDVLRELVYTNREFTGSEAKLLGFATHVSDDPLAKAMELAAVIADKNPHAIRGAKRLC
FT                   NMLGDASDAEILQAESDEQVKLIRTPNQIEAVMAHMEKRRPNFVD"
FT   gene            232707..233657
FT                   /locus_tag="Sala_0224"
FT   CDS_pept        232707..233657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0224"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51948"
FT                   /db_xref="GOA:Q1GS92"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GS92"
FT                   /protein_id="ABF51948.1"
FT                   /translation="MGQILHGSAKTTHAIRGELQRSQASVASLARKYGINEKTVLKWRH
FT                   RQSVDDMPMGPKERRSTVLSPMEEAAIVALRVQARLPLDDVYIALKDVIPQLTRSSLHR
FT                   CLQRHGISRLPKADREKPKKFKDYEIGYFHIDIAELRYEGGKAFLYVAVDRTSKLVFAR
FT                   IYRKATKLAAAAFLKVLVKTVPYRIHTVLTDNGVQFVQPQRGQSRQWLIHIFERVCLEN
FT                   GIEHRLTKPYHPWTNGQAERMVRTIKEATVKSFHYASIQELRRHVSDWLIAYNFAKQLK
FT                   ALKFRTPYEAIEELWKSKPDVFIVKPNHHMLGPNN"
FT   gene            complement(233676..234170)
FT                   /locus_tag="Sala_0225"
FT   CDS_pept        complement(233676..234170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0225"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51949"
FT                   /db_xref="GOA:Q1GNK2"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GNK2"
FT                   /protein_id="ABF51949.1"
FT                   /translation="MAGDRRHRNPCPSPGRRGQGKKGGVQAQALGRSRGGFGTKIHAVV
FT                   DALGLPVRFMLGPGQQNDMAPACDLIRGLKAEHVLADRAYDADSLCDLITEQGGEPVIP
FT                   PRRHRKVQRSYDRIAYKQRWGIEGFFAKLKQWRRIATRHDKLAANFLGFIKLASIMLWL
FT                   K"
FT   gene            234305..234520
FT                   /locus_tag="Sala_0226"
FT   CDS_pept        234305..234520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM2"
FT                   /protein_id="ABF51950.1"
FT                   /translation="MRQPQQSIQKPPTIAARSALALAATGHKLPKPLPLIVPENLAFHT
FT                   SLQKPVLNQNSRQLGIPKLSLQPRAR"
FT   gene            complement(234774..236156)
FT                   /locus_tag="Sala_0227"
FT   CDS_pept        complement(234774..236156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51951"
FT                   /db_xref="GOA:Q1GWM1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR017528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM1"
FT                   /protein_id="ABF51951.1"
FT                   /translation="MRDLVFVAFLFAFIGTGFRKPFLFILCFCYIDIVAPQRLSYFLIN
FT                   SIPVSLIVFGLAIVGWLVADDKRDTRWSGRQTLLVLILGYCWMTTIQADFPVEAADKWS
FT                   WVWKALLWAIFLPLTLRTRLRIEALALIMLLSAASIAIAGGIKTAAGGGGYGTLQLLLN
FT                   ENYGLYEGSIMSTVGIAIIPLILWYRRHGTIFPPDWRVSLFAFALCFACMLLPVGTQAR
FT                   TGLVCLAVLAVLSLRAVRHRFLYITGAGLLAIAAIPFLPQSFTERMETIRNHRADQSAS
FT                   TRVAVWQWTWDYAKENPFGGGFEAYIQNRVRVEKAASDYDPDAPQNAEPTVYEEQSRAY
FT                   HSSYFEMLGEQGYPGLALWLLLHAIGLARMEQLRRRYLRTRRAEEQWIAPLATALQHGH
FT                   IIYMVGSLFVGIAFQPFIYMMLALEIGLTTYCRRREREAGWRPLMARPAQVPARHTQPA
FT                   NP"
FT   gene            236380..237585
FT                   /locus_tag="Sala_0228"
FT   CDS_pept        236380..237585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0228"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51952"
FT                   /db_xref="GOA:Q1GWM0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR024004"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWM0"
FT                   /protein_id="ABF51952.1"
FT                   /translation="MTRILHVLDHSLPTHSGYTFRTRALMKAQVAKGWEVAGVTGVRHP
FT                   DAGPDGETIDGLTFYRTPPIAPARSPLYEWREIGALARRVESLARDWKPDVLHAHSPVL
FT                   GGLAALRVGKRLGIPVIYEIRAFWEDAAVGNGTGREGSLRYRLTKMVETYAVKSADAVA
FT                   VICEGLRGDLIARGVDPAKITVSPNGVDLALFGDPPPRDDALASELGLASDDSVIGYIG
FT                   SFYDYEGIDDLIAAMPALVAAQPKARLLLVGGGPMEAALKRQAAASPASAQIHFVGRVP
FT                   HGEVERYYSLIDILAYPRKKMRLTDLVTPLKPLEAMAQGKLVAASDVGGHRELIEDGAT
FT                   GTLFAPDEPAAIVDALDKLLKNRDMWPQRRRAARIFVESHRNWSSNILRYEPVYQRLLR
FT                   GS"
FT   gene            237638..238447
FT                   /locus_tag="Sala_0229"
FT   CDS_pept        237638..238447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51953"
FT                   /db_xref="GOA:Q1GWL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL9"
FT                   /protein_id="ABF51953.1"
FT                   /translation="MDETSDKRVKIRAGALLRALRPAIPAVIGAAALTFLFAALMPFAW
FT                   VSAISWNLYLDRLSDLFVPPIGNGGRLALAFGMAAAAALIAGFVALLIARPEAAGLSRL
FT                   RDPFRRETETSDDDTPVLTRRRIDLHPDDPPRPPLRAGRDLPVGGLDGFETPGRAAAAV
FT                   PGHEEDGDDELILADLASDDDFGADAPWLQPAEMTSSVPASDPGDKSLGAMVARFEAGL
FT                   ARRRRVATGRTAVPAAEAMAPAEEPEVDFALEAALGTLQRMTRQSTG"
FT   gene            complement(238516..238764)
FT                   /locus_tag="Sala_0230"
FT   CDS_pept        complement(238516..238764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51954"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL8"
FT                   /protein_id="ABF51954.1"
FT                   /translation="MPPGLAPGASTLRAWASASFVGARHIFPCALAAGEAEPMRRALQE
FT                   RLGALEWRLPGHIVADVLVECGRDPRTLRIEILTVED"
FT   gene            complement(238839..239060)
FT                   /locus_tag="Sala_0231"
FT   CDS_pept        complement(238839..239060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51955"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL7"
FT                   /protein_id="ABF51955.1"
FT                   /translation="MERSLLQRIEAFLKETAMPPTAFGRAAVRDPRLVSDLRGGREPGA
FT                   RLKNRVEHFMNMWRADQAREDARTGVAA"
FT   gene            239198..239866
FT                   /locus_tag="Sala_0232"
FT   CDS_pept        239198..239866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0232"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51956"
FT                   /db_xref="GOA:Q1GWL6"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL6"
FT                   /protein_id="ABF51956.1"
FT                   /translation="MIDPVHDPRAALDRLLSEKGVDYARLSQVIGRNPAYIQQYIKRGS
FT                   PRRLAEQDRARIAAYLGVSEAMLGGPVARVATPARSRGAGMILVPKLAIGASAGAGASV
FT                   DGEPVEGEVAFNPKWLRDLGADPRALSIIRVEGDSMAPTLDDGDDILVDGSDAAARLRD
FT                   GIYVLRMDDVLMVKRIARAPGPGRVSVISDNPHYRSWDDLPLSAIRLVGRVVWTGRRVR
FT                   "
FT   gene            complement(239874..240182)
FT                   /locus_tag="Sala_0233"
FT   CDS_pept        complement(239874..240182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51957"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL5"
FT                   /protein_id="ABF51957.1"
FT                   /translation="MMRALILPLMAAPLLAGCVSTVKSVVTAPVKAVGQVADWSTTSQD
FT                   EADRNRGRELRKREEEMGKLARQRDQAAEKCRDGDADQCRRAEVLDHEIEALMAAPY"
FT   sig_peptide     complement(240108..240182)
FT                   /locus_tag="Sala_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.386 at
FT                   residue 25"
FT   gene            240430..241647
FT                   /locus_tag="Sala_0234"
FT   CDS_pept        240430..241647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0234"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51958"
FT                   /db_xref="GOA:Q1GWL4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL4"
FT                   /protein_id="ABF51958.1"
FT                   /translation="MSEVIDQFRANPGLRTLAVVDAEERPVGVIREQRVRELLFCPFWF
FT                   SLMQNPTIGGSIASMIEDCPTADVERSTTELLRIAASAPDGRDLILVQGGRFVETLDGS
FT                   QLARLAMQREVELAQERAARATHIDAAGRAFQRDIAALTASLSDMAGQVEAVAGELSHR
FT                   AHQTGRDAVTVAGATAQTLAGLQDLGDRGHALAATMARIVEDSRLARTVRGDAHAKIRQ
FT                   ASERASALKAASQSIEQMLALVIDMASRTNMLALNAGIEAARAGDAGRGFAVVAAEVKA
FT                   LARQTRAAAGDITRYVDHIRDIVGEVSAGFVEVERAIDANNGFSDAIDRAVDGQSATTL
FT                   TIASYVEQAVFAGREIDMRVQDIGRGASAVGDGAQALGQLSAGLSAAALSLDQRARYFV
FT                   RAVAAA"
FT   gene            241747..242472
FT                   /locus_tag="Sala_0235"
FT   CDS_pept        241747..242472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0235"
FT                   /product="MIP family channel proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51959"
FT                   /db_xref="GOA:Q1GWL3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL3"
FT                   /protein_id="ABF51959.1"
FT                   /translation="MTNIQKGLAEFIGTFWLVFGGCGSAVLAAGFPDVGIGLLGVSLAF
FT                   GLTVITMAYAIGHISGCHLNPAVTVGLWAGGRFGARDIPLYVVAQLLGAIVAAFLLFYI
FT                   ASGSPTYDLATNGLAANGFGEGSPGGYDIWSALLIEIVLTAFFLWIIMGSTDGRAPAGF
FT                   APIAIGLALTLIHLISIPVTNTSVNPARSTGPALVVGGLAIQQLWLFWVAPIVGGIIGG
FT                   VLYKTLGADSFPKPNIEGE"
FT   sig_peptide     241747..241833
FT                   /locus_tag="Sala_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.904) with cleavage site probability 0.891 at
FT                   residue 29"
FT   gene            complement(242510..243373)
FT                   /locus_tag="Sala_0236"
FT   CDS_pept        complement(242510..243373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0236"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51960"
FT                   /db_xref="GOA:Q1GWL2"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL2"
FT                   /protein_id="ABF51960.1"
FT                   /translation="MKPIRKAVFPVAGLGTRFLPATKAIPKEMLPVVDRPLIQYAVDEA
FT                   REAGIEQMIFVTGRGKSAIEDHFDIAFELEKTMSERGKDLSVLTPTRLGPGACAYVRQQ
FT                   EPMGLGHAIWCARDIVGDEPFAIFLPDEFMHGIPGCMKQMVDAYARVGGNLISVLEVPH
FT                   EQVSSYGVIAPGARDGALTEVKGLVEKPPVAEAPSNLIISGRYILQPEVMRVLERQEKG
FT                   AGGEIQLTDAMATMIGAQPFHAVTFAGARYDCGSKAGYIQANLAVALERPDIAADVRAF
FT                   AIDLLK"
FT   gene            complement(243434..243946)
FT                   /locus_tag="Sala_0237"
FT   CDS_pept        complement(243434..243946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0237"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51961"
FT                   /db_xref="GOA:Q1GWL1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL1"
FT                   /protein_id="ABF51961.1"
FT                   /translation="MTIPLVRPLCTLFLTAFAALLAACQSLPAPGGFSPEQVAVLKSEG
FT                   FVETALGWELSMPERLLFPTNESAVPAEQQERMRAIAMRLVSVGITTARVEGHTDSTGS
FT                   SAYNLTLSRARAEAVAAPMRAGGMTFTADQIVGRGETLPLSGNDTAEGRQDNRRVVVIV
FT                   TPALASQ"
FT   sig_peptide     complement(243875..243946)
FT                   /locus_tag="Sala_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.628 at
FT                   residue 24"
FT   gene            complement(243964..245190)
FT                   /locus_tag="Sala_0238"
FT   CDS_pept        complement(243964..245190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0238"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51962"
FT                   /db_xref="GOA:Q1GWL0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWL0"
FT                   /protein_id="ABF51962.1"
FT                   /translation="MSGPDLPRPVERIGARTTLQKLLSRFHFGITLFAVALSGLTILLA
FT                   GVTALRGYADRNMELAAQLGAYGVEPALVFNDPVAAREGIEPLTRIPGITRLRVIDDVG
FT                   RPVIEWKSPAGDPAPLLSRTFFPRPFAVTVRRNGSAIGTVEVWGDSSTLIDYVRLGLLA
FT                   GLACLLVTALGTIFLARRFEYELVKPLNEIATVAHDVRLHRRFDKRVKPLGIAELDRLG
FT                   GDINALLDELQGWQGHMESERALLAHRASHDTLTALPNRAAFDEQLALRIAAAKARDGR
FT                   FALLFIDADNFKAANDNFGHAAGDAVLVAISACIRNTLRKDDFAARIGGDEFVVIIDPF
FT                   DVGVVPADLANRLRACIADPITLPDGESYRASVSVGVAVFPDDGGDATALLTAADAAMY
FT                   SEKMTHRSR"
FT   gene            complement(245187..245720)
FT                   /locus_tag="Sala_0239"
FT   CDS_pept        complement(245187..245720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51963"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK9"
FT                   /protein_id="ABF51963.1"
FT                   /translation="MLASLLLIGAVSTTPQMSVQAAAQSVVEDGGMTQAVNRMVGGIAS
FT                   YVRWPSGTPATNRHMCVVGTPRLAPRMAPDTPGRGSISVRYIAASAVNADCDILFLGRM
FT                   PATDRRQLIAWVRGRPVLTITDDDAACLYGAMFCLSSRAASLSFSVNLDAIARGPLKID
FT                   PRVLRIGAGDGGAG"
FT   sig_peptide     complement(245655..245720)
FT                   /locus_tag="Sala_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.526 at
FT                   residue 22"
FT   gene            complement(245964..246497)
FT                   /locus_tag="Sala_0240"
FT   CDS_pept        complement(245964..246497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0240"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51964"
FT                   /db_xref="GOA:Q1GWK8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK8"
FT                   /protein_id="ABF51964.1"
FT                   /translation="MTRETAIFAGGCFWCTEAVFQSLAGVERVESGYIGGTVANPTYKQ
FT                   VCGGDTGHAEAIRITFDPAVIGYDDLLDVFFATHDPTQLNRQGNDVGTQYRSAIFPLDD
FT                   AQAAAARRGIERAAPDWPAPIVTTIENASEWYPAEDYHQAYWEGEGQRNPYCMAVIPPK
FT                   LAKLRKGFAERLRN"
FT   gene            complement(246555..247547)
FT                   /locus_tag="Sala_0241"
FT   CDS_pept        complement(246555..247547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0241"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51965"
FT                   /db_xref="GOA:Q1GWK7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK7"
FT                   /protein_id="ABF51965.1"
FT                   /translation="MPRRVRPILAALSLLVAPLALAAPSAAPSPYALLAATEARVAAIG
FT                   FRLTTANAAWCPVRQPQFGWMWGDPRLYEADRRVEALAAYRADDANHAFVAAIAPGSPA
FT                   AGAGLRVGDPVKAIDLAPVPDGEGDHPFARITAIEAKIAARPANAPLDLHVGGGQLIRL
FT                   TPVPGCASDFRVEAKDKPGAVADGRLVLVNQGLADFTADDAELAAAIAHELAHNILRHR
FT                   ARLDAAGVDRGLGKQFGRSARLFRQTEVEADRLSVWLLAGAGYDPGAAARFWSNFGQRK
FT                   GRPLFQAGTHPGWRDRVAALEAEAATIAAARAAGQPLHPPLVDAPPPLE"
FT   sig_peptide     complement(247479..247547)
FT                   /locus_tag="Sala_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.942 at
FT                   residue 23"
FT   gene            247661..248728
FT                   /locus_tag="Sala_0242"
FT   CDS_pept        247661..248728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0242"
FT                   /product="cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51966"
FT                   /db_xref="GOA:Q1GWK6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWK6"
FT                   /protein_id="ABF51966.1"
FT                   /translation="MTNSSALSPSSSAVAPRPGALARWLWAVALLVIIVVGVGGITRLT
FT                   ESGLSITEWRPVSGVLPPLNEADWVREFEKYKQIPEYKEINLGMTLAGFKAIFFWEWLH
FT                   RILGRVVGMALVVPFVWYAWRRAIPAGYGWRLFALTALVGLQGAIGWWMVASGLEYRTD
FT                   VSHYRLAAHLLTALFLLAGLVWTARDLGALARDPGAPPARLTGAAIGVIAILFVQLLLG
FT                   AWVAGLNAGYVSSSWPLMNDHFVPEGIDWSGGAWLALTNDPFLIHFLHRWWSWAAAGAL
FT                   LLLARTLARRGARAEACALVIVVAAQMLLGIWTIVSGVSMWVAVMHQVVGAILVAVTAA
FT                   ALHRLGRRSAITEVS"
FT   sig_peptide     247661..247729
FT                   /locus_tag="Sala_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.973 at
FT                   residue 23"
FT   gene            248893..249372
FT                   /locus_tag="Sala_0243"
FT   CDS_pept        248893..249372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0243"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51967"
FT                   /db_xref="GOA:Q1GWK5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK5"
FT                   /protein_id="ABF51967.1"
FT                   /translation="MKALTKTTVSANAATVEKKWVLIDAEGLVVGRVASIIANILRGKH
FT                   KPSFTPHVDCGDNVIVINAEKVAFTGKKMQDKRYYKHTGYAGGIKETSPAKILEGRFPE
FT                   RVLEKAVERMIPRGPLGRQQMRNLRIFAGSEHPHEGQNPEVIDVASMNRKNKVGA"
FT   gene            249372..249869
FT                   /locus_tag="Sala_0244"
FT   CDS_pept        249372..249869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0244"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51968"
FT                   /db_xref="GOA:Q1GWK4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK4"
FT                   /protein_id="ABF51968.1"
FT                   /translation="MADEQTMTDLKDLGGAVEGSVAAPVSTTPLREKIVDKQGRAYATG
FT                   RRKDAVARVWLKPGTGKITVNGRDQESYFARPTLRLVINQPFGLTERVGQYDVIATVKG
FT                   GGLSGQAGAVLHGIAQALTRFEPALRGPVKAAGFLTRDSRAVERKKYGKAKARRSFQFS
FT                   KR"
FT   gene            complement(249945..250763)
FT                   /locus_tag="Sala_0245"
FT   CDS_pept        complement(249945..250763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0245"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51969"
FT                   /db_xref="GOA:Q1GWK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK3"
FT                   /protein_id="ABF51969.1"
FT                   /translation="MKDQIWWVTGASSGIGAALARALTARGAKLILSGRNIAALEAVAK
FT                   DCGAGTMILPFEATDYAALPAIVRQAWDWQGRIDGLVNNAGISQRSLAIETDFSVYQRI
FT                   IGVDLLAPIALTQQLLPRMIEAGGGQIIAISSVAGIAGVPLRSAYSAAKHGLIGYHDAV
FT                   RAENEHLGLKVLVVAPGSVRTNVSRNALNADGSVRGESDTAIDNGLSPDDAAAQMLAAV
FT                   DAGKREIVVAEGMEAAIADLRRSDPDALFDRMSVMVQAGYAQQMKAGGTA"
FT   sig_peptide     complement(250701..250763)
FT                   /locus_tag="Sala_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.857) with cleavage site probability 0.386 at
FT                   residue 21"
FT   gene            251077..251604
FT                   /locus_tag="Sala_0247"
FT   CDS_pept        251077..251604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0247"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51970"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWK2"
FT                   /protein_id="ABF51970.1"
FT                   /translation="MSASTLVFEVGDYVVYPKHGVGRVIELQKSEIAGMQLELYVLRFE
FT                   KEKMTLRVPTNKAEGVGMRKLSSDKTLKEALQVLTTKPKVKRTMWSRRAQEYEAKINSG
FT                   DLVSIAEVTRDLFRADDQPEQSYSERQIFEAASSRLARELAAMEESDEKTAQAKILQIL
FT                   NEHAPLYYAEKV"
FT   gene            complement(251833..252573)
FT                   /locus_tag="Sala_0248"
FT   CDS_pept        complement(251833..252573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0248"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51971"
FT                   /db_xref="GOA:Q1GWK1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWK1"
FT                   /protein_id="ABF51971.1"
FT                   /translation="MTRFALTIEYDGRPYMGWQRQAHGPSVQQAIEEAIHRFTAEEVQV
FT                   LSAGRTDAGVHAIAMRAHVDIEKPLTPFKLTEALNAQLRPAPIAVIGCEVVPDDWHARF
FT                   ACIGRSYEYRIVNRRAPLTWDKGLAWQVARPLDVDAMHEAAQQLIGLHDFTTFRSAHCQ
FT                   SQSPVKTLDRLTVSRHGEEVIIEAAARSFLHHQVRSMVGSLALVGHGKWSARDLKAALE
FT                   AADRQALGLNAPPDGLYFVGAVYP"
FT   gene            complement(252742..253662)
FT                   /locus_tag="Sala_0249"
FT   CDS_pept        complement(252742..253662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0249"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51972"
FT                   /db_xref="GOA:Q1GWK0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWK0"
FT                   /protein_id="ABF51972.1"
FT                   /translation="MRIAFMGTPPFAVPTLAALHTAGHDIAAVYSQPPRPAQRGKKLQK
FT                   SPVQLWAEEHGLPVRTPKSLKSDEAQAEFAALDLDVAVVAAYGLILPQAVLDAPREGCL
FT                   NVHGSILPRWRGAAPVQRAILAGDAETGVTIMQMDAGLDTGAMRLIETTPVARKSAGLL
FT                   THELAEMGALMMRRVLSELHAFPPVPQPDEGVTYAAKIDKSEARLDFLVSAVQVERQVR
FT                   AFNPAPGAFFELEGERYKVLAAEVVHPAETVAGAAPGVTIDDRLAIACNPGAIRVTRIQ
FT                   RAGKPAMEAGEMLRGRGIAKGTRLA"
FT   gene            253889..254485
FT                   /locus_tag="Sala_0250"
FT   CDS_pept        253889..254485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0250"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51973"
FT                   /db_xref="GOA:Q1GWJ9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWJ9"
FT                   /protein_id="ABF51973.1"
FT                   /translation="MVSTEIEALVQQLARLPGLGPRSARRAVLHLMKKRESAFAPLLAA
FT                   LQTVSERLVTCTTCGNIDTHDPCAICADPRRDARSLCVVEEVSDLWALDKSRLFPGKYH
FT                   VLGGRLSALEGVRPQDLSIDALVTRVAAGGIDEVVLAMNATLEGQTTAHYLAERLEGYP
FT                   VRLTQLAHGLPVGGELDYLDEGTLAQALRARRPVG"
FT   gene            254531..255073
FT                   /locus_tag="Sala_0251"
FT   CDS_pept        254531..255073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0251"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51974"
FT                   /db_xref="GOA:Q1GWJ8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ8"
FT                   /protein_id="ABF51974.1"
FT                   /translation="MASMAILPIIETPDPRLRVISKPVETFDAELKQLVADMFETMYDA
FT                   PGIGLAAIQVGVPKRILVIDLQEADPEDPEGKKVIRTPRVFINPVFSDFSDEHSVYQEG
FT                   CLSVPEQYADVTRPAEVTVDWQDEDGKHHQERMTGLMATCIQHEHDHLEGILFIDHLSR
FT                   LKREMVLKKLAKLRKAA"
FT   gene            complement(255275..255820)
FT                   /locus_tag="Sala_0252"
FT   CDS_pept        complement(255275..255820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0252"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51975"
FT                   /db_xref="GOA:Q1GWJ7"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ7"
FT                   /protein_id="ABF51975.1"
FT                   /translation="MENDTPVDDGQTDDAATETETAATEPQDEAAKLAEQLAAVQQDLL
FT                   YARAETQNVRRRAEKEVADAHAYAATRFARDILSVADNLGRALAALSDEQRADEAIKPL
FT                   VTGLEATERELMAVFERHGITRIAAIGLPLDPNQHQAMLEIPSDKEPGTIVQEMQAGYM
FT                   MKDRLLRPAMVAVAKKAE"
FT   gene            complement(255834..256877)
FT                   /locus_tag="Sala_0253"
FT   CDS_pept        complement(255834..256877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0253"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51976"
FT                   /db_xref="GOA:Q1GWJ6"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWJ6"
FT                   /protein_id="ABF51976.1"
FT                   /translation="MTTPPITELTTRARDVFRLVVDAYLETGQPVGSRTLSKLATLNLS
FT                   PASIRNVMQDLEEYGLLASPHTSAGRMPTEQGLRLFVDGMMQVAEPSAEDRAQIEASLS
FT                   EGGPIESALAQATAALSGLSACAGLVLVPKHERVLKQVAFVPMSERQALVVLVAGDGTV
FT                   ENRIIDVPAGLDPSALVEAGNFISATLSGLTLTEAMARVRREIEAERIAIDRAAQDLVS
FT                   RGLAIWSSDGADRPVLIVRGQANLLDDSAVGDLDRVRQLLDELETKQDIAQLLDSAREG
FT                   SATRIFIGSENKLFSLSGSSVIAAPYRGADGRVVGVVGVIGPTRLNYARIVPMVDFTAQ
FT                   SLSRLIR"
FT   gene            256982..257698
FT                   /locus_tag="Sala_0254"
FT   CDS_pept        256982..257698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0254"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51977"
FT                   /db_xref="GOA:Q1GWJ5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWJ5"
FT                   /protein_id="ABF51977.1"
FT                   /translation="MRPSGRAADQMRPIAIETNFTIHAEGSVLVSFGNTRVLVTASVEE
FT                   KVPPFLRGKGQGWVTAEYGMLPRATHTRGSREAAKGKQSGRTQEIQRLIGRSLRAVVDM
FT                   QKLGERQIVIDCDVIQADGGTRTASISGAWVALRLAVDKLIEAKQLTEDPIVDSVAAIS
FT                   CGIYKGTPVLDLDYDEDSVAEADGNFVLTGKGQIVEVQASAEGATYDEEGLLRLLRLAR
FT                   IGCGEIFAAQAKAVGR"
FT   gene            257743..258192
FT                   /locus_tag="Sala_0255"
FT   CDS_pept        257743..258192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51978"
FT                   /db_xref="GOA:Q1GWJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ4"
FT                   /protein_id="ABF51978.1"
FT                   /translation="MNDLSFMDVANVAELRLWRHHMLERERERLEQRQRGYRTVVAAVA
FT                   AGGIVLVAVLIDQMLRLSGAAGLAALLPSGALEMLQLISVFAGLLILAFWLFDRWRQLR
FT                   YDEEILKTRMLLLEEQDNGSRPETTARDTGSHTEALLERGEGYLT"
FT   gene            258297..258668
FT                   /locus_tag="Sala_0256"
FT   CDS_pept        258297..258668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ3"
FT                   /protein_id="ABF51979.1"
FT                   /translation="MSDWLSSRPDSPPSQLGDHARIREILIVARSHILEAVKAQPISSG
FT                   EAVGVAIGTGFAGYLAPALIKAWKIAALIEPVTAGAVGAAAVPIGYALVQARRIAYAAR
FT                   KDRMFRSLIRKLDSIRGDL"
FT   gene            258677..259309
FT                   /locus_tag="Sala_0257"
FT   CDS_pept        258677..259309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0257"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51980"
FT                   /db_xref="GOA:Q1GWJ2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ2"
FT                   /protein_id="ABF51980.1"
FT                   /translation="MAAPHRKLAPGKLVIASHNAGKVREIRALLAPYGVDPVSAADLGL
FT                   PEPEETGTSFRDNALLKAHASAAASGLPALADDSGLCVDALGGRPGVYTADWAERQWFE
FT                   GNPGRDWYLAMGKVEGLLAEQGPDVDRSARFVCTLALAWPDGHAEVFEGRVEGGLTWPP
FT                   RGKLGFGYDPVFVPAGKTLTFAEIEPAEKHAISHRADAFAKLVAGVF"
FT   gene            259318..260463
FT                   /locus_tag="Sala_0258"
FT   CDS_pept        259318..260463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0258"
FT                   /product="Putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51981"
FT                   /db_xref="GOA:Q1GWJ1"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ1"
FT                   /protein_id="ABF51981.1"
FT                   /translation="MFEPLALYVHWPFCVSKCPYCDFNSHVRDSVEQEVWRAALLADLR
FT                   HEAAVLPGRRVASIFFGGGTPSLMPAATVAAVIAEAAALWGLTDDCEITLEANPNSAEV
FT                   AAFADLAAAGVNRVSIGVQSFDAQALAFLGRAHSEDEARRAIAMAQEHFARVSFDLIYA
FT                   RPGQTLAAWEGELADALGFGTGHLSLYQLTIEPGTRFWALAAKGELTIPDGDAAADLFD
FT                   ATQAMTRAAGLPRYEVSNHARPGEESRHNLAYWRYADYAGVGPGAHGRRLRQATERHRK
FT                   PENFIAAVTRNGHGLKVETDLSGRERATEAMLMGLRLTEGVDLARVEARSGLPRADFVD
FT                   ADAVARLAGQGLLVADGDRLAVTGAGILLLDSILSEVVETR"
FT   gene            260564..261457
FT                   /locus_tag="Sala_0259"
FT   CDS_pept        260564..261457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0259"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51982"
FT                   /db_xref="GOA:Q1GWJ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWJ0"
FT                   /protein_id="ABF51982.1"
FT                   /translation="MASDLIRDWDAHLAHEKRRSEHTRRAYIATAERFCAFLSLHRGGA
FT                   VDAAMLTALTPNDLRAYLADRRAEGLGNASAARELSALRAFLRFVGGSNASVPQMRGPR
FT                   VKKGLPRPVSPAEAMQLAQNVEDNAREGWVGARDFALLLLLYGAGLRIGEALALTGAAM
FT                   PLGDTLRVTGKRNKTRIVPILPAVAKAVARYVAACPWPIARETPLFLGVRGGPLHPGVV
FT                   RVSVRSARRALGLSDRTTPHALRHSFATHLLAGGADLRSLQELLGHASLASTQIYTAVD
FT                   AAHLLDIYRSAHPRAG"
FT   gene            complement(261537..262145)
FT                   /locus_tag="Sala_0260"
FT   CDS_pept        complement(261537..262145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0260"
FT                   /product="alkaline phosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51983"
FT                   /db_xref="GOA:Q1GWI9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI9"
FT                   /protein_id="ABF51983.1"
FT                   /translation="MTEFILDLIHSWGYFGIAVLMFLENVFPPIPSEVIMSLGGVMVGQ
FT                   GRFDYWTLVAFAVAGTTLGNWVWYWIGRWYGYERLKPLVDRYGRWLTLDWDEVEKLHDW
FT                   FIRYGSGIVFVMRFMPIARTMVSLPAGMVAMNQAKFLIWTAAGSTIWIAALAGAGSWFG
FT                   RQFAEVERFIGPVALVAIGSIILLYIYRVVTWKPKVRED"
FT   gene            complement(262302..263255)
FT                   /locus_tag="Sala_0261"
FT   CDS_pept        complement(262302..263255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0261"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51984"
FT                   /db_xref="GOA:Q1GWI8"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI8"
FT                   /protein_id="ABF51984.1"
FT                   /translation="MTLRAAVQMDPMDGINIAGDSSFALMLKGLERGYTLYHYDVRGLT
FT                   WEAGRLTTKAHGVVAAQRVAGDHYRFGDEVTLDLGRDVDVVLMRQDPPFDLGYLTGTWL
FT                   LERIQGETLVVNDPVSVRNAPEKVFVLDFPEYMPPTMVTRDLDAVKDFQARHGAVVIKP
FT                   LHGNGGKAVFRIDADGGNLGALVELFGQVWPEPFMVQQFLPSVAQGDKRIVLVDGEVAG
FT                   AINRKPGEGEFRSNLAVGGYAEAAELTPREQEICAALAPALKERGLIFVGIDVIGGEWL
FT                   TEINVTSPTGIVAIDRFNNSDTAGMIWDAIARRIGR"
FT   gene            complement(263409..263759)
FT                   /locus_tag="Sala_0262"
FT   CDS_pept        complement(263409..263759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0262"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51985"
FT                   /db_xref="GOA:Q1GWI7"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWI7"
FT                   /protein_id="ABF51985.1"
FT                   /translation="MTRAAAEARGRRAERRAAWWLRLHGWRIVGQRLRVPVGEVDLVAR
FT                   RGRTVAFIEVKWRDRAADLDLAIDPYRLRRVAAAAEMLAPRFARPYDDIRIDVMLLAPR
FT                   RLPRHLVHVWQP"
FT   gene            complement(263756..264616)
FT                   /locus_tag="Sala_0263"
FT   CDS_pept        complement(263756..264616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0263"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51986"
FT                   /db_xref="GOA:Q1GWI6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI6"
FT                   /protein_id="ABF51986.1"
FT                   /translation="MPDSTIPDSPLPGLYIVATPIGNLGDIGVRAAATLASADLIAAED
FT                   TRVTAKLLAHLGLRVPMTPYHDHSDERTRAALVARMASEVVVLVSDAGTPLISDPGYKL
FT                   VRDARAAGRHITTLPGPCAAIAAITLSGLPSDRFLFAGFLPNKAKARADTIAEFAGLRA
FT                   SLVFYESGPRLAAALAALAEGLGNREAAVAREITKLYEECVTGPLADLAARYEQAPPKG
FT                   EIVIVVGPPGEAAAEEADDAMLDAALRDAMADKPVAQAAKAVAKRFGRDRHAIYARALA
FT                   LKGQA"
FT   gene            264693..265829
FT                   /locus_tag="Sala_0264"
FT   CDS_pept        264693..265829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0264"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51987"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI5"
FT                   /protein_id="ABF51987.1"
FT                   /translation="MLRGLGAVALAGVLAACQVVPRTGGPATPPPPSDPGETVGPGLPT
FT                   DTDRHRVALLVPQTGPNADVGTAIANATTMALLDTRTERLRITTYDTALGAAAAARQAV
FT                   ADGNKLILGPLLSEDVAAVAPIARGAKIPVLSFSNDSSVAGNGVFIMGFVPGQSVERIV
FT                   AFSRAKGHQRFGALVPKNVYGDRSAAAFRAAVAEAGGTLVALESYDRSATALTGAARRV
FT                   ANAGDIDAVLIADSGGNAIRAVPVIKSAGDRQILGTELWNTDAVLAGSAAMRGAWFASV
FT                   SDGLYGQLATKYRTRFGRAPYRLASLGYDSVLLTVRIARDWKPGTNFPVNRLLATDGFG
FT                   GIDGIFRFNNRGIAERALEVSEIGAGGFRVIDPAPTKW"
FT   sig_peptide     264693..264767
FT                   /locus_tag="Sala_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.859) with cleavage site probability 0.433 at
FT                   residue 25"
FT   gene            266016..266537
FT                   /locus_tag="Sala_0265"
FT   CDS_pept        266016..266537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0265"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51988"
FT                   /db_xref="GOA:Q1GWI4"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI4"
FT                   /protein_id="ABF51988.1"
FT                   /translation="MAPLPPKNGPRYNEFIASPKVRVIDEEGENLGVMLTAEAIEQAAE
FT                   VGLDLVEVSPNADPPVCKFLDVGKYKYEAQKKANLARKSQKTQEIKEIKMRPNIDDHDF
FT                   DVKMKKVFDFLEEGDKVKMTMRFRGREMSHTQLGLNVLQRVAELTAEVAKVEAHPRTEG
FT                   RQMLMVLAPK"
FT   gene            complement(266656..267354)
FT                   /locus_tag="Sala_0266"
FT   CDS_pept        complement(266656..267354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0266"
FT                   /product="protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51989"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI3"
FT                   /protein_id="ABF51989.1"
FT                   /translation="MCVVALAHRVHPDWPLILIGNRDEFHARPAAPLHQWADGSGIVAG
FT                   RDLQAGGTWLGVHAPSGRAVVVTNVRGAMPDPAKDSRGALVTDLLRGQGRFADPAVADL
FT                   DRFNAFNLFAIDGSGPRLLTNRPRPQISSLGPGVHALANEPVDRPCPRAERLRATLAAL
FT                   VGSRSDPEGLLDTLTAEGDPALFLTGEVYGTRASTLAAVAADGTVRMVERRYEAGGRPG
FT                   GTTALDFRIG"
FT   gene            267452..268006
FT                   /locus_tag="Sala_0267"
FT   CDS_pept        267452..268006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51990"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI2"
FT                   /protein_id="ABF51990.1"
FT                   /translation="MADEFAKMGESLRAKTGKGLDEWVATARRAGIAGHMALVNHLKSE
FT                   HGLGHGYANMIVHAANASSSLSQDDDALVQAAFDGAKAHWRPLYDRFAALVQGFGNDVE
FT                   LAPKKGYVSFRRKKQFALLMPSTKDRFDIGLALKGEAPTGKLELAGSWNAMVSHRIRIN
FT                   AGEEPGDDVTGWLRAAYDRAG"
FT   gene            268018..268626
FT                   /locus_tag="Sala_0268"
FT   CDS_pept        268018..268626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0268"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51991"
FT                   /db_xref="GOA:Q1GWI1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI1"
FT                   /protein_id="ABF51991.1"
FT                   /translation="MNAADTRQRILMTAMELFWEKGYLSTSVSDILSRSQVHSGSLYHF
FT                   FPGKQDVLIGVLELYRDGIEEMLLAPNWQGVEDPVERVFALLGGYRTHLIVTDCTYGCP
FT                   IGSLALEIHEPDPVVRELMAANFTNWSTAIARCFDAAADRLPPGTDAQALGEFVLTVME
FT                   GAVMQARTYRDIGYFDRNIAVLRDYITILLASAKNDSLA"
FT   gene            268649..269086
FT                   /locus_tag="Sala_0269"
FT   CDS_pept        268649..269086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51992"
FT                   /db_xref="GOA:Q1GWI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWI0"
FT                   /protein_id="ABF51992.1"
FT                   /translation="MTEVGKTPWHLWVVGVLAVLVNAFPVVDFTLTNVENEFWLSPLTS
FT                   DQRVFILGAPLWADVCWALGGFGAFIGSVLLLLRSRHAVTAYIVSIAGLAGSTLYQHIL
FT                   NGETTRALFQNVAMIVTAVIWVIMLALFFYARAMKAKGVLR"
FT   gene            complement(269295..270797)
FT                   /locus_tag="Sala_0270"
FT   CDS_pept        complement(269295..270797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0270"
FT                   /product="peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51993"
FT                   /db_xref="GOA:Q1GWH9"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH9"
FT                   /protein_id="ABF51993.1"
FT                   /translation="MKSGLSLIALALAVAVPAIVHAEDKNDKAKAEKPADYEPQIRTTK
FT                   LSGTFGGQRINYAATIGETIIRNKDGVPEVAVVTTSYVKEPRDTSRPVTFLFNGGPGSG
FT                   TVWLMMGAFGPKRVAIPGTGVDDGAPPWPIVDNPDALLDVTDIVFIDPPGTGFSHLIGK
FT                   ADPKDYYGVTQDAKLVAEVIRRWLADNGRWNSPKYLGGESYGTTRTAAVAHQLMNATYN
FT                   DVAFNGLILISTVLDFAAGADTPGNELSPVTNLPSMAVTALYHGKASASSVEAFAEEAR
FT                   QWAIGPYATALLKGQKLQGEERAAIRRELARFTGLSETWLEQADLRVTPARFYKELLRD
FT                   RGLTVGRLDSRYTGKDYDHAGETPDNDPSFYGIDASYTAAINSWLRDGLGFRTDREYQS
FT                   ISGIGGQWDWRIGGRDTNAYLNVAPYIGQAMRENSGLRVLVAQGWYDFATPFFAAEYAL
FT                   SRTGIPQDRITFTYYDAGHMMYIRDEDRRKLSEDVRAFIRAR"
FT   sig_peptide     complement(270729..270797)
FT                   /locus_tag="Sala_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(270915..271136)
FT                   /locus_tag="Sala_0271"
FT   CDS_pept        complement(270915..271136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0271"
FT                   /product="protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51994"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH8"
FT                   /protein_id="ABF51994.1"
FT                   /translation="MQPRYHINVFWYPDDNCWIADVPDLRPCSAHGETPIEAVAEAEIA
FT                   IESWLEVAREKGFPIPEPRYRPAIYAVR"
FT   gene            complement(271136..271456)
FT                   /locus_tag="Sala_0272"
FT   CDS_pept        complement(271136..271456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0272"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51995"
FT                   /db_xref="GOA:Q1GWH7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH7"
FT                   /protein_id="ABF51995.1"
FT                   /translation="MSGSRTITEDDDRLDNVHPGDILRHDFLIGSDIAISEVADGAGIA
FT                   VEHLEAILDARQAIDANVDLRLARYFGMSEGFFLGLQIDYDLEEERREHGADLDKIVRR
FT                   AA"
FT   gene            complement(271425..271712)
FT                   /locus_tag="Sala_0273"
FT   CDS_pept        complement(271425..271712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0273"
FT                   /product="plasmid maintenance system killer"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51996"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH6"
FT                   /protein_id="ABF51996.1"
FT                   /translation="MIRSFAEPETEHVWRGERSRKLPGDIQSTARRKLRQLNRTTKLQD
FT                   LRVPAGNRLEQLKGFTPLRYSLRINDQWRITFHWSNGGADDVRIEDYHRG"
FT   gene            complement(271719..272333)
FT                   /locus_tag="Sala_0274"
FT   CDS_pept        complement(271719..272333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51997"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH5"
FT                   /protein_id="ABF51997.1"
FT                   /translation="MLTASAESPIAAIGGRPMSQNRSRDDFIRFLDYLGEKGLIARATA
FT                   SARRTAVAKVLAVLSDDEAEDVTNLDIDHVMGRFDNLNPHQYTPDSLQTYRSRLKTALE
FT                   DFRSYSENPVSFRPSGQSRMRQKANGNNAKPQKSKAPTTQTSASPPTTSSLPMVDLPNV
FT                   NQLPVQLRQNLTVRIFGLPFDLTMQEAQKIANIVLAHASPE"
FT   gene            complement(272384..274570)
FT                   /locus_tag="Sala_0275"
FT   CDS_pept        complement(272384..274570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0275"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51998"
FT                   /db_xref="GOA:Q1GWH4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH4"
FT                   /protein_id="ABF51998.1"
FT                   /translation="MAIQIRTSLDEIDTAEGYVPHRPARPDKVEGGKRFELVSDYEPAG
FT                   DQPTAIRELVETARTGERDQVLLGVTGSGKTFTMAKVIEELQRPALILAPNKILAAQLY
FT                   GEFKSFFPNNAVEYFVSYYDYYQPEAYVPRSDTYIEKESSVNEAIDRMRHSATRALLER
FT                   DDVIIVASVSCLYGIGSVETYSAMIFDLKKGQVADNREIIRKLVALQYKRNDQAFARGN
FT                   FRVRGDSLEIFPSHYEDMAWRVSFFGDEIEEITEFDPLTGKKIASLNSIRIYANSHYVT
FT                   PGPTLKQATEAIRHELAERLKELEAEGRLLEAQRLEQRTNFDLEMIAATGSCAGIENYS
FT                   RFLTGRLPGEPPPTLFEYLPDNALLFVDESHQTIPQIGAMSKGDHRRKITLAEYGFRLP
FT                   SCIDNRPLRFAEWDMMRPQTISVSATPGTWEMERTQGVFAEQVIRPTGLIDPPVEIRPV
FT                   EEQVDDLIAEAKKTAAAGYRTLVTTLTKRMAEDLTEFLHEAGLKVRYMHSDVETLERIE
FT                   IIRDLRLGVFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSETSLVQTIGRAARNV
FT                   DGRVILYADRITGSMERALRETDRRREKQKAYNEAHGITPTTIKRNIGDIIAHVASKDG
FT                   VVIDIGEDKPAHMVGHNLRAYIQELEKKMRDAAADLEFEEAGRLRDEIRKLEADELGLP
FT                   PDQQVAPRVGRSNEGKPGTRKGRFGKQSKTKWGR"
FT   gene            274612..275166
FT                   /locus_tag="Sala_0276"
FT   CDS_pept        274612..275166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF51999"
FT                   /db_xref="InterPro:IPR022061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH3"
FT                   /protein_id="ABF51999.1"
FT                   /translation="MTRKRKRRVLRRQAMKKVMTIAALGTLLALSGCGKAENAGGTVKR
FT                   EAGNWKTEVKLVKFEIPGMPPEMKDGMTRMVEGASGMDQCFTQEQVDKEDIAAELAKGP
FT                   GNGGECTWSKKDVAGGKIDVAGTCTANGQTVEMAMNGTMEAKRSDVTITTRGKVPTGGD
FT                   MEMVMQMTSTHTGPCKAPATT"
FT   sig_peptide     274612..274722
FT                   /locus_tag="Sala_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.619 at
FT                   residue 37"
FT   gene            275245..275643
FT                   /locus_tag="Sala_0277"
FT   CDS_pept        275245..275643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0277"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52000"
FT                   /db_xref="GOA:Q1GWH2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH2"
FT                   /protein_id="ABF52000.1"
FT                   /translation="MLGYVTMGTNDLDRAREFYAALLGTIGASELMRMSDEDNGFTLYA
FT                   TGWGQPGIAVTRPYDGQPAHRGNGHMAAIVVDSRAKVDSLHAKALELGGTCEGAPGVRG
FT                   DEGEQAFYGAYFRDLDGNKLCAFRIGPA"
FT   gene            275731..276063
FT                   /locus_tag="Sala_0278"
FT   CDS_pept        275731..276063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH1"
FT                   /protein_id="ABF52001.1"
FT                   /translation="MSRTRFAVRRSIAMKRIDLPGGEQVGLSSRPAKSWNEVRGVSKGA
FT                   RDQLAPFALGLTAHRQKRDAAVQRMTEIPFRGSYKGSHVGVSPFDNPFLTRFRLFRSRI
FT                   GAAFDI"
FT   gene            276172..277917
FT                   /locus_tag="Sala_0279"
FT   CDS_pept        276172..277917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0279"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52002"
FT                   /db_xref="GOA:Q1GWH0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWH0"
FT                   /protein_id="ABF52002.1"
FT                   /translation="MDQAKTNEMDPDEVDRIIADELQRLLESPMFTRSPVLSRLLQFLV
FT                   EHRLRGGRSAPKAYAIATEALGRSEDFDPAVDSYPRVMVGRLRTLLDRYYSETAWVHRL
FT                   RVPQGSYEVVVQHRSSPPAARAAEGPDGDDDVKAAAAAAGGDAVPPAVARPGGGRFGRW
FT                   IVALLLLALALLALWALRGEAPRLLARDAVPEPLLEISAPDSGNLPESRALARALDGRL
FT                   RDGLRRFDLIELLAAHTAGGAAPRPADYRLDTSLVRTVDGVVDVTLVLNRVADQRAIWS
FT                   QQLRLDHFDTPEFTAVEPVIAQLAGDYGVIVRDQIRRQPDNYAPGYPCLAQFNRLRQMR
FT                   DAATAKRVVSCLRAMIKADPRDPVALAALSLVRFGDWQPQRGTPAGREAFAEARALALR
FT                   AYREDPDSSVGQFAMARANFYAGDCAAGIAMGDSARALNPYDADMAGFLGLFKLACDHA
FT                   DEGEELLRRSLALDPSNPGVPAVTLAFILSQRGEQAQAQAILDRMPSPTNLEPQYLMVR
FT                   SVVLARQGEVDAARALWRRLLAYTRQPADAPPEQVLGRFLITPAVIARASAALRESGVV
FT                   GPPAG"
FT   gene            278152..278388
FT                   /locus_tag="Sala_0280"
FT   CDS_pept        278152..278388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0280"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52003"
FT                   /db_xref="GOA:Q1GWG9"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWG9"
FT                   /protein_id="ABF52003.1"
FT                   /translation="MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVM
FT                   AFEEEFGVEIPDDAAEKIATVKDAIDYIEANKG"
FT   gene            278556..279815
FT                   /locus_tag="Sala_0281"
FT   CDS_pept        278556..279815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0281"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52004"
FT                   /db_xref="GOA:Q1GWG8"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG8"
FT                   /protein_id="ABF52004.1"
FT                   /translation="MRRVVVTGLGLVTPLGGDVETSWKNLIAGKSGAGPITKFDASDQK
FT                   CTIACEVKPADHEYGFDPMKRVDHKVQRQVDPFIIYGIDAAGQALEDAGLTELTEEQKV
FT                   RAGCSIGSGIGGLPGIESESLLLAEKGPGRVSPHFVHGRLINLISGQVSIKYGLKGPNH
FT                   AVVTACSTGAHSIGDAARMIKDDDADIMLAGGAEATICPIGIAGFAQARALNMRFNDRP
FT                   EQASRPYDRDRDGFVMGEGAGVVVLEEYEHAKARGAKIYAEVVGYGLSGDAYHVTAPDP
FT                   EMDGAFRSMQAALKKAGMTPADIDYINAHGTSTMADTIELGAVKRLFGDAMANVSMSST
FT                   KSAIGHLLGGAGAVETIFCILAIRDQIVPPTLNLDNPDEGTEGADLVPKVAKRRKVRAA
FT                   LNNSFGFGGTNASLIVKAID"
FT   gene            complement(280014..280763)
FT                   /locus_tag="Sala_0282"
FT   CDS_pept        complement(280014..280763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52005"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG7"
FT                   /protein_id="ABF52005.1"
FT                   /translation="MIRGFLTRRAEWPAHVPDPDAPPPLMLLWREMGSLARAIGGRIRP
FT                   LPPEPNPDSDYPPVMVLPGFLSGDWATKALRADLRRAGFRCYAWGLGFNRGATPDIIER
FT                   IDGRVQWIIDRTGFAPALVGWSLGGIYAREYAKRHPDKVARVVTLGSPFSGSRRANRAW
FT                   RLYHLIARHPVDNPPIDFHPAPRPEMPTFALWSKHDGVVAVNSARGLPHESDRAVEVDC
FT                   SHMGFAYAPNSVAAIVRALTEEVAPSE"
FT   gene            complement(280774..281907)
FT                   /locus_tag="Sala_0283"
FT   CDS_pept        complement(280774..281907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0283"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52006"
FT                   /db_xref="GOA:Q1GWG6"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG6"
FT                   /protein_id="ABF52006.1"
FT                   /translation="MAACSAPAATEAAPADTAALDASGEHPAVPLADAPFRVQEIASFD
FT                   EPWAMTFLPGTRAALVTEKAGKLKLWQESGPTLDVTGVPAVAYGGQGGLGDVIVAPDFA
FT                   TSGTIYLSWAEAGSGGTFGAVVGRAKLVQGAAPRLEGLEVIWKQTPKVTGRGHYSHRLA
FT                   FSPDGRYLFIGSGERQKFDPAQDMTGNLGKIVRLNPDGSIPADNPFAGEGGVTAQIWSL
FT                   GHRNILGLAFDDSGRLWNQEMGPRHGDEVNLVEAKANYGYPIVSNGDHYDGRDIPDHPT
FT                   RPEFAAPKLWWNPAVSPAGLAYYGGDLYPGWKNSLLMGALSGEGLVQMRIDGTALHKAG
FT                   RWDFGTRIREVEVREDGTVWLLTDGDDGRLVKLVPKR"
FT   gene            complement(282062..282697)
FT                   /locus_tag="Sala_0284"
FT   CDS_pept        complement(282062..282697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0284"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52007"
FT                   /db_xref="GOA:Q1GWG5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG5"
FT                   /protein_id="ABF52007.1"
FT                   /translation="MTAPTAAASQPQADALSDSEFKALLAGVIPHLRAYGRSLSGNPDL
FT                   ADDLTQDTMVKAWASRDRFERGTSIKAWTFVILRNTFLSQMRRNKFVGEYDETAVERTI
FT                   STPASQEESGEMADVQRGLMELPQDQREALILVGAGGMSYEEAASICDCALGTMKSRVS
FT                   RARAALEEIMARGRFSQKRADAPPASEAVDAIMDSVEEIAARREAANR"
FT   gene            283107..283532
FT                   /locus_tag="Sala_0285"
FT   CDS_pept        283107..283532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0285"
FT                   /product="BLUF"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52008"
FT                   /db_xref="GOA:Q1GWG4"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG4"
FT                   /protein_id="ABF52008.1"
FT                   /translation="MLSVIYVSVADPLLSPADIDAILVTARRNNARDALTGALIYNGHN
FT                   FMQLLEGPADRVDACLAAIREDRRHSGMIEIRRRAIERREFADWTMLYEPGFQGQEVEF
FT                   ARLAANGRLDPEFERMLGNFVALGRRSPSAGGQAPLQ"
FT   gene            283576..284211
FT                   /locus_tag="Sala_0286"
FT   CDS_pept        283576..284211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0286"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52009"
FT                   /db_xref="GOA:Q1GWG3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG3"
FT                   /protein_id="ABF52009.1"
FT                   /translation="MPDKGLVISTVTPQPLDDASFKQELAAMLPHLRAFGRSLCGNADL
FT                   ADDLVQETMLKAWKARAQYVPGPSSMKSWAFVILRNCFLSQMRRKKFTAEYDELAAERL
FT                   LVAPDDQDDSLHLADVQRALLMLPVDQREALILIGAGQLSYEEAAAICGCAIGTMKSRV
FT                   SRGRAALQTILESGEMPRRSTDEQPSHEAFRAIMDHVDELTGGASTPD"
FT   gene            complement(284220..285014)
FT                   /locus_tag="Sala_0287"
FT   CDS_pept        complement(284220..285014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0287"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52010"
FT                   /db_xref="GOA:Q1GWG2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG2"
FT                   /protein_id="ABF52010.1"
FT                   /translation="MALGDEIRGHLPYLRRYARALTGSQQHGDNFVHALLEVIVAAPDE
FT                   FRSGAGSRIDLYRGFHRIWESAYIDDGEGSDDAENPLVRAAHQRLRQMTPLGRQILLLT
FT                   ALEGFSVEEAGQITGTDTATVETLLADAVADLDRESRTSVLIIEDEPLIAMELEQIVRS
FT                   LGHEIAGIATTHEDAVAAFEDTDAGLVLADIQLADGSSGIDAVQDILARAPVPAIFITA
FT                   FPERLLTGGRVEPTFLISKPFRENTVRAAISQSLLFTPQLAA"
FT   gene            285198..286742
FT                   /locus_tag="Sala_0288"
FT   CDS_pept        285198..286742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0288"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52011"
FT                   /db_xref="GOA:Q1GWG1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG1"
FT                   /protein_id="ABF52011.1"
FT                   /translation="MAERPPGEMNDAARATSATRGGRDLPLTRDGRTERERRRVETLRE
FT                   YHLLDTGAEAAFDRVTKLVADLFDAPIALISLVDDCRQWFKSAHGLDVPETPRDISFCK
FT                   HVVEDEQPLIVGDAASDPRFQDNPLVTGEPYIRFYGGVPLFAYNGAILGTLCIIDRKPR
FT                   PALSFREVERLQDFAALVMAEADLRRIVGERDEARRMLEQALDFSGIATWRYDARTGAI
FT                   HWSGAVAELWGADYATALAHIDGFFDRLHPDDREAVRGVLGESVAHGGHYATEYRIQHP
FT                   ERGVRWIAVHADWDVRTDDAILTGVSMDITEQKSRQENANLLMRELHHRMRNLFATVGA
FT                   IISLTRHAARDVDDYVERISSRLDALNRAQNVLLGANFMTGSMHALLREVEASFPRIHW
FT                   SGPDLLLPENALVAMALLFNELATNAAKHGALSGERGQVEVRWTQDDEGADDRRFRLTW
FT                   AESGADREITPPERTSFGTLLMERSVRNNLGGTIARRWEPGGLIVDITLPARWREA"
FT   gene            286755..287768
FT                   /locus_tag="Sala_0289"
FT   CDS_pept        286755..287768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0289"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52012"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWG0"
FT                   /protein_id="ABF52012.1"
FT                   /translation="MARATTWIEPHPGGIYVKPADLWIDPSRPVPRAAVTHGHADHARS
FT                   GHGAVFATPETLAIMALRYGVDVAASHNRGFAYGEGFERGGVRFSFHPAGHVLGSAQIL
FT                   MEYRGERIVVTGDYKRRADPTCAAFEVVPCDIFITEATFGLPVFRHPPTQGEIAKLIDA
FT                   VRAEPDRCVLVGAYALGKAQRLIAELRGAGWDAPIYIHGALEKMCTLYAVHGVDLGELR
FT                   LVSETDRADMAGQIVVAPPAALNDRWSRRLPDPLTAMASGWMRVRQRARQRMVELPLVI
FT                   SDHADWDELTTTIAEVNPKETWITHGSEDGLLRWCELHQRQARALHLVGRDLEEEA"
FT   gene            287765..289417
FT                   /locus_tag="Sala_0290"
FT   CDS_pept        287765..289417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0290"
FT                   /product="DNA ligase (ATP)"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52013"
FT                   /db_xref="GOA:Q1GWF9"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF9"
FT                   /protein_id="ABF52013.1"
FT                   /translation="MKALAALIDRLIYTRSRNSKLALIADYLRCTPDPDRGWAIAALTE
FT                   SLDFPAVKAGMVRALLATRVDEQLFRLSRHFVGDTAETAALLWPEPFQPSPSGEGLGVG
FT                   AIGLAQGVEPPPQTPPLKGRGLTVTQAVDALAAASRSDAPAILADLLDRLDADGRYALL
FT                   KLALGGMRVGVSARLAKQAFAQAFDVPVDDVEELWHAIPPPYAPLFAWGEGRAERPDLA
FT                   DVAFFRPFMLAHPLEEESVDLADYAAEWKWDGIRVQIVRGGGETRIYSRGGEEIGAAFP
FT                   ELIAAFDQDAVIDGELLVRGEVQGGEAASFNALQQRLGRKTVSKKMLADYPAFVRVYDL
FT                   LAVDGDDLRPLPWTERRRRLEAFVPRLASSHFDLSQLIEAADFDDLAERRAGARDAAIE
FT                   GVMLKRRDAPYVAGRRAGLWYKWKRDPLTADCVMMYAQRGNGRRASFYSDYTFGCWSDA
FT                   GELLPVGKAYSGFTDEELKWLDKFVREHTLNRFGPVREVEKSLVLEVAFDSIHSSKRHK
FT                   SGLAMRFPRISRIRRDKPAEEADRIATLRAMVT"
FT   gene            289605..290231
FT                   /locus_tag="Sala_0291"
FT   CDS_pept        289605..290231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0291"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52014"
FT                   /db_xref="GOA:Q1GWF8"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF8"
FT                   /protein_id="ABF52014.1"
FT                   /translation="METAMTIAHPPLPYAQDALAPHISADTLATHHGKHHKAYVDKVNA
FT                   AIEGTELADKSLEEIIHHAEGSGNKGLFNNSAQSWNHAFYWNSLNPTKTEPAGDLLAAI
FT                   ERDFGSLGELKKKLKDTAVNHFASGWAWLIARDGTLSVTDTHDAGTELVAGIKPLLVID
FT                   VWEHAYYIDRKNLRPAYVDAVVDELLNWDFAAENYAREGSWTYPS"
FT   gene            290401..291780
FT                   /locus_tag="Sala_0292"
FT   CDS_pept        290401..291780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0292"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52015"
FT                   /db_xref="GOA:Q1GWF7"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF7"
FT                   /protein_id="ABF52015.1"
FT                   /translation="MTISLFELFKIGVGPSSSHTVGPMVAARRFTVWLDEQALLVRTVH
FT                   VEADLYGSLALTGKGHAADTAIVAGLAGEIPASTSLAAIKAHWERAASEGFIYLLGRQR
FT                   VRFQPQRDLHFQMKQRQPFHSNAVSFTARDGDGEILAKRMYFSIGGGFVVDEDEAGRNS
FT                   RGAEDEVELPYAFTSGADLLAMGAVSGKSFAEMMLENELVHRSLDEVNAGLDAIAAAMD
FT                   ASIDAGCCSTGTLPGGLKVKRRAPQIAADIRERHEANLSDPMAMMDWINLWAMAVNEEN
FT                   AAGGKVVTAPTNGAAGIIPAVIRYYKRSYRGDAAGVRTFLLAAGAVGALYKRNASISGA
FT                   EVGCQGEVGVACSMAAAGLTAALGGTNAQVENAAEIGMEHNLGLTCDPIGGLVQIPCIE
FT                   RNAMGAIKAIDASRIAMIGDGTHVVSLDTVIATMLQTGRDMRDKYKETSKGGLAVSVVE
FT                   C"
FT   gene            291790..292056
FT                   /locus_tag="Sala_0293"
FT   CDS_pept        291790..292056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF6"
FT                   /protein_id="ABF52016.1"
FT                   /translation="MLHRHPGLDPGSMAAPQSWTSDQIGAYPFGTRQSCLPAFAGGQMF
FT                   DREATRRDAPGAARWTTSVTMEKHRSLLAPRLATGRLRLALQS"
FT   gene            complement(292085..294085)
FT                   /locus_tag="Sala_0294"
FT   CDS_pept        complement(292085..294085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0294"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52017"
FT                   /db_xref="GOA:Q1GWF5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF5"
FT                   /protein_id="ABF52017.1"
FT                   /translation="MTATFSPGQLKFLKALTEALFDGAAMAITPDQVVANIAELFGKVG
FT                   GTKLDEMRVSLIATEIALGPLFAEVDVAARVERIADRLRDSRIDLFQDMGRLRGIVYAC
FT                   YYGHWLPGDQDANVANPVHRQIGFALPRFRARGPGDVPITPVQGREIDPAHILTADSLD
FT                   DEYDVIVVGSGAGGAVAGYNIAAQGYRVLIVEAGPFYPSHAITHHELDMIANLYKHGAV
FT                   QTTTNRDFVVFQGRCVGGSSTINNGICLRVNEPGRTHPDAEDVLAKWATIGAPIDPAAF
FT                   HASYDAVQAMLGIARIESRSGRHNGPHLINGWRAYANASSDPKDKRAIADWFDKNFGPP
FT                   NTPNACAYCGYCNSGCAYGRRMGVAQTYLPQACRDHGARILPRTKVQQILWQTAIDGRR
FT                   EAEAVRLVLPDGANRLVRARVGVVVAAGTIASSKLLARSDIDGTGYQVSLNVASPVVAL
FT                   MPPGVGGDAWDEDQMSSYVDCGDFLLESHFQPPMSMASLMPGWFADHADRMKNYGRVHS
FT                   AGILFPADRRGQIVDGKLRFRLDSTDDLPLLRRAMATLTKVHFAAGAIECYPALAKGQT
FT                   VTPDMDIDAFFEAAIREQDDVTLSSSHPHGGNAMNEDSQHGVVDLDCRVHGTTNVLVTD
FT                   ASVFPSCIRVNAQWTTMAMAHYATARGDPFR"
FT   gene            complement(294188..295087)
FT                   /locus_tag="Sala_0295"
FT   CDS_pept        complement(294188..295087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0295"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52018"
FT                   /db_xref="GOA:Q1GWF4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF4"
FT                   /protein_id="ABF52018.1"
FT                   /translation="MSDTAPARHRHDFLAAAHDDNARRTRWVVALTAAMMVGEIAAGYW
FT                   TGSMALLADGFHMATHAGALGLAALAYRYARKHRNDPRFSFGTGKIGDLAGFASALILG
FT                   VFAIGIAVESTLRLIDPVRVDFASATLVAVLGLAVNIVSALLLMGGHHDHHLHDHGHDH
FT                   AHGHDNNLRSAYFHVLADALTSLLAIVALLAGRYLGLGWMDPAMGIVGAIVIARWAWSL
FT                   MRDTAAILLDTHDAPAAAAIRARVEAAGAEITDLHVWRVGPGARAAIVEVAGSACSAAL
FT                   REQLEGAPAIAHLTIGVR"
FT   gene            complement(295097..295369)
FT                   /locus_tag="Sala_0296"
FT   CDS_pept        complement(295097..295369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0296"
FT                   /product="protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52019"
FT                   /db_xref="GOA:Q1GWF3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF3"
FT                   /protein_id="ABF52019.1"
FT                   /translation="MSHLAARPDLIARVRRIAGQVAAVEKALAADAPCATVLHRVAAVR
FT                   GAVNGLLAEVIAEHLKDHVALPGLSDAERATGAEDLLAVIRRYAK"
FT   gene            295766..296542
FT                   /locus_tag="Sala_0297"
FT   CDS_pept        295766..296542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0297"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52020"
FT                   /db_xref="GOA:Q1GWF2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF2"
FT                   /protein_id="ABF52020.1"
FT                   /translation="MAEQPKFDLTGRVALVTGASSGLGAGFAKALAAAGAKVVLAARRA
FT                   DKLAEQVAAIEAAGGQAVAVSMDVTDEASTKAAYDAAEAAFGTVDTIVANAGVATEKMA
FT                   MSLSVEDVDFLLAANVRGVFLTANEGAKRLDQAGSREKQHGRIVLIGSITAEKVFPATS
FT                   VYGATKAAVRHLGKALAREWARRGICVNVIQPGYFESEMTAELLESDAGAAMVKSFPRQ
FT                   RMRPATDLHAPLLLLCSDAAAGVTGSVFTIDDGQTL"
FT   sig_peptide     295766..295864
FT                   /locus_tag="Sala_0297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.886) with cleavage site probability 0.768 at
FT                   residue 33"
FT   gene            296539..297327
FT                   /locus_tag="Sala_0298"
FT   CDS_pept        296539..297327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0298"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52021"
FT                   /db_xref="GOA:Q1GWF1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF1"
FT                   /protein_id="ABF52021.1"
FT                   /translation="MSALLIEARGAVEIATLNRPERLNALNEELVDELNAYFGGLVERP
FT                   DVRVVILRGAGRGFCAGLDIQEDRAGDETPVLRTLRTQTRIGNIYRKMRACPQPVIALG
FT                   HGAACGGGLSLLLASDVRYATPSLRCNAAYIRIGLGGCDMASSYFLPRLVGASLAAEMI
FT                   LTGRFIDAERALRAGLVSEIVGEEALLDRGLALADEMLATSPHGLRLSKQALNLNLDAP
FT                   SLDAAMAIEDRQQVILSATEDHKEALAAFLEKRAPEYRER"
FT   gene            297402..299231
FT                   /locus_tag="Sala_0299"
FT   CDS_pept        297402..299231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0299"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52022"
FT                   /db_xref="GOA:Q1GWF0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWF0"
FT                   /protein_id="ABF52022.1"
FT                   /translation="MAAGWRTTRRGRTGASRRAAIIALACLLGSTSGLAQSRAAPPRQP
FT                   NIVILLADDWGFSDVGAFGSEIATPHIDALARAGMRFANFHVSGSCSPTRAMLQTGVMN
FT                   HRNGLGNMPETIPDEHRGKPGYDTVMNLRVVTIAELMKAAGYRTYLTGKWHLGSDAKRL
FT                   PEARGYDRAFSLADAGADNFEQRPIEGLYDKANWTENGRPATLPRDYYSSTFVVEKMIE
FT                   YIEADRDSGKPFLASINFLANHIPVQAPDSDIARYAAMYQDGWTALREARARRAAALGI
FT                   VPAGTPMVTMPTTRDWQRLDADERAAAVRVMQAYGGMATAMDREIGRLVAHLKTTGDYD
FT                   NTIFVFLSDNGAEPTNPFASLRNRLFLRMQYDLSTDNIGRRGSFSAIGPGWASAAASPL
FT                   SGYKFSAAEGGLRVPLIIAWPGHGAIPAGAINDGLAHVTDLLPTLAELADVPLHEGTWQ
FT                   GRSVEPITGRSLVPMLKGAAGSVHGDAPLGYELSGNAALFRGDYKLVRNLPPTGDGRWR
FT                   LYDIKTDPGETRDLSAAMPDRFAAMLSDYRAYARANGVLDMPAGYTADEQINRYAWEQQ
FT                   GRKRAIKAGLWLGGGLMALALLVWSWRRRRARG"
FT   sig_peptide     297402..297509
FT                   /locus_tag="Sala_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.588 at
FT                   residue 36"
FT   gene            complement(299483..300412)
FT                   /locus_tag="Sala_0300"
FT   CDS_pept        complement(299483..300412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0300"
FT                   /product="protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52023"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE9"
FT                   /protein_id="ABF52023.1"
FT                   /translation="MIRSAALPALLLIGALAACGDDPDTPLAETKPPECPAMPAQDYAW
FT                   IPGATFTLGADAQLPEEGPPREVTVAGFWIATHEVTNAEFAEFVRATGYKTLAEQDPPP
FT                   LPGAPPDMLIPGSAVFTAPTDGNPNWWRWVVGAEWRHPAGPATNIDGRGRDPVVQIGYE
FT                   DALAFAKWKGKTLPSEEQWELAAASGGADRNVPVGKDGKPRANFYQGSFPLRDLGTDGF
FT                   TGRAPVACFPADAHGVHDLIGNVWEWTTSAAGSERNVIKGGSFLCAANYCARYRPAARQ
FT                   FQERSLGTDHIGFRLIDPARPAPDKPTP"
FT   sig_peptide     complement(300350..300412)
FT                   /locus_tag="Sala_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 21"
FT   gene            complement(300409..301032)
FT                   /locus_tag="Sala_0301"
FT   CDS_pept        complement(300409..301032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0301"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52024"
FT                   /db_xref="GOA:Q1GWE8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE8"
FT                   /protein_id="ABF52024.1"
FT                   /translation="MTTGVTKSEAARSGAERIDGRRARSRSSHKRIVEAMMELIVAGDL
FT                   SPSAARVAEEAGIGLRTVFRHFDDMDALYSEITATVTDRVMPIVTAPYPDQPWRANVRE
FT                   LVRRRIRVFETTLPFRLAANIKRYQSPFLMGQYSRVVMLERELILRLLPGHVLTDRITV
FT                   EALCAALSFHTWRTLRHDQGLSAEEAGEVLGQMVAALLATVADE"
FT   gene            301155..302786
FT                   /locus_tag="Sala_0302"
FT   CDS_pept        301155..302786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0302"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52025"
FT                   /db_xref="GOA:Q1GWE7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE7"
FT                   /protein_id="ABF52025.1"
FT                   /translation="MANKWVALGAMTLAAVGGYWAYDANKYRIPGIVQDWREPVQPNRA
FT                   IAWQQGPAAAPEGARPPNIILIVADDLGYNDISLNGGGVAGIVKTPNIDALAREGVHFT
FT                   TAYAANATCSPSRAAMMTGRYPTRFGFEFTAVPIEFAENLAHGEGVGPHRAIFHDELVT
FT                   PDIPPYPQMGVPASEVTIAEAVKAAGYHTVHIGKWHLGEAPELQPHAQGFDESLAVLAG
FT                   AAMLLPEDDPDAVNAKLPWDPIDRFIWANLRHAVTFNGSKRFAAQGHMTDYFADEAIKA
FT                   IEANRNRPFFLYLAFTAPHTPLQATRADYDRLAAIKDHRTRVYGAMIAQMDRRIGDVMA
FT                   KLKEAGIDDNTLVIFTSDNGGAWYNGMPGLNAPFRGWKATFFEGGIRAPLFMRWPARIA
FT                   PGTERGDVTGHLDLFATIAAAAGAALPADRTIDSEDILAGPAKRPAMFWRSGDYRAVRA
FT                   GDWKLQVTKRPEKARLYNLAADPTERTDLSAREPARVAELGAMIEAQNRGMATPIWPGL
FT                   VEGPVRIDVPLNTPWQDGQDYIYWTN"
FT   sig_peptide     301155..301220
FT                   /locus_tag="Sala_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.844) with cleavage site probability 0.798 at
FT                   residue 22"
FT   gene            302837..303844
FT                   /locus_tag="Sala_0303"
FT   CDS_pept        302837..303844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0303"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52026"
FT                   /db_xref="GOA:Q1GWE6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE6"
FT                   /protein_id="ABF52026.1"
FT                   /translation="MAKGSGSNGGGNARPTMADIANELGLAKITVSRALSNPSSVKEST
FT                   RRLVRETAERMGYRLNVSARNLRQQRTRTIAVVIEMTPSHERLMSEPYPLLLLGGIMQE
FT                   LTAAGQNMVLTTIDLFTAAPPSADGVILLGQGVHDDAAAVIEATGLPYVVWGAEHGPPG
FT                   RIVVGSDNREGGRLAADHLLGRGCRRLLFLGDAEHGEAEDRLRGFEARVAASDAAIVGN
FT                   IPCAFTLPAGREAVGPLLDARGLDFDGIFAASDAIAMGAIEALQARGHRVPGEVSVVGF
FT                   DDSPGAALFSPSLTSIRQDWAVGGELLAQKVLAKVAGQPVESRAMPVVLVKRES"
FT   gene            303981..306941
FT                   /locus_tag="Sala_0304"
FT   CDS_pept        303981..306941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0304"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52027"
FT                   /db_xref="GOA:Q1GWE5"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE5"
FT                   /protein_id="ABF52027.1"
FT                   /translation="MATIEQSLEPMRLVRRGAAGEDATARALFALANGLVGVEGMADEL
FT                   AVASCAYLPDAYIRRPITYHESFPGYASATDTRIACPSPVLLRLEIDGRAVDFAAADLL
FT                   DSEIALDLASGQVQRRSRWRLAGGRTIEIAAERIVPLDGGALVASRLHIRPVDFGGAVA
FT                   AWLTYGFDSAALHKGDADDPRISGRLRALWRLTSPLPGDASSVTRFAQDAVELAYRQHV
FT                   ACPDAAVAATEAGHVVRGELVAGGTLTIDRVVALAAARGRPVDLAALDDGDADFDALAE
FT                   RQRAAVQRLWDAADLAIDGDDALAAALRFDLFQLHQSASRDPNHSIGAKGLTGEGYEGH
FT                   YFWDAETFMLPVLALQAPEKARVLIAYRIGKLDAARAHARAIGHRNGALYPWRTIGGDE
FT                   CSSHYPTGSAQYHINGDIAYALALAVAATGDEALRAEAAEMLFETARIWMEIGAFDPRR
FT                   GGAFCIHGVTGPDEYSALVDNDFYTNAIARRHLAYAAETADWLAARGDPAAVTQRIGLD
FT                   AAEVAEWRRAADAMWLPVDSELGINPQDDAFLGRPELPGLAQRDGEGPLLMRYHPMILF
FT                   RHRVAKQGNVVQAMAMDLVAMPLAQQRRNLDYYTRVTTHDSTLSSVSFAIAAARLGDEP
FT                   AALDFMRECALVDLEDRHGNTSHGLHMAALAGSWLVLAEGWGGLRLDGAAPAFRPQLPA
FT                   AWTGYRFRLQWRGSVIETAVDAAGATYRLLAGAPLDITDHGRALTVGADRVFAPRPALK
FT                   GVIFDLDGVLTDTAEDHYQAWQALADAHGLTFDREANHALKGVDRAGSLRLILEQTGKA
FT                   VEPPKFEAMLAEKNATYVARLRGYSPANLFAGVERLFAALRAAGLKIGLASASRNARDV
FT                   VARLGIADAFDFIADAGAVTHPKPAPDIFLACADGMGLSPDQCIGVEDARAGITAIHAA
FT                   GMVAIGIGSEEALPDADIHVPAIGDLTLGQILSAEQETAARGRRTGRTVNAEDLSC"
FT   gene            306935..309295
FT                   /locus_tag="Sala_0305"
FT   CDS_pept        306935..309295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0305"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52028"
FT                   /db_xref="GOA:Q1GWE4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE4"
FT                   /protein_id="ABF52028.1"
FT                   /translation="MLKTTHLLSSIALFALPMAAHAQEAPLDDAAPADEEIVVTGTAGG
FT                   GISRQDAAFAITSINAEAIERAAPNSTADLFKVIPGVSAESSGGQNGANIFVRGYPSGG
FT                   DAEFVTLTVQGVPFFSPPTLSFLENTQLIRIDETIERVEAVRGGTGALFGNGQPGLTVN
FT                   FVQKEGGRDFEGLVKASITDFGDLRGDMLLSGPLGESTSFMIGGYYASGNGIRDPRFTA
FT                   EKGGQITANVRHDMDRGSILVFARYLNDRGQWLLPIPVVRDGDKVRQFGNIDPGTGVLA
FT                   GPETRLSLLPDGTRADLADGRGADLVNLGTNFDYEIGDGLQLRYRASYLKGDADTTGLV
FT                   PASTATSADAYAASLGSTIGSLTYVNGGQAVAGSQPVIRAGTWIVRKQIEDFTNDLAVE
FT                   WDSGNNKFTVGAYYSDFSSNDQWNLGNVQLLTAETNARLLNLVLANGQVATDRGFTQGS
FT                   FFNVNAAYDGREYAFYAVDEFQVTPELRLDAGIRYQHYKASGTLENNDFGVNVDGDPDT
FT                   LYDNGTAVLNGTFRNIAYKKGSWSWTVGANYDISSSVGVYARYNRGNTNPFFDNLRDGI
FT                   FVSPRVDNYEGGVKVRTDLLSLYATLFHTRFRGLATTVITNGAPIASIGGARSTGVEIE
FT                   GQIRPIDNVSIAFSGTWLDAKYRNFFADGGATDLSGNRVQRQPKWQWRVTPAYDIPFGN
FT                   DGKVSLYSTFTYVGDRFSDTANTQSLPNYFKIDAGISVDVNQALSFAVTADNLTDKVGL
FT                   TEGDPRQLGAGSQVVNARPILGRSFRFSAAYRF"
FT   sig_peptide     306935..307003
FT                   /locus_tag="Sala_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            309459..310688
FT                   /locus_tag="Sala_0306"
FT   CDS_pept        309459..310688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0306"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52029"
FT                   /db_xref="GOA:Q1GWE3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE3"
FT                   /protein_id="ABF52029.1"
FT                   /translation="MARTRLIAAMILTYVGFAMLLNSVGTVILQSISSFGVTKPQASTL
FT                   EGFKDITIALVSFATASYLARIGLRKALIGALLLAIAACLVMPMLGSFGAAQLHFAMVG
FT                   AAFAVAKVAVYSMIGFVTAGPRQHASLTSLIEGMFMLGVLASYWVFSAFIDPTGLRWLN
FT                   AYWVLAGIVALALALLLSSRVDEAPAGEEPAVPEAAPFRAMLRLAALPLVLVFVLCAFV
FT                   FVVIEQGIGTWLPTFNNEVLHLPAQMSVQAASLFAACIALGRFGAGAVMARFDWYPVLN
FT                   ACLILLAALIILVLPLADGLSPRPIAGWGDAPVAAFLFPLIGFALAPIYPTIISVMLSA
FT                   MPGRQHPPLMGLVVVFSALGGTTGSVITGQLFAHLDGRTAFTLMLVPTAILGIGLFLLR
FT                   RQIAVKDTAS"
FT   sig_peptide     309459..309530
FT                   /locus_tag="Sala_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.550 at
FT                   residue 24"
FT   gene            311012..311851
FT                   /locus_tag="Sala_0307"
FT   CDS_pept        311012..311851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0307"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52030"
FT                   /db_xref="GOA:Q1GWE2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE2"
FT                   /protein_id="ABF52030.1"
FT                   /translation="MRALLLSLALLAPFASAIANDDVIDTHVHLWNGEASLAEYRAKLK
FT                   AAGLSVERFGAMWFGGPNQARAGNPADISARNDALIALGKKHPDMIPIATVHPYDGDAA
FT                   LAEVTRVASRGVKLLKIHPHTQGFDAADPRVLTLVKHAGASGLVVLLDNASIVPADNEK
FT                   LFNLALAAPKTKFIFAHMGGMGFRFWNILALARTAEGLFAENIFFDISGVTLFADSPVK
FT                   DEYVWTIRNVGVDQVLIASDYPQMSLAKTLEAFDKLDLTEEERAKIRSGNAKRLLGL"
FT   sig_peptide     311012..311071
FT                   /locus_tag="Sala_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 20"
FT   gene            complement(311952..313118)
FT                   /locus_tag="Sala_0308"
FT   CDS_pept        complement(311952..313118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0308"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52031"
FT                   /db_xref="GOA:Q1GWE1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE1"
FT                   /protein_id="ABF52031.1"
FT                   /translation="MSIASIALPRILRIGGGASKQLGEVLETLGLSRPLIVTDPWLLNS
FT                   GRVDELAGGLASAGIAARVFADTVPDPTIASINVGVAFLQEGDHDCVVGFGGGSPLDSA
FT                   KAIALLGHHGGAMADYKAPHVQDTPGLPVIAIPTTAGTGSEATRFTIITDDATDEKMLC
FT                   PGLAYLPVAALVDYELTFTKPRRLTADTGIDSLTHAIEAYVSRRANPFSDGMAMLAMRA
FT                   IAPNLRRVCADPMDAAAREAMMLGATQAGIAFSNSSVALVHGMSRPIGAHFHVPHGLSN
FT                   AMLLPAVTAWSAPAALPRYADCARAMGVADDAEGDQAAVARLIDELAALNRELEVPGPA
FT                   AWGIDAARWDALIPTMCAQAAASGSPANNPRIPDADEMAMLYAKIWAG"
FT   gene            complement(313173..314231)
FT                   /locus_tag="Sala_0309"
FT   CDS_pept        complement(313173..314231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0309"
FT                   /product="putative lipoprotein signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52032"
FT                   /db_xref="GOA:Q1GWE0"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWE0"
FT                   /protein_id="ABF52032.1"
FT                   /translation="MTGLRAPLRLALLLMLLCAAPTVWAGPFVGQRLMTADHPPAAARN
FT                   ADGSTRLRVTVWYPAAGDDGAGTAPPVVRDAPPAAGGRRGVILLSHGFGGAAVAMGWFA
FT                   RTMAEAGYVVIGVDHPGNNGLEAMTKAGAALFFERPGDLRRAFDHVAADPVLGPMLDPG
FT                   RVAAAGFSAGGFTALALGGARMETGLLRRFCTANPDDGVCRPQLEFAVPIDEVLAMLDG
FT                   ESARARLAEIAATPPRPRIRALLVMAPAIVQAFDPASLAAIDVETRLILGGADSVTPNA
FT                   TNGLAVAALVPRAHHQTIPDAGHYDFLTACAADAPNPLPFCAHQRQTAAAHRAAITAAL
FT                   DLFARTIGARTE"
FT   sig_peptide     complement(314154..314231)
FT                   /locus_tag="Sala_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(314307..315344)
FT                   /locus_tag="Sala_0310"
FT   CDS_pept        complement(314307..315344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0310"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52033"
FT                   /db_xref="GOA:Q1GWD9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD9"
FT                   /protein_id="ABF52033.1"
FT                   /translation="MMKCSAMASSLSLAADRPCPTGFPALLRQHRKRDGRSQMNLALDM
FT                   GISPRHLGFLEKGRARPSADMVARIADALALTPAQRNAMLLAAGFAPKIAPASAAATAA
FT                   EAASLALGAFETAVAIAGASSAAAAVDIAARFLSALGIAHFMTGTLRRGIHGWEVGRDA
FT                   DGRPAIGWLRHNEANGYRNHDYLIRATAAASAGFFWSDIPRAMLSPLQRRILDEARDFQ
FT                   IADGFVMPVQMGDGSVRALSSWAGPIDTDLATRTAVGLVSTALLDQLARLAAPTLPVND
FT                   PVRLDPADRDMLAFFAAGYSIVGIGQRLALAEKEVERRLRGVAVLMGCSTPAMAACRAT
FT                   ALNLI"
FT   gene            315471..316313
FT                   /locus_tag="Sala_0311"
FT   CDS_pept        315471..316313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0311"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52034"
FT                   /db_xref="GOA:Q1GWD8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD8"
FT                   /protein_id="ABF52034.1"
FT                   /translation="MTSRLGPMLKAIRERAGIAQLELSLRMNVSQRHISFVESGRSRPS
FT                   RDLIGAWLGETDAPPSLRNAVLLAAGYAPASHDVSPRDPRLAVAIAALDRTLDLHEPYP
FT                   GLVFDADWQAHLTNRSARRLMRLNLPDFVAALDDLSLGFSMIDALIHPGGMFRYMRDPW
FT                   IGGGALLDQLRREQWVRPAIEPRADRVEASMIERFGPRPPQPTKPSADPCLNLVFDTPQ
FT                   GVMRFFTIQSVFALPQDVTLASLRMELWFPADEPTRAAMRALANSEAAPGEPLVTVKP"
FT   gene            complement(316344..316430)
FT                   /locus_tag="Sala_R0002"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(316344..316430)
FT                   /locus_tag="Sala_R0002"
FT                   /product="tRNA-Leu"
FT   gene            316747..318324
FT                   /locus_tag="Sala_0312"
FT   CDS_pept        316747..318324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD7"
FT                   /protein_id="ABF52035.1"
FT                   /translation="MAAFARIHMVMLSGVACSILAACGADGVASPGEGVIVVPAPTPTP
FT                   TPTPTPTPTPTGVTPAANCPTIAGADQLTDLGTITGNEGTWRNCGFPARFNSTTAIPKV
FT                   AGVIYSLPGRVDVGTDQGPTEEAGDPADVTLTIDPGVTIFGATGVSFLAVNRGNKIDAV
FT                   GTPTQPIVFTGRGNVVGSATDNTSQLWGGVVLLGRAPITDCLAPAATPGTAACERNTEG
FT                   ATNALYGGATANDNSGRMSYVQIRYSGFVLSANSELQGLTPSGVGSGTQIDHIQIHNSS
FT                   DDGAEVFGGRVNMKHLVITGAEDDGLDTDVGYQGNIQYVIGVQRAGGAVGDSMMEIDSD
FT                   GNEEAIPRQRVALSNFTYIQRNNAAGNGAAIRIRGGADYMFANGLIVAPGIRCLRIDSV
FT                   TTVRAADPALDDQGPPRFESVSLQCNATPFRGSNGVTDAEVQAIFEAGTNNRSNYVPSL
FT                   TNLFVNGATETGFTPFDAKTLNAFFDTTAYVGAVRDANDSWYQGWTCNSATADFGTSSG
FT                   SCTGIPTT"
FT   sig_peptide     316747..316821
FT                   /locus_tag="Sala_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.794 at
FT                   residue 25"
FT   gene            318409..321102
FT                   /locus_tag="Sala_0313"
FT   CDS_pept        318409..321102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0313"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52036"
FT                   /db_xref="GOA:Q1GWD6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD6"
FT                   /protein_id="ABF52036.1"
FT                   /translation="MTKRPIFASLLLLSTALVAPAALAQGSGADPAPAAADEPVADAAA
FT                   QDEDADISIPGGADAEIVVTGRFTPNVVRATPEVVSVLSSADIARTGEGDIAGSLQRVT
FT                   GLSVVGNGFVYVRGLGDRYSLALLNGSPLPSPEPLKRVVPLDLFPSNVIDSTLVQKSYS
FT                   ANFPGEFGGGVINLTTKSTPRETFLTFSGGVGWDSETTNELGYTYYGSDTDWTGFDDGT
FT                   RDVPPLLKAAFASGKPILEGADFTQDDLEAIQMELVNAETSLLQQNDHIPINWSAGITG
FT                   GTTITLPNGELGIIATMGISNKWRTRDTLQQTSLNQDLSGDPQTSFNRVITDNRIVVNG
FT                   LLGFGLELGDHKFRWTNLFIRDTLKQARLGLGVDRNQSERDILEQDTAWYERQLINTQL
FT                   VAEFDFDRLQLDLRGGYANSQREAPYERGFTYVRTNLPTEQDPTGDKFVNDLGGNRGDA
FT                   TIAFSDLTENLWSGGVDLSYEVAPRITATIGYAYSDTSRTAVRRAFQFRGSNLPVEVTQ
FT                   LRPDYLLSDATIQLYDISLLETSAQDGTAAFDAALTTHAGYGQVQAEIIPGVNINAGVR
FT                   YEDARQTVRPIDLFNTGSSAIVATNLNNDYWLPAVTLTWEVAPDMQLRINGSKTIARPQ
FT                   FRELIAQVYQDPESNREFRGNPSLTDSELWNAEVRYEWYFDRDQRFTLAGFYKSIDRPI
FT                   ETFTSISTDSVANSSFANAPKATLYGAEVEVQKYVPLDTLSDAPFWQSRRLVLIGNYTY
FT                   TKSEIKVGDDDTTVINGVTLSAADFFFDGSPLTGQSDHIVNFQIGIEDQDKLSQQTLLF
FT                   TYASPRVTSRGPSQQPDIREKPGISVDFVARQGVTLLNKDIELKFEARNLTGRTYKEVQ
FT                   EAGDNRIFLNRYKLGRTFSLSASLKF"
FT   sig_peptide     318409..318483
FT                   /locus_tag="Sala_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 25"
FT   gene            321266..322132
FT                   /locus_tag="Sala_0314"
FT   CDS_pept        321266..322132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0314"
FT                   /product="type II secretion system protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52037"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD5"
FT                   /protein_id="ABF52037.1"
FT                   /translation="MATLMPRSAVRLPRALPSWLRVGGRSPRAIWPQLLVGLLGALLVW
FT                   QAVRLLWVLLTPVSPLGAWQPQTAAIASAAERRALFTSLDPFFRGAAQGPAAATVTSAG
FT                   LTLFGINLNEATGGGSAIIAGEDGVQTSYAVGDEIAPGLKLAGVAFDHVLLDRGGARES
FT                   LFLDQSGAAPVARPATPLPAPTAEVGASASGELTAAAIKAGIAFAPRIEDGRVTGIVVQ
FT                   PTGDGATFRAAGLRPGDVIRSVGGRPIGAASDAAALANQLTPGARIALEVERGASVVPV
FT                   AIFLSKQ"
FT   gene            322138..324336
FT                   /locus_tag="Sala_0315"
FT   CDS_pept        322138..324336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0315"
FT                   /product="type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52038"
FT                   /db_xref="GOA:Q1GWD4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD4"
FT                   /protein_id="ABF52038.1"
FT                   /translation="MRLKLSLMLAAALVSATPVPAVAQYTLNVRDADIRAFIQDAARIT
FT                   GRTFVIDGRVNGKVSVVTDRPLSRSEYFEIFLATLRSNGLVAVPGPNGAYRVQPIDGAA
FT                   AQPGRIGSGGAAQNQFVTEIIRLRHIDAVAAVETLRPLVSAQGSLTANRNANSLVVADF
FT                   ADNIRRIRSLAASIDRDSSTSQIVTLKNAGAREIAAALQALVPAAGEGARAPVAIVPID
FT                   SSNAIALRGDQALVTRFVAMANELDAKAAGGTELRVYWLEHANAETLLPTLQQLIGGGS
FT                   DPVQRAGLPPASSSSSGGDGNAAPAAAAPASSSTGAGGSGSISTRGPAIVTRYEGANAI
FT                   IVAANSEVQRMLGELIRQLDARRQQVLVEAIVVEIGDDAAKRLGVQFLLGGKNIPFVAT
FT                   SYSNASPNILTLGGAYASTRISEETTTTDGTTVVTQTTSALGDALQEAAAAQLLSATGG
FT                   FAGFAGDIGKNTIFGAIINAVKSDTTSNLLATPHIVTLDNQPAKFLVGQDVPITTGEQL
FT                   GDNFENAFRTVQREEVGIKLEVTPQVNGAGEVKMFLRQEVSSVAGPVSSRNSDLILNKR
FT                   AFETVLTVDDGEILAIGGLLNDDERRTIERIPLLSDIPLIGELFKSRSRTRAKTNLMVF
FT                   IRPTILKSREDNAALTARRYGYIRNFQLQRNPDVEPAIDTLVRDYMGATPPSPPTPDDV
FT                   TVGPVNLPQLRGTDGAVIQTDVPPSVSQAPAPPAGDYP"
FT   sig_peptide     322138..322209
FT                   /locus_tag="Sala_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            324333..325826
FT                   /locus_tag="Sala_0316"
FT   CDS_pept        324333..325826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0316"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52039"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD3"
FT                   /protein_id="ABF52039.1"
FT                   /translation="MSDSEPAAPAAAPVDIPYGFARAHGVVIAPGEEGVWLATLREGSD
FT                   PAVLIEVKRHLAQPLRVATADAADFDRLLSDHYAVDSSAAAMAGSVGSDGLDLGIPSAE
FT                   DLLDSADDAPAIRLINAIIAEAVRQGVSDIHIEPYESGLVVRMRADGVLREHLRMPPHV
FT                   APVVVSRIKVMARLDIAERRVPQDGRIGLTLAGKAVDVRVSTLPSRAGERVVMRILDKD
FT                   AAGIDFDILGLSGEADRILREALAEPNGIILVTGPTGSGKTTTLYAALKQLNDGQRNIL
FT                   TVEDPVEYAVDGVGQTQVNSKVGLDFAAGLRAILRQDPDVVMVGEIRDRETADIAVQAS
FT                   LTGHLVLSTVHTNDAVGAITRLKDLKVEPFLLASTLRAVIAQRLVRKLCDNCREPVQAD
FT                   NSIAAMLGLDIGTVIWRPKGCEACGGTGFKGRIGVFEAIKVDDTVRRYIYAGGDEAMIA
FT                   KHAFLKSPTLASAARTMVAKGLTTAEEAIRVARREDVDA"
FT   gene            325819..327036
FT                   /locus_tag="Sala_0317"
FT   CDS_pept        325819..327036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0317"
FT                   /product="General secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52040"
FT                   /db_xref="GOA:Q1GWD2"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD2"
FT                   /protein_id="ABF52040.1"
FT                   /translation="MPDYRYVAIDPAGRERKGRLTAANDDAARADLIRRKFHIVVVEEA
FT                   GTKAGSGRSLLAFRKDRLGRKELALFTRQLATLAEVAPLEEALRTLTRQSEAESARGVI
FT                   ADVHAGLLEGRRLADAMARQPTSFPPLYRAMVAAGETTGSLTVILARLADLLERQAEVR
FT                   GKLIAALAYPIVLAVVAIGVVAALMIFVVPRVVEQFTDTGQRLPFLTRAVIGVSSFAAN
FT                   WWWLIALLMVAAAFGWAAAIRRPAFKARVDARLLRLPLLGRLLRDLYAARFARTLATMV
FT                   SSRLPLVEGLRLTLPTIRNAALASATAGLVDQVRAGGSLSAALRDAGVFPPLLVYMTAS
FT                   GESAGRLEVMLERAADYLEREFDRFTAASMALLEPVIIVVMGSCVALIILAILLPILQL
FT                   QNLAGL"
FT   gene            327040..327531
FT                   /locus_tag="Sala_0318"
FT   CDS_pept        327040..327531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0318"
FT                   /product="General secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52041"
FT                   /db_xref="GOA:Q1GWD1"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD1"
FT                   /protein_id="ABF52041.1"
FT                   /translation="MSLMQLFLRLMLDTGRPPVHRRRKKGERGFTLTELMVVIFIIGLL
FT                   ATVVMINVLPSQDRAMVTKAKADIATLETALEQYRLDNLTYPTSTDGLNALVTAPPALA
FT                   QPERYRRGGYIRKLPEDPWGRPYNYQAPGPNGKAFDVWSLGADGAPGGTDENADIRGDS
FT                   "
FT   gene            327506..327994
FT                   /locus_tag="Sala_0319"
FT   CDS_pept        327506..327994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0319"
FT                   /product="General secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52042"
FT                   /db_xref="GOA:Q1GWD0"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWD0"
FT                   /protein_id="ABF52042.1"
FT                   /translation="MRIFAATAKLRARARPDANGFTLVELMVVLAIMALAATAVVLTIP
FT                   GEERSVRSEADRLAARLAAARDVAVIEGRSVAVRFAPSGYGFERRIAGEWQPLPGRPFE
FT                   QRSWPADVTFSAESGQGVARILFDRVGTSPTPQTVVLSGGDAREMVRVSATGEVSRGR"
FT   gene            327984..328361
FT                   /locus_tag="Sala_0320"
FT   CDS_pept        327984..328361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0320"
FT                   /product="General secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52043"
FT                   /db_xref="GOA:Q1GWC9"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC9"
FT                   /protein_id="ABF52043.1"
FT                   /translation="MGADPLRPDERGFTLLEMLVALSIISIAALTLVRLDAYAVRTAGD
FT                   LDVSTVAGIVAQNRAVELWTDPAPPTIGNSAIGVTNAGRNWRIDQRVTKTADAALLRID
FT                   LLVRPESGSGQAALTIIRPAR"
FT   gene            328358..328969
FT                   /locus_tag="Sala_0321"
FT   CDS_pept        328358..328969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0321"
FT                   /product="General secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52044"
FT                   /db_xref="GOA:Q1GWC8"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC8"
FT                   /protein_id="ABF52044.1"
FT                   /translation="MTDQRGFTLVEMLVALSLFAAIAAIGVGLLRSSIDTQDAVQERLK
FT                   GMSGMNRVRAIMANDLAQAVQRPTRGAAGEAVPAFVGSSNGFAFVHAGAAAFDGSPRPA
FT                   VARVGYARVGSEWRRATQPMLDGTALGEGDRLLDAVTAARVRYRDEAGRWSESWTSEPG
FT                   DRLPRAVEVRIDRTGRPPLTMLFLTAPTPLPPPAIAGEAP"
FT   gene            328966..329970
FT                   /locus_tag="Sala_0322"
FT   CDS_pept        328966..329970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0322"
FT                   /product="General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52045"
FT                   /db_xref="GOA:Q1GWC7"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC7"
FT                   /protein_id="ABF52045.1"
FT                   /translation="MTPAPGDRGAALLSVLLLVAVMAVIAATALDRLTLATRIAGSAAT
FT                   VDQGRAYSFAAEQIALGRVADLVGRDPAKLTLAGDWLGRDFVLPLPGGEGRARLTDASN
FT                   CFNLNSLVAETLPGRLTQRMGAQRQFAALMTLLGIEDGEAQAIAGAAADWIDSDSNEGR
FT                   LGAEDNVYRSLPGAYLPANRKMAHVSELRAVRGVSAKLYAQLEPWVCVLPTTDPVKLNV
FT                   NTLAAWQAPLVAMLWPGEIDVRAARAALAARPAGGYGSSVRFWEASAFDRRKPPDDVAE
FT                   QAAVTSRWLVLTTNVTMGDGFLTAVSLIDANGGAPSVGTAPPVIVRRDWGESD"
FT   sig_peptide     328966..329046
FT                   /locus_tag="Sala_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.927 at
FT                   residue 27"
FT   gene            329984..331117
FT                   /locus_tag="Sala_0323"
FT   CDS_pept        329984..331117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0323"
FT                   /product="General secretion pathway L"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52046"
FT                   /db_xref="GOA:Q1GWC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC6"
FT                   /protein_id="ABF52046.1"
FT                   /translation="MLIWLPRVAALADAAAAPAAWLRIDDGVVVDSGQDDGWVADWEKQ
FT                   GDDGPDDRLIALAPAADVPLRWFHYPDAAPAQAAAAARIDALKASLGDAAGLHVVAGQP
FT                   TEMGQAVPVAVTTHAAMTGWTGWLAARGLTAAAIIPAAAALPPPEADSLWSAELGGERI
FT                   IRSADRAWASDPELDPLIAGNHDVAPLDAEAMREALLLTLAAPPLDLLSGAWKPKRRWA
FT                   VDPAMLRLAKRLAIALVAVSVAIPIVYALRLTADTSRADDAVVAMATRAGVTASDASAA
FT                   ETEIDRRLATAGGGPLAFSVPASALYDAMRDAPGVSLKNLSHRTDGTLTTTLAAPRVDD
FT                   INQVLLALQARGYRITAQPMAGAGGQQMAHVTIRAVP"
FT   gene            331114..331596
FT                   /locus_tag="Sala_0324"
FT   CDS_pept        331114..331596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52047"
FT                   /db_xref="GOA:Q1GWC5"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC5"
FT                   /protein_id="ABF52047.1"
FT                   /translation="MTERLKYWWAGLSGRERWLVGIAAVLALGVLGWGLGRPAVAAFID
FT                   LENRHRAAIEREGRVAAKVALLGARPQKSVAASADAGAIDQFLQQSAGEIGLTLDRNEA
FT                   RGTNRAAIAIATAKAPVLTDWLASLEAQGFVIDQLTITPAADGTVGMTAELRKGGQ"
FT   gene            331593..332309
FT                   /locus_tag="Sala_0325"
FT   CDS_pept        331593..332309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0325"
FT                   /product="type II secretion system protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52048"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC4"
FT                   /protein_id="ABF52048.1"
FT                   /translation="MSVRRRWIVAAALLALVLLVATFPMRLALGWSGAGDAGVSARTVR
FT                   GSVWSAELVDARLGALPLGTVRASLSPLALLTGATELAFERSDDRLGALAGRLHGTSPR
FT                   GMSDVNGMSAMVGGLGMIPVDTIRFEGATVRFDDAGKCVRASGRVQLMVAAPIAGLDLS
FT                   RGLSGPLRCANGRAEAALASQSGMERLTLIFDGGGAWRARLAISVDRDPTMAAALAALG
FT                   FRAAPGGFVLATSGRF"
FT   sig_peptide     331593..331685
FT                   /locus_tag="Sala_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.796 at
FT                   residue 31"
FT   gene            332423..333205
FT                   /locus_tag="Sala_0326"
FT   CDS_pept        332423..333205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0326"
FT                   /product="type 4 prepilin peptidase 1. Aspartic peptidase.
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52049"
FT                   /db_xref="GOA:Q1GWC3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC3"
FT                   /protein_id="ABF52049.1"
FT                   /translation="MVDQSLKILDALPFGTGILLAGLTGLLLGSFIATLVLRWPEGRSL
FT                   LGRSQCDGCGRALGVRDLVPLVSAALSRGRCRTCGARINPFHGRVELVSALIGAGALAL
FT                   LPGTAGWLWALFGWLLLPLALLDARHFWLPDRLTLLLAVTGVLLAGPMLGTSLVDRWVG
FT                   ALVGGGTLALLAWLYARARRREGMGGGDPKLVAATGAWLGWQALPLMLLLASLGGIIWA
FT                   LVVQRKGDQPLGERRVPFGMFLCGAAFAAVPLWPLIAR"
FT   gene            complement(333192..333704)
FT                   /locus_tag="Sala_0327"
FT   CDS_pept        complement(333192..333704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0327"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52050"
FT                   /db_xref="GOA:Q1GWC2"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC2"
FT                   /protein_id="ABF52050.1"
FT                   /translation="MTIRKSTAMIAAITMLAVGACAKKAPDTLPPAPEGAGTDTTTDTG
FT                   TGVVPGSQEDFVANVASDRIFFDFDQYNVDAQDQATLQSQAQWLQRNPAVRVTLEGHAD
FT                   ERGTRDYNIALGERRANAAKNYLASLGIDPSRINVISYGKERPAAIGSNEEAWAQNRRA
FT                   VTVVIGR"
FT   sig_peptide     complement(333636..333704)
FT                   /locus_tag="Sala_0327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.921 at
FT                   residue 23"
FT   gene            complement(333811..335175)
FT                   /locus_tag="Sala_0328"
FT   CDS_pept        complement(333811..335175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0328"
FT                   /product="TolB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52051"
FT                   /db_xref="GOA:Q1GWC1"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWC1"
FT                   /protein_id="ABF52051.1"
FT                   /translation="MSLRPISLMLALLLTSAPALAQSAPTPPATVQTEPRETIEGTLSQ
FT                   ERTVIGIPSFATASVQTVAGLRTDALGRQLADVIAADLERSGLFEPIGPNGVRAIGRAE
FT                   VQAPRFGEWQARGAENVVHGFVDAGSNGSLIVGCYLYDTALGSELVRKGFEIQPADWRR
FT                   AAHKCADAIYSRLSGEAPFFDSRVAYIAESGPKGNRIKRLAIMDSDGGNHRFITNGQAL
FT                   ALSPRFSPDYKKIVYVSYLNDRVRVFIYDVASGTQRLVTESRNPTFAPRWSPDGTQILY
FT                   SMAVGGNTDIYRISANGGTPVRLTTAPGIDVGGSFSPDGRKIVFESDRSGSQQLYVMNI
FT                   DGSNQQRISFGGGRYATPEWSPRGDLIAFTRMGGGEFRIGVMTPSGGGVRMLTNGWQDE
FT                   APTWSPNGRVIQFFRTTPGREGRSSLWQVDLTGVNLRRLPTPQDGSDPSWGPVLP"
FT   sig_peptide     complement(335110..335175)
FT                   /locus_tag="Sala_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.970 at
FT                   residue 22"
FT   gene            complement(335181..336002)
FT                   /locus_tag="Sala_0329"
FT   CDS_pept        complement(335181..336002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52052"
FT                   /db_xref="GOA:Q1GWC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWC0"
FT                   /protein_id="ABF52052.1"
FT                   /translation="MAEAGADRGNERRGFAIAVAAHVVIIGLLSIQWTAGERRFDNPPM
FT                   EVDLIAETAVQSTAPVISETPPAARLGEEDNVDIAAPEPMPAPPLPEPVVRPTPAPTPK
FT                   QVARPKAQPKQTPPAAVKAQPKAAPKAPPAKDRPARPTGRLDGIAEGLSKSQPKSPSSK
FT                   GAPAAATAAEVRRSIDVSIKAAVAPRWNSCRVSGVDVDQLKTIVKFRLTQSGALAGFTS
FT                   VTTTGENDSNRFQIERHQECAKRAVELAAPFDLPEENYSFWQNYTLDFIKR"
FT   gene            complement(336012..336533)
FT                   /locus_tag="Sala_0330"
FT   CDS_pept        complement(336012..336533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0330"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52053"
FT                   /db_xref="GOA:Q1GWB9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWB9"
FT                   /protein_id="ABF52053.1"
FT                   /translation="MAMTGPSGGGGGRRGRGHRRAPMSEINVTPLVDVMLVLLIIFMIT
FT                   APLLASAVPIDLPESRAKPVETEEEEPVQLSINADDTLYIGDEIVPEAELPARLDAIAR
FT                   ERRGEDRPRQIMLRADKGLDYGRVMRVMGELNRAGLTRIALVTTGAEASADTPPPTADA
FT                   AVTDGSDSGQ"
FT   gene            complement(336533..337231)
FT                   /locus_tag="Sala_0331"
FT   CDS_pept        complement(336533..337231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0331"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52054"
FT                   /db_xref="GOA:Q1GWB8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWB8"
FT                   /protein_id="ABF52054.1"
FT                   /translation="MLDNISLAADAATLSPVALFLQADIIVKAVMIGLLAASIYVWAVI
FT                   FTHGRGVGKLMRASERFERDFWRADNIDRFFDKNGAEELPSAKVLSAGIGEWRRSTKGK
FT                   VIDRDGTRERLGIAMNSAIAGEIDRLAEKIGTLATIGAVAPFVGLFGTVWGIMRSFTAI
FT                   AAENNSSLAVVAPGIAEALFATAIGLFAAIPAVIAYNAFSQRLNRLESRLGRFADGLHA
FT                   TFSRELEVEA"
FT   gene            complement(337225..337704)
FT                   /locus_tag="Sala_0332"
FT   CDS_pept        complement(337225..337704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0332"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52055"
FT                   /db_xref="GOA:Q1GWB7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWB7"
FT                   /protein_id="ABF52055.1"
FT                   /translation="MVNAPPPFVPGAFVGIEHHYRARVYFEDTDLSGIVYHANYLRYME
FT                   RARSDMLRLAGIDQRAAMEDGEGAWAVTDLSIKYRSPAKLDDDLLVVSTVEVVRGASVI
FT                   IAQRILRTNDTLSGETLTDGRVTAAFLSPTGRPRRQPADWVQRFTAIMNGDNIPC"
FT   gene            complement(337887..338903)
FT                   /locus_tag="Sala_0333"
FT   CDS_pept        complement(337887..338903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0333"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52056"
FT                   /db_xref="GOA:Q1GWB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWB6"
FT                   /protein_id="ABF52056.1"
FT                   /translation="MTDLTTPIRTPEDADAALRPKTLAEFVGQAAARENLRIFIEAAKA
FT                   RGDALDHVLFFGPPGLGKTTLAQIVARELGVGFRSTSGPVIAKAGDLAALLTNLEDGDV
FT                   LFIDEIHRLSPAVEEILYPAMEDRALDIMIGEGPSARSVRIDLPQFTLVGATTRQGLLT
FT                   TPLRDRFGIPVRLNFYTHAELEQVIGRAARLLGLAIAPDGALEIAKRSRGTPRIAGRLL
FT                   RRVRDFAAVAGHAIVDARAADAALNRLEVDALGLDAMDRRYLTMIADIYRGGPVGVETL
FT                   AAGLSEPRDTIEDVIEPYLLQIGLIARTARGRTLNASAWKHLGLNPPAGSQDGLFDK"
FT   gene            complement(339108..339512)
FT                   /locus_tag="Sala_0334"
FT   CDS_pept        complement(339108..339512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0334"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52057"
FT                   /db_xref="GOA:Q1GWB5"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWB5"
FT                   /protein_id="ABF52057.1"
FT                   /translation="MTDRTRHPSCRCGQVRIACTGEPIRVSVCHCRECKARSGSAFAAQ
FT                   VRFPAEQVRTEGEAKLWQYTGDSGHTADFFFCPTCGSGVWYRARPHHDAYAIPLGNFEP
FT                   GHGFAPEYSVWEERREPWVSIIGDGIEHHD"
FT   gene            complement(339509..340108)
FT                   /locus_tag="Sala_0335"
FT   CDS_pept        complement(339509..340108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0335"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52058"
FT                   /db_xref="GOA:Q1GWB4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWB4"
FT                   /protein_id="ABF52058.1"
FT                   /translation="MIAKLTGRLDSNGAGHAVIDVGGVGYLVEASARTLDALGAVGGEV
FT                   TIHTEMLVGEDFLRLLGFARAEERDWFRLLTSVQGVGAKVALAILSALEVADLQRALAS
FT                   GDSAMIARANGVGPKLAQRITHELKDKAGALGGISGSGPALSAAAGPVGDAIAALTGLG
FT                   FKPGEASAAVAAANEELGADASLDALVRVALKKAAK"
FT   gene            complement(340421..340891)
FT                   /locus_tag="Sala_0336"
FT   CDS_pept        complement(340421..340891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0336"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52059"
FT                   /db_xref="GOA:Q1GWB3"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWB3"
FT                   /protein_id="ABF52059.1"
FT                   /translation="MIILGLDPSLSCTGWGLIRVEGSRISHIANGQIKTDAKAALPDRL
FT                   VHLDTALAAVIADHAPKCAAVEEVFVNDNPQSTLKLAHARGVVLLGCARGGLTVTQYAP
FT                   RLVKKAIVGTGGAAKGQVQAMLGVLLPGTKVAGPDAADALAVAICHANHRRR"
FT   gene            complement(341031..341777)
FT                   /locus_tag="Sala_0337"
FT   CDS_pept        complement(341031..341777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0337"
FT                   /product="protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52060"
FT                   /db_xref="GOA:Q1GWB2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWB2"
FT                   /protein_id="ABF52060.1"
FT                   /translation="MAGHSKFKNIMHRKGAQDKKRSALFSKLSREITVAAKMGLPDPDA
FT                   NARLRAAVNAAKAQSMPKDNIQRAIDKASGGDGDNYEEIRYEGYGPGGVSLIVEALTDN
FT                   RNRTATNVRTAFSRNGGNLGTSGSVSHGFDRLGLISYPPGVGDADTVFEAALDAGADDV
FT                   ESSDDGHDIWTSIDSLHEVAKALEAKLGEAEGVKLAWRPTMKSEVADEATAQTLFKLID
FT                   TLDDDDDVQTVWGNYEIPDAVMEKLG"
FT   gene            complement(341949..342266)
FT                   /locus_tag="Sala_0338"
FT   CDS_pept        complement(341949..342266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0338"
FT                   /product="protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52061"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWB1"
FT                   /protein_id="ABF52061.1"
FT                   /translation="MFSTTTNNIEGHPVREYLGIVTGEVIVGANLFRDLFASITDIVGG
FT                   RSGKYEDVLARARKEALGEMEAEAAKLGGNAVIGVDIDYEVLGQNGSMLMVSASGTAVV
FT                   I"
FT   gene            complement(342320..342562)
FT                   /locus_tag="Sala_0339"
FT   CDS_pept        complement(342320..342562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52062"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWB0"
FT                   /protein_id="ABF52062.1"
FT                   /translation="MSEATVSDEQLRLFIERIERLEEEKKGIADDIRDTYNEAKSQGYD
FT                   PKIMRQIVRLRKLPPHDRKEMEAILDVYKSALGID"
FT   gene            complement(342618..342947)
FT                   /locus_tag="Sala_0340"
FT   CDS_pept        complement(342618..342947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0340"
FT                   /product="protein of unknown function DUF1244"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52063"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA9"
FT                   /protein_id="ABF52063.1"
FT                   /translation="MSCSDQQAAPNDALDTLDDAVAAAAFRRLVRLLRHRHDAANIDLM
FT                   GLAGFCRNCLGDWIAEAGDMDRETGRAIVHGMPTAEWKARFHTAATPEQLTRMEESMAK
FT                   NPRAR"
FT   gene            343046..344500
FT                   /locus_tag="Sala_0341"
FT   CDS_pept        343046..344500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0341"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52064"
FT                   /db_xref="GOA:Q1GWA8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA8"
FT                   /protein_id="ABF52064.1"
FT                   /translation="MVQSFTPRQRKVRILATLGPASANAEMIAALHRAGADAFRVNMSH
FT                   GDHAGHAKVIAAIRSLEKETGRPTTILVDLQGPKLRVGTFRDGPAELVKGAAFMLDTDT
FT                   APGDATRVHLPHPELFAALEPDTRLLIDDGKLVLRVKSVSAERIETIVEVGGKISDRKG
FT                   VNVPDVVVPLAALTEKDRKDLAFALEQHVDWIALSFVQRPEDVAEARRLIGGKAALLVK
FT                   FEKPSGVQRIDEILELADAAMVARGDLGVELPPEAVPPLQKRIVATARRMGKPVVVATQ
FT                   MLESMIVSPSPTRAEVSDVATAVYDGADAIMLSAETAAGAWPVEAVTMMDSIARSVEGD
FT                   PDYFRRLHFTETQPDATTADALAEAAGSIITTIAADAIICFTASGSTARRVARERPGAP
FT                   LLVLTPRKEAARRMGLLWGAHAVPTRDIGSFEEMIAKGKRMALRHGIGKAGSKLVMMAG
FT                   VPFGTPGSTNVLHVATLTGDELRGYS"
FT   sig_peptide     343046..343123
FT                   /locus_tag="Sala_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.906) with cleavage site probability 0.897 at
FT                   residue 26"
FT   gene            344728..345501
FT                   /locus_tag="Sala_0342"
FT   CDS_pept        344728..345501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0342"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52065"
FT                   /db_xref="GOA:Q1GWA7"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GWA7"
FT                   /protein_id="ABF52065.1"
FT                   /translation="MSAPFRFPRFFVTSPAPCPYLAGRTERKVFTELSGNNATELNDAL
FT                   GRIGFRRSQSVAYRPSCADCSACVSVRVCASEFAPSNSQKRTLRRNGDLVVTACKPWAT
FT                   EEQYALLRSYLASRHPDGGMADMDEQDFADMVEQTPVDSYMIEYREPVAGGGKGRLVGC
FT                   CLTDRQGDGLSMIYSFFDAHHPLREGLGTYIIADHVLRAAKAGLPYVYLGYWIEGSARM
FT                   AYKARFRPLEKLGPDGWSRFEPTPSERIAAMFELA"
FT   gene            345792..348227
FT                   /locus_tag="Sala_0343"
FT   CDS_pept        345792..348227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0343"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52066"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA6"
FT                   /protein_id="ABF52066.1"
FT                   /translation="MSEPVKVAIIGSGPAGLSAAARAAQLGMSHVLLEKTDHLSDTIFK
FT                   YQKGKRVLATPERLDLRSDCRFAEGAREQILANWDEDAANNKVNVAYRADVAEVTGEKG
FT                   AFAIRTAKGDVFHAENIVLAIGTQGNPNRLRCEGYDLPHIIYQVDDPEDFRDKHITVVG
FT                   SGDAGIENALGVAEEALENTVTILNRSRDFARAKAKNVSDLMEAAENGLISIRTETQPK
FT                   KVEPGWLTLDTPDGEERIPCDVIVARLGSVAPRAFVESMGIEFTGPDREAFPKLSPTFE
FT                   STVPGIFVIGALAGYPLIKHCMNQGYDVVEFINGNMALTPADEKDLAAIFAGLPQQKPV
FT                   SEWLDYLRERVSIFADVSPLQMREFMLDSKVAFYRKGEVVFEKGEPGSSLFAIADGHAE
FT                   VEVGPGATVPIEQGSIFGEVGLISGRKRGATIRAGADSIFVEVSRTAALKLMAAVPGAR
FT                   RAINRISLERQLLQIFKGGLTAEDLAPVVEAAEVERVPAGKAVLIEGEQGDDVYVIRSG
FT                   SMVVEKDIGGKPIFLRYLPAGSFFGEMGVLSGEPRNATVKAAVGSEVIKLTGDSFRKML
FT                   AARPQVREATEAAVAERAAMNSFIESRKASYSSAVDLYSDTASFIMKEGLGEATDALLI
FT                   DENLCVGCDNCEKACADSHEGLSRLDREAGKTFAHLHVPTSCRHCEHPHCMADCPPNVI
FT                   HRGPDGEVFMEPGCIGCGNCMRNCPYGVIRMEAAPPPKPGLLSWLLLGRGPGPGEPSPK
FT                   WTKKQLGDEKPKKIAVKCDMCKGIAGGPACVRACPTGAAIRVSPEEFLSIARLGEATD"
FT   sig_peptide     345792..345863
FT                   /locus_tag="Sala_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.969 at
FT                   residue 24"
FT   gene            348227..349108
FT                   /locus_tag="Sala_0344"
FT   CDS_pept        348227..349108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52067"
FT                   /db_xref="GOA:Q1GWA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA5"
FT                   /protein_id="ABF52067.1"
FT                   /translation="MASLFQRRRSKATQVERVRERQHEGFLRYAGFRWAKISGGLCLLV
FT                   ILSYALIDVTPRHNGGSWYGYTLGTIGALLILWLTALGYRKRKMTRDYWSLKAWTSAHV
FT                   YLGLSLIIIGTWHTGFQLGWNVHTLAWVLMMLVILSGLYGVIVYATLPAALSNNRDQMT
FT                   QMQMLEAIRAFDRQLHSAAQPLTPADSAAVLGSLDQDPFAGGAWARLRGRYPGCATAAA
FT                   RRALAASQGGNADARAKVVQLLSQKEAALARLREHLRLRALLEIWLYVHVPLTFALIAA
FT                   LSAHIVSVFFYW"
FT   gene            349119..351053
FT                   /locus_tag="Sala_0345"
FT   CDS_pept        349119..351053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52068"
FT                   /db_xref="GOA:Q1GWA4"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA4"
FT                   /protein_id="ABF52068.1"
FT                   /translation="MSFILRRIATTKTGKQIVRDQPLPGDTITLGRDSANGIHVADLAV
FT                   NPHHATIASSDGRTVRVTAQEGLGFDLNGRTETVADIDSAAGGELRFGGHRLTIAREDG
FT                   RIILLVERIDELSQSSKDVDEVKAFSLAGVMPGKRVGAWTFGLLMLLAFLVGPIWAWHS
FT                   YRQVDERPDGFHADRTWLSGPLSSAHANLTKDCQSCHVEPFVAVTDSACVNCHTGEHKA
FT                   MSMAHAGAPTAMLLAARAPPGGFDKFLANVGEAFNRPQGRCVDCHTEHEGAGPMAATPQ
FT                   QFCADCHDGMQGRLKSAGHPTMLADASDFGTGHPEFRPLVRAVPGGKLERMMLAKGVVD
FT                   DNGLKFPHDLHLRANGGVARMAASFRGRHDFGRKLECENCHRVEADGVRVKPVEMERDC
FT                   AMCHSLAFETVGGVTRTLRHGEPTQVIADLTAYYRSTPPSRPLQLGGMQRRRPGAYAEG
FT                   QVYNIYFNEVAVRPARAQDAVRAIFSKGGACYDCHTIFAPRAGSSWRVAAVNQTQRYLQ
FT                   KGWFDHDAHKETACADCHTAAPASKASTDLLVPGLRQCRDCHVGEGGARLVKVETATES
FT                   PCAMCHEYHSDGGKPWAPKRQQRVNSVAITNKRAGASVSVTAITGAAARGLYHVTWRTP
FT                   ALHGARRGG"
FT   gene            351095..351943
FT                   /locus_tag="Sala_0346"
FT   CDS_pept        351095..351943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0346"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52069"
FT                   /db_xref="GOA:Q1GWA3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA3"
FT                   /protein_id="ABF52069.1"
FT                   /translation="MLIAQITDIHIGFDPDNPAEYNRKRLDEVLDVLIEGPNRPDLLLA
FT                   TGDITDRGDADSYRRLATAFSRCPFPVWPSVGNHDLRDNFHARFPGFDDGNGFVQYTVE
FT                   LPELRLVTIDTLEEGRHGGAFCERRAAWLDAELAKAPARPTYIVMHHPPVESGIEWMNT
FT                   HPDEPWVATFTDVVRRHPQVRGLICGHLHRSVTVAWEGRTIAICSSTAPQVSLDLRPID
FT                   ENHPDDRPMIVAEDPAYALHRWNGRELVSFYDHAGAHTMLAKYDERLQPLVRELKAERP
FT                   G"
FT   gene            complement(352006..352950)
FT                   /locus_tag="Sala_0347"
FT   CDS_pept        complement(352006..352950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0347"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52070"
FT                   /db_xref="GOA:Q1GWA2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA2"
FT                   /protein_id="ABF52070.1"
FT                   /translation="MTKTVTVLSGLIRPLVESRLPEWVEPRFFQSKDEALELAPHAEIG
FT                   WFDMYDKKDMAAVITAATKLKWLNSIYAGVDGMPLDLLATRGTIVTNGAGINAITIAEY
FT                   VVMGMLTVAKGYREVVRAQERREWLTDSPGKVELFGSKALLLGYGAIGKLIEERLKGFA
FT                   VEVTVVRRTPGEHTLTPDQWRARLGDFDWVILAVPATPETDGMIGAAELATMKPSATLI
FT                   NIARGSVVDQDALVAALDAQQIAAAFLDVTTPEPLPADNPLWSLDNAHITMHLSGRAQD
FT                   KMFVRSAERFLENLARWHRGEAVEPRVNLTLGY"
FT   gene            complement(352947..353393)
FT                   /locus_tag="Sala_0348"
FT   CDS_pept        complement(352947..353393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0348"
FT                   /product="protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52071"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA1"
FT                   /protein_id="ABF52071.1"
FT                   /translation="MRPDKPASTIRRAKRLRRDLTLPGTLLWQILRTAPGGHRFRKQHP
FT                   AGPYILDFFCARADLAIEIDGIAHDMGGNPAHDERRDIWLRANRIDTIRIPVRAVLDSA
FT                   ERVAQSILDMVEDRLNSFGKAPPSSLRDATSPSQVDGEDQKDRI"
FT   gene            complement(353461..355044)
FT                   /locus_tag="Sala_0349"
FT   CDS_pept        complement(353461..355044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0349"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52072"
FT                   /db_xref="GOA:Q1GWA0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GWA0"
FT                   /protein_id="ABF52072.1"
FT                   /translation="MGGGMTDTPASPPLRLFNSLTRRLETFEPVHPGEARVYSCGPTVY
FT                   NYPHIGNMRAYVFADTLGRTLSFKGYKLTHVINITDVGHLTDDADAGEDKLEKAAAEKA
FT                   QSIWDIARHYTEAYWADVKALNIRGPMKAGKPEAAHWSIATDYVPQMIEFAKAIADKHC
FT                   YELDSGLYFDTSTVADYGRLARHATDEGESRIDPVDGKRHPADFAIWRKTPPGETRQME
FT                   WDSPWGKGAPGWHLECSVMSEALLGFPFDIHTGGIDHREIHHPNEIAQNQARSCSTDSG
FT                   ARIWMHNNFLVERSGKMSKSAGEFLRLQLLIDKGYHPLAYRLMCLQAHYRSELEFSWEG
FT                   LGAALTRLKRLVMAVQRTKEAATLSEWKPFKKYLRSPGMVDDYIDSINETDEWFDFTGI
FT                   LGEFDDAISNDLNTASAFPTSEKLALTKLVEEAVTDPFIQLDNRLRLIATMDQIFGLRL
FT                   LELDRIDLRIRPKTATITESEIEAILTRRKEARAAKDFATSDKLRDELIAAGVEVMDGD
FT                   PLGWDWRLEA"
FT   gene            complement(355082..361354)
FT                   /locus_tag="Sala_0350"
FT   CDS_pept        complement(355082..361354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52073"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW99"
FT                   /protein_id="ABF52073.1"
FT                   /translation="MILASRTTAMRAIATPSPRHRGKPRLLASCAIAAGLAALAQGGPV
FT                   AAQVAGTGSFVSGTGAIGNNGATNTTSVTVTTSESVINWVPTDNAPTGGAIDILPAGEI
FT                   WNFIGTGDYTVLNRFVDASGGALGRQIALNGTVNSYIGSTTGPRGGNIWFYNAGGVLIG
FT                   ASGVINVGSLLLTANDVDTSGGLFGPGGTIRLGGASGSTSAITVNGAINANNAGNPGSS
FT                   YVALVAPRIVQAGTVRVDGSAAYIAAEAANIRINGGLFDIDVTVGAEGGTVIDHSGTTT
FT                   GPAHQQGDTDQSRIYMVAIPKNDAVTLLVGGAIGYDDAVSAQVDPDGAVRLSAGYNIVG
FT                   GELDTAPVSAVAATIVAADTLFRSDTVARASGTFAAAPTQTLPGSPPALSADGQFLVEG
FT                   NGSFTGDAGASLIIGAGQQGGATGNFTLQSGGTAGAVGNAALTVTGGTFAASDLAILAS
FT                   GTPEAVTGDAQGGNASLTIAGGSVTTSVLTIDASGVGEIGDGGTAGAGRGGNATFSQTG
FT                   GTASIGDIRVSADGGAVESQSGLGVGGNATIDFSGGSITVADVFATADGFGGEGLPGND
FT                   DDPLNIIPGGDGQQGRGGTATINISGTAVVDASVIQASAVGTGGRGGEFFNFSSFSGVP
FT                   GTPGDGAEGIGGTAAINVTGGTTTASSMIADASGIGGDGGGSFFSSSSGGATGIGVGGT
FT                   GGAGRGGSATIALETAIPAVASASSVATGTGGDGGIHNVGGAGGDGFGGVAQAIVTGFD
FT                   AGALLIAIASTGTGGDGGNGRDGDGGDGGNGSGGTSRMQAVGAGAGLTIVETNFVTGGV
FT                   GGNGGSAGLGFGSFPTAAPDGGDGGDGRGGTIEIAATDGAAVTLGTGTGGGVALASSGA
FT                   GGAGGAGANSVFGAGNQAGDGGDGGNGGGGTVRLVAVGGTIDSGGEAVDLAANGVEGEG
FT                   GSGGLGQGGGTDGGLGLMGLSAGGRVEIEARSGVAGPGQIDLGQTGIDASGDIAGRIEL
FT                   RTSGGDINFAGLAAQAFGLAAPTNNDIDTAAAGIFVAPAGGAIASQGDVTLITDGSIGV
FT                   YGQSNGSFDVDGSLTIDAGDQIDLRHDNREGTAPTLNASGDMTMTAATSVSGATGSLAA
FT                   ADGSLSLTVSDPAGTIMVDGLAGGSISLFSPGAARVEHAEAIGDFSASAGSFATGLNSI
FT                   ITGGNISIASPGAVDLGNSSAGGFVQVSGQSIAFNSIDAGLTVSLSAVDGIDGGAIAAT
FT                   GDISLFADNVALTGPVTGDASFVAFGLGGAVSVDTADVAGTISIFAADDLTGNFVAGGN
FT                   IFLNSDASIFASAIASGGYVDGNGLLAEGNLFAIAAADVSLTTSAAARMFGVSAGGAAS
FT                   VDGGTAGEDMLLLAGTIASLANIAAGDDVRVQAAGNVFANGVAATGAGADTHILDFSSA
FT                   SGSPGFAITPQAADGADIVMQSAAGAIDAAALTAGDDILLTAANEIAVGGASTLGLGVT
FT                   GGDSSLRTQGGATTLADVASFDDVVVDSAGPATLTASVNAGRDIAITADNVTIAALTDP
FT                   GGNPAPTLTADGNLVIASTAGIAGGGVRALGNASLNAAGAIDLTVVEGQNVALTGAAGI
FT                   DADQVYALGATSLASSNGAIRIGALFASGPIDASADAIRIEGGDAMDFATLVTDVGDAF
FT                   VRSSGDLSLGNGSVAGTADLDAQGTAMTIDALTAADAILANNGGVLNLGTVTVAGDLSA
FT                   TARSSIGVAGIVTGQSISFASADIAIDAAARIGTAGVTTALSLANNNNANQTFIGGAPG
FT                   GSVSGYRIDADELTRLFGAQIEVFAPEVASVGGSSVGSAAPPDVIIDSFTLAGGAPGSN
FT                   LGANGALTIRTPGKMRVIGNVELSGLTDANALNLVADDALEVILGQGRVRLVNGTAPAG
FT                   QLNMVSDDIIVATAAAIADVASAMTTDAISERLSRNDGIVLDEGALFARGIRAAVVGGF
FT                   FVQNSGAGTALAERRGFTFGAGGLDVLTEGASRIVVNGTHLGAGGRVTGLQALQLVTVN
FT                   GVAPVVGSYDPRSTVNGCLLSSPAVCIAFDRDGDGGFPVQDVIEEEIEGDGEDGQGGGY
FT                   TLRQPLITMRDIDPLSGEPLVDDPVTGAGNDDLWTPPAE"
FT   sig_peptide     complement(361232..361354)
FT                   /locus_tag="Sala_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.560 at
FT                   residue 41"
FT   gene            complement(361358..363181)
FT                   /locus_tag="Sala_0351"
FT   CDS_pept        complement(361358..363181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0351"
FT                   /product="Hemolysin activation/secretion protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52074"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW98"
FT                   /protein_id="ABF52074.1"
FT                   /translation="MAVSGDEGQDPIFGLRRGAFRAALTASTGLIAAALPAAALGQATP
FT                   QIPTREEIQRPPLAPAAPPGERIVAVDEEIERAPCPLADPQFAHIRFTLRAVEFSRVEG
FT                   IDPAMLSPSWSGRTGQELPIAAVCDIRDRAATMLRAKGYLAAVRVPAQTIDDGVVRLDI
FT                   LAARMARVEVRGDAGANEALLQRYLSRLDDAPVFNIADAERYLLLARDIPGMDARLTLR
FT                   PGGTPGEVIGEVTVVRTPVTFDFNAQNLGSRDVGRWGANARARFAGLTGMADLTTLSFY
FT                   STPDFDEQTVVQVGHELRVGGEGLRLGASYIYAWTRPDVTGLPIKSDTQILSLFASYPL
FT                   VLTQARRLTIGGGLDIIDQDIGLSGISLNEDRLRVLGLRADASWVDPGSIAGRGGYSAG
FT                   EPRWSLATSLEARQGVDFLGASDDCGPGGTACFLPGAVPLTRIEGQPDAFLIRAQALAE
FT                   WRPVKLFTLSAAPRAQWAADPLLAYEEFSGGNFTVGRGFDPGTVIGDSGVAVALEARYG
FT                   SFVPANTKAFAIQPFAFFDAAWVWNEDAAFDGLDPQKLYSAGGGVRVAYGDVARLDVTL
FT                   AVPLNRGGFLTERPDPRLLVSLTTQFGVRAR"
FT   gene            complement(363365..364129)
FT                   /locus_tag="Sala_0352"
FT   CDS_pept        complement(363365..364129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52075"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW97"
FT                   /protein_id="ABF52075.1"
FT                   /translation="MSFPDLPMRRIGLAAAAAIAAFAMIGTAAAQSMVVRSTGPSASKY
FT                   PTGAKLKASDRVTLVAGDRVVLMQSGKTRTLSGPGTFSATGNVQASQSLGSNVSRMLAK
FT                   GPTVRSRGGFSRGPNDPIPAETRAPNLWLLDYRQGGTFCVADPATLLLWRPNMEGDTAL
FT                   EIESGGKKATVAIVDGANFRKWPTDVLPVQYGVDYRLSGAGLPRPVTVRFAAMETVPDT
FT                   AEASVEMLMAKGCAPQLDRLVDTMAEAEGGQG"
FT   sig_peptide     complement(364037..364129)
FT                   /locus_tag="Sala_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.942 at
FT                   residue 31"
FT   gene            complement(364116..366215)
FT                   /locus_tag="Sala_0353"
FT   CDS_pept        complement(364116..366215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0353"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52076"
FT                   /db_xref="GOA:Q1GW96"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW96"
FT                   /protein_id="ABF52076.1"
FT                   /translation="MNAPETPVRAAEAVTPDDADGRPPTVPLAKRVRRLVTQLGPSRMV
FT                   ATILFLVLAVLIARFSWQMPLINAAERALYDARATLMAPKVQQDPRILLVTYNDETLFN
FT                   TGIRSPLDRSLLTAALANIDQMGAKAIGIDIAFDSPRPDDAALKAQLRAMQTPTWLAYA
FT                   EQASNPNTIFYEQQKFLESFIADVATARTRPTSVLFHTDDDSVIRRWPDRPAGLPPLMA
FT                   NALAPVDPAHAGYRGAIRFLVPARAGGGQVEPVFANIPIDSFALPMDAAMRAGFSELVK
FT                   DRYVLIGGDIIDNDQFNTPLSRFPDAITGQHETMIGLEVHAHMLAQQLDGAWARPLAGP
FT                   TLWVLALLVVLAGGLTSLIDMRARWVALAFLGQMAFFVAFPFWLQGRGIDTTTLPTFGW
FT                   AVGWLFGYAAVGTAARTIGSRQRAFAQSALGKYLPADVAEQIMRDPDQLSLHGERRNIF
FT                   CVFTDLEGFTKLSHAVTPETVARLLNEYLDRLSDIVLAHGGTIDKFVGDAVVAFWGAPI
FT                   SRPDDGEKAATAALAMYQAGERFRVDLAAGDIPPIGMTRVGLHVGDAIVGNFGGEGRIQ
FT                   YTALGDSMNTASRLEAANKSLKTGVLISAEAAARSGRDDLVPMGRVTLRGRAQPVDVFT
FT                   PRPDLAPDQRGRIAALVAAHGAGDNDACVTLATELAQELRQDAAIQFLIERLNQTKRGE
FT                   SYVLS"
FT   gene            complement(366220..369297)
FT                   /locus_tag="Sala_0354"
FT   CDS_pept        complement(366220..369297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52077"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW95"
FT                   /protein_id="ABF52077.1"
FT                   /translation="MTVRVPHWMPALAAVVLTVPTGALAQGGDPTLRDSFSIGSEGGAL
FT                   CEVQATVRDPVVEGMFERAWTVVCRDASQPVGTIRVLRAATDDARARIERARADRVTCT
FT                   AGRCTLRDSDAVWTTRIETNGANAYTAEGFEAYADALAIALESVRQRRVVPGVIRVATT
FT                   SVGGNDGFARTLAGAIDIDKALAEGYRRNHSGDYAEAAEFFDALSRRALEEQAAVGVDA
FT                   TEFTLNRALQRSNLGEFAEAERLFAEVEAIPTSDPVQLRLRRNFRAIHALNQRDLDGAA
FT                   ARLQAAIPPLATGVIVADGAVTLAPAIVAGVNSGGDARLVQAGERERLSPIERAQIIDA
FT                   QAVHLLGTVERLRGDAAAAKAAQIKGLADALAVREGRVTSIIRLRSQMLGELALAEEAL
FT                   GDIGAADARFGEAVALLAVEYPETTALASARARYAAFLTRQGQDDKALGIYREVVGALA
FT                   ESQRSTVGMANMMAPYYRLLAARADSDPAALQDFFVASQLQIRPGVADTQAVLARELSS
FT                   GSDEGARLFRQATTLNRDIERARIEDARLAQLPQSAEIAALRADIRTQLDNLAFQQAET
FT                   IVRLSAFPQYRVVAPGKLDLGELQAVLRDDEAYLKMLVVGDSVYAMLVESGGAMLWKSD
FT                   IGAADLERAVDAIRSTISIVENGRRVTYPFDAATARRLYGQLFGPVAARLPMVPHLIFE
FT                   PDGAMLRLPVNLLITSDTGLAAFEQRVLDPEADPFDMRDIAWLGRTSRPSTAVSALAFR
FT                   NARQAAPSKAANQYFGLGENLPLGDRLPSLGTRGAAGGMDGDCLWDASQWARPISADEL
FT                   VTARNAMGADAGALLTGGAFTDTAVKTRDDLADYRIIHFATHGLVTAPRPACPARPALV
FT                   TSFGGQESDGLLTFQEIFDLRIDADLVILSACDTAGAASVAATREAGLSGGGNALDGLV
FT                   RSFIGAGGRSVIASHWPAPDDFDATTRLISGLFTADDGASVADALWATQRRLMDDQQTS
FT                   HPYYWAGFAIIGDGAQPLLRGAQTARHGQAAGRAAR"
FT   sig_peptide     complement(369220..369297)
FT                   /locus_tag="Sala_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.977 at
FT                   residue 26"
FT   gene            369519..369845
FT                   /locus_tag="Sala_0355"
FT   CDS_pept        369519..369845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0355"
FT                   /product="protein of unknown function DUF1476"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52078"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW94"
FT                   /protein_id="ABF52078.1"
FT                   /translation="MTTFDDRERAFETKFARDQEVHFRIIARRNRLLGEWAAERMGLTP
FT                   EETDAYAKAVVQADFEEAGDEDVIRKLAGDLTAANVDISDAEIRAMLNDKAAEARRQFI
FT                   DSAN"
FT   gene            369856..370089
FT                   /locus_tag="Sala_0356"
FT   CDS_pept        369856..370089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0356"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52079"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW93"
FT                   /protein_id="ABF52079.1"
FT                   /translation="MGMREDELKAMIEAAFPGAAVTITDLAGDNDHYSAHVVSESFRGM
FT                   SRVAQHKAVYAALGGRMGGELHALQLTTAVPS"
FT   gene            370140..370472
FT                   /locus_tag="Sala_0357"
FT   CDS_pept        370140..370472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0357"
FT                   /product="Glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52080"
FT                   /db_xref="GOA:Q1GW92"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW92"
FT                   /protein_id="ABF52080.1"
FT                   /translation="MSDPATQARISKLVADHPVLLFMKGTPLFPQCGFSSRAIAMLDRL
FT                   GVEYETVDVLQDMEIRQGIKEYSDWPTIPQLYVKGEFVGGSDIMMEMWEAGELHQLMDG
FT                   IPTRAQ"
FT   gene            complement(370540..370914)
FT                   /locus_tag="Sala_0358"
FT   CDS_pept        complement(370540..370914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0358"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52081"
FT                   /db_xref="GOA:Q1GW91"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW91"
FT                   /protein_id="ABF52081.1"
FT                   /translation="MKRIFAAALLAAVALPTGTAYADPPPWAPAHGKRAKDRAIYDSHG
FT                   RYYEPRRLSRGDRIWRGRDGRYYCRRDNGTTGLIIGGAVGALVGRELDGGRDRTVGTII
FT                   GAAGGALLGRAIDRGELRCR"
FT   sig_peptide     complement(370846..370914)
FT                   /locus_tag="Sala_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            371373..371741
FT                   /locus_tag="Sala_0359"
FT   CDS_pept        371373..371741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0359"
FT                   /product="transcriptional repressor, CopY family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52082"
FT                   /db_xref="GOA:Q1GW90"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW90"
FT                   /protein_id="ABF52082.1"
FT                   /translation="MAERASESEMQVLSALWDEAPQTAADLTRRVGAANGWTQATVKTL
FT                   LARLVQKGAVTAEADGRRYLYSPAIGRAEAVGEESQRFVDRLFGGRVSPLIAHLADREA
FT                   LSDADIAEIEALLKKLKS"
FT   gene            371738..373411
FT                   /locus_tag="Sala_0360"
FT   CDS_pept        371738..373411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0360"
FT                   /product="peptidase M56, BlaR1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52083"
FT                   /db_xref="GOA:Q1GW89"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW89"
FT                   /protein_id="ABF52083.1"
FT                   /translation="MSAAMFIEAWSDTLLTTALLVVAVLLIRKPFARHFGARLTYGLWA
FT                   IPALRLVLPPLPFADPVTAPVVMPVETGTTLALTLDGGATVEAVTPAWTLADVMPWLVV
FT                   PWAAGMIAVIGAAMLAHRRFRAAVLTDAVELEPIGSIRLVMTDAVDGPVAFGLLHRVVA
FT                   VPQDFFARYAAEERALAVDHELSHHRHGDLWANAAALVLLASQWFNPFAWRAIRAFQFD
FT                   QEAACDARVLTMADDAARHDRAANYATAIVKAAVGPRLALTAPMAVHDNLQERLTMLTK
FT                   RDISKRRGLAGRLLIGGAALAVLGATATLVPSGMAAATTQPGDIPAPPAPPPAPDAPPP
FT                   PEAPDAPEVMVFTGSDEAVSETVTTSDDGKTREVRRIVIRHDHDKDGKTADASADHQKK
FT                   AQRFEFHIPGGLSREDVLATLKEQGITGARADVIADRLEAKRKERLRVALAPMPPMPAI
FT                   PPMSWSADGKAMVLGKCRDGSKAAPIVDRKHSEGGKRSHVVMFGCGDSGEIRALRLSAL
FT                   EKTREAFVEGERARGLSEEMRAKVIADIDKAIAEIKKSDE"
FT   gene            373691..374611
FT                   /locus_tag="Sala_0361"
FT   CDS_pept        373691..374611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0361"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52084"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW88"
FT                   /protein_id="ABF52084.1"
FT                   /translation="MSDEKPWPDSIRAGECEQHEPLVRRVLAPNPSPYTFTGTQTWIVG
FT                   AGRDVAVIDPGPTGSGMSVGDPPDANGRGHVEAILRAVEGQRVAAILCTHTHRDHSPAA
FT                   APLKAATGAPIIGCAPLALSDDGPRADSAFDPDYAPDRVLMDGERIAGDGWTIEAVATP
FT                   GHTSNHLCFALVETGALFTGDHVMAWSTSVVSPPDGDMAAYMASLSKLHDREDRVYYPA
FT                   HGPAVTKPRQLVRGMLGHRKQRERQILRELERGTRVIPDMVKHMYKGLDPRLTGAAGRS
FT                   VLAHLLDLEARGRVAREDECWRLVA"
FT   gene            374608..375207
FT                   /locus_tag="Sala_0362"
FT   CDS_pept        374608..375207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52085"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW87"
FT                   /protein_id="ABF52085.1"
FT                   /translation="MNRGLFRVAVVAVLALALFFGWRAWSDWQRGYDPQTVVAASLEGL
FT                   KEQNVLVPFTARYVAVVTSTQSRLGLSAKKTLIMPGTVRYELDLGRLKQSDLDWDGATN
FT                   ALTVTLPPLRLAGPEIDIDAISEFRDGEILLTLTDAEASLDAANRKAAQEELIRQARGA
FT                   TPMRLAEGAARAAIEQSFAMPLKAVGIDATVTARFE"
FT   sig_peptide     374608..374688
FT                   /locus_tag="Sala_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.992 at
FT                   residue 27"
FT   gene            complement(375224..375421)
FT                   /locus_tag="Sala_0363"
FT   CDS_pept        complement(375224..375421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52086"
FT                   /db_xref="InterPro:IPR009579"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW86"
FT                   /protein_id="ABF52086.1"
FT                   /translation="MDDDELPRRRDDVLSALVRQPLDPLSVDELDARLAALEAEIERVR
FT                   AHRRAATSQKAAAEALFRKS"
FT   gene            375523..376521
FT                   /locus_tag="Sala_0364"
FT   CDS_pept        375523..376521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0364"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52087"
FT                   /db_xref="GOA:Q1GW85"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW85"
FT                   /protein_id="ABF52087.1"
FT                   /translation="MTSLPADMTAVAIGAPGGPEMLQSVTRPVPQPGAEEVLIRVAAAG
FT                   VNRPDVLQRMGLYPPPPGASDLPGLEVAGTVVAVGPGGDPEMLGQEVCALVAGGGYAEY
FT                   CTAPVGSCLPVPKGFSMAEAAALPETVFTVWHNLFERGYVQEGETVLVHGGTSGIGTTA
FT                   IGLCKLFGIRVIVTCGSADKCDAARALGADLAVDYSNEDYVAAVKDFTGGAGVHVVLDM
FT                   VGGDYVPRNLDCLADDGRHVSIAFQRGAKVEIDVSQVMRRRLTLTGSTLRARSAAFKAL
FT                   LADEIHRTLWPRLAEGAWKPAMDQAFALTDAAAAHARMQAGAHVGKIVLTV"
FT   gene            complement(376582..377292)
FT                   /locus_tag="Sala_0365"
FT   CDS_pept        complement(376582..377292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0365"
FT                   /product="(Acyl-carrier protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52088"
FT                   /db_xref="GOA:Q1GW84"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW84"
FT                   /protein_id="ABF52088.1"
FT                   /translation="MFELNPAALRLLHIDSSARPGVSGRDPHGSHTRRLGARFVERWTA
FT                   LRPTDAVTYRDVGQHPPAPVDADWVAAAFTRPEKRDAAQKARLAESDRLIAELIAADIV
FT                   IVGAPMYNFGMPATLKAWLDNIVRVGVTFGFDRARDGDPYWPMLPAGKTLVTLSARGDY
FT                   GYDPGGRQAHNNFVESGLAAPLAYIGLHDNHMIAIEYDEFGDQRLADSIAAAEQAVDAL
FT                   VDRLILEPRTLEPA"
FT   gene            377378..378283
FT                   /locus_tag="Sala_0366"
FT   CDS_pept        377378..378283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0366"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52089"
FT                   /db_xref="GOA:Q1GW83"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW83"
FT                   /protein_id="ABF52089.1"
FT                   /translation="MTQPDSSIAQLRRLPPLAALRAFEAAARHVSFRQAAEELGVTPTA
FT                   ISHQVRLLEDSLGFALFVRRARGVVLTDAGRRLFPTLRDGFDAFERAIWELSPRPRRVA
FT                   VTLSATTLFTVRRILPAIGRFRERFPDYDLRLHASDDPVDLIAGEADVAVRYGSGAFRG
FT                   LVATPLLAERFGVLCSPKMAIARPNDLRGATLLHIEWRRAGKAPDWRRWARLAGIEGLA
FT                   VDRGPRFTEDDHALQAAAAGSGVVLSGLALAQPTIDAGLLVHPFGPVIEGEAYHVVTTP
FT                   DNRDAPAVCAVCDWLREDVV"
FT   gene            378392..379054
FT                   /locus_tag="Sala_0367"
FT   CDS_pept        378392..379054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0367"
FT                   /product="protein of unknown function DUF1013"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52090"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW82"
FT                   /protein_id="ABF52090.1"
FT                   /translation="MANANPTPLMPHATAAWLVDNTGLTFGQIAEFCGIHILEVQAIAD
FT                   ETAATKYTGRDPVRAHELSMEEIEKGQKDPNYKLKMTVQAQDVIRRTRGPRYTPVSKRQ
FT                   DKPDGIAWILKNHPEVSDGAISKLIGTTRNTIGAIRDRSHWNSANIVPKDPVTLGLCSQ
FT                   RELDALVAKAAKKAGIKAPEDSRLEGDREALLEELRAERTAANEARAAEEAQADGED"
FT   gene            379182..380306
FT                   /locus_tag="Sala_0368"
FT   CDS_pept        379182..380306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0368"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52091"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW81"
FT                   /protein_id="ABF52091.1"
FT                   /translation="MTIGDEENIPAASGSPDASLTQDDSFTATSHAGLTYPWGEAAPGA
FT                   GETIRIAGGISWARIPMPGSLGHINSWLLDDDDGVAVVDTGVCLTMCSDAWKALYAGAL
FT                   KDRRITRVIGTHLHPDHIGLAGWIAKKQGVKLWMTRGEMLTARAIVADSSDSAPEEALA
FT                   QSRAAGWDAEAIEAQRGRGWNMFQRMIFTLPRSYVRIADGDVLDMGAHRWRVVVGSGHS
FT                   PEHACLWNEAEGVLISGDQVLPRISSNVSVNITEPDADPLGEWLASIDKLLRTVPADVI
FT                   VCPAHGEPFRGLHVRMTALRDEHRMRLYNLAEAVARAPMRAVDAFPLLFNRPIGEHNRG
FT                   LATGEALAHLKRLEVEGRVRREDRDGVWWYHGVA"
FT   gene            complement(380313..381038)
FT                   /locus_tag="Sala_0369"
FT   CDS_pept        complement(380313..381038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52092"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW80"
FT                   /protein_id="ABF52092.1"
FT                   /translation="MTTAIDTDIAARLAATDWDAAATALDGAGWAVLPGLLGDAECDAL
FT                   AAAYDMPPLFRSHIQMARHGFGRGEYRYFAYPLPPLVAALRSRLYPRLAPLANRWHERM
FT                   GLPARFPSDHADFLARCDAAGQRRPTPLLLQYGPGDYNCLHQDLYGEHVFPVQAAVLLS
FT                   APGEAFTGGEFILTEQRPRMQSRAAVVPLAKGDAVIFAVNVRPVRGSRGDYRVAMRHGV
FT                   SEIRSGRRHTLGVIFHDAA"
FT   gene            381679..382677
FT                   /locus_tag="Sala_0370"
FT   CDS_pept        381679..382677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0370"
FT                   /product="protein of unknown function DUF481"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52093"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW79"
FT                   /protein_id="ABF52093.1"
FT                   /translation="MIAAAIDSGEKRDIDTVVSLAKATNPRSIGDIEAMLAAAKAIREG
FT                   GEQPDPVRQMLAAAMASQKDGDVEAVGKLAKATLPDQAAKIEALLAQYRADRAREKAAE
FT                   AAVARAKLAQAKLWQNWKGEGQIGASISTGNTKSSGLSVGVALARKGLDWDQRFRAQAD
FT                   YQRTNGRTSVERYLVEYEPQIEVSERAFAYGLGRWERDRILGFGERWNASAGLGYKLIA
FT                   DKKMALSVKAGPAWRDTDYIPGRGIDDSEVTGLAGLDFGWQLSPTLRLTQVASTIVGGR
FT                   NTSTSALTALNAKLTGALSARFSYSAEIDTDPPPGVETVDTMTRFTLVYGF"
FT   gene            complement(382830..383288)
FT                   /locus_tag="Sala_0371"
FT   CDS_pept        complement(382830..383288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0371"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52094"
FT                   /db_xref="GOA:Q1GW78"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW78"
FT                   /protein_id="ABF52094.1"
FT                   /translation="MSGDLNGVAHVILTAGDFARSTAFWRDLIGYLGLKIVLDSDAMFY
FT                   GVGGRTAIGIRTPSPENVGKRFDQGAPGLHHACFRMRDRAAVDRLYAFLKDRDDIRFVH
FT                   GPQEEPWAPGYYSLLFEDPDGIRIEFNHVPGAGLLAEGEAIGGAEAFD"
FT   gene            complement(383285..384829)
FT                   /locus_tag="Sala_0372"
FT   CDS_pept        complement(383285..384829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0372"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52095"
FT                   /db_xref="GOA:Q1GW77"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW77"
FT                   /protein_id="ABF52095.1"
FT                   /translation="MDMKEQSLRTLLERRGVLRGAAMLGAGATMMHPLPVLAASSQSAA
FT                   IRKAAEAGKAASIQRIRDWIALPSIAAENLNMAEGAAFMAELARDAGFTNVEIVPTDGH
FT                   PGVFGTIDVGAPRTLGIYFMYDVKQFDPAEWSSPPLEGRMVERPGFGRAIMGRGAVNQK
FT                   GPEAAFLAALHAIRAARAKLPVNIVLVCEGEEEIGSPHFRQIATKPNILAALRKCEGIF
FT                   IPFASQGKTGNVTVNLGSKGIIELELIASGEKWGRGPKKDVHSSLKAMVDSPAWRLVQA
FT                   LQTLVTKDGNTPAIEGWFENVRPLTEREKELIRAAARAGDEAAQKQALGITHWIDNLAY
FT                   DDALIRLAQEPTVNIEGLVAGYTGPGGKTILPGRAVAKLDLRLVPNQTRAEAEKKLRAH
FT                   LDKHGFTDVEMNVSGGYDPTEVAEDSRLVRSELATYKRLGVATSLNPRMAGSWPGATFT
FT                   APPVSIPAAHFGIGHGSGAHAPDEYYLIDSTNPRVAGLVDATMGFAEFLYTLAAIR"
FT   sig_peptide     complement(384713..384829)
FT                   /locus_tag="Sala_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.995 at
FT                   residue 39"
FT   gene            385276..386121
FT                   /locus_tag="Sala_0373"
FT   CDS_pept        385276..386121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0373"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52096"
FT                   /db_xref="GOA:Q1GW76"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW76"
FT                   /protein_id="ABF52096.1"
FT                   /translation="MDFQGKSVVITGGATGIGFALAKRIGTAGARIILFEPREERLAAA
FT                   VEALAPFGVNACAFAGDVTDAAAVEALADFAWATHGRADAIIANAGVGGVRTEILDTDD
FT                   AAARALIEVNFWGVWNCVRTFGRRFQGDGLPSAIYATASENGLFNAVRRNGGIYVASKH
FT                   AVIGLMDTLRNEAPDTIEVGVIIPGWVKSDMTRHADAAMDADVFANRIVPQMEAGQFYL
FT                   VSHPYNVVRMEERWAEAYAAFAKYAPREPGDDAMDVALFMERMRAEREGLTPPPATPHP
FT                   "
FT   gene            complement(386090..387613)
FT                   /locus_tag="Sala_0374"
FT   CDS_pept        complement(386090..387613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0374"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52097"
FT                   /db_xref="GOA:Q1GW75"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW75"
FT                   /protein_id="ABF52097.1"
FT                   /translation="MNTVIIREDDLIETIADALQYISYFHPMDYIRALAAAYEREVSPA
FT                   AKDAMAQILSNSRMCAEGHRPICQDTGIVTVFIKWGMDCRLDSPRSLQQVVDEGVRRAY
FT                   LHPENKLRASILADPAFSRVNTKDNTPSVLNVEMVPGNKVVIDVAAKGGGSENKSKFKM
FT                   MNPSDSIVDWVLEMVPQMGAGWCPPGMLGIGIGGTAEKAMLLAKQSLMDPIDMTELLAR
FT                   GPSNPTEELRIELYEKVNALGIGAQGLGGLSTVLDVKIADWPTHAASKPVAMIPNCAAT
FT                   RHAHITLDGSGPAYLEPPKLADYPQIDWKPDTTAKRVDLDHLTPEIVASWKQGDRLLLS
FT                   GKMLTGRDAAHKRIADMLAKGEQLPVEFRGRVIYYVGPVDPVGEEIVGPAGPTTATRMD
FT                   KFMDMMLGQGLLACVGKAERGPAATQSIAKHKSAYLMAVGGAAYLVARAIKGSKVVGFA
FT                   DLGMEAIYEFEVQDFPVTVAVDSEGQNVHVNAPKLWQKRIKDEGLLAGV"
FT   gene            387785..388240
FT                   /locus_tag="Sala_0375"
FT   CDS_pept        387785..388240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52098"
FT                   /db_xref="GOA:Q1GW74"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW74"
FT                   /protein_id="ABF52098.1"
FT                   /translation="MTEVASPAPVLMRPAAFLSRGRALVRAARGSRPLTSLSGDQLAMG
FT                   LSGLCLVHCLATTIFFASIASVGGVFLDNHLFHEIGLIVAIGFALITLVAGVLSHGYMM
FT                   PFAVGSFGLGMMAGALARPHDGSEVIATMIGVAVVALGHDLNRRARG"
FT   gene            388342..388806
FT                   /locus_tag="Sala_0376"
FT   CDS_pept        388342..388806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0376"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52099"
FT                   /db_xref="GOA:Q1GW73"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW73"
FT                   /protein_id="ABF52099.1"
FT                   /translation="MGKHDHPHVEASGASLARAAQAALEGAGEAWTDMRAEIFDAVAAI
FT                   GKPASAYEIADIVSQKRGKRVAPNSVYRILDLFVANNLVRRVESANAFVANSHPGCLHD
FT                   CIFLICDTCGTAVHVDDDTLSTGVRAAAEKTGFAAERPVIEVRGKCAECQ"
FT   gene            388838..389599
FT                   /locus_tag="Sala_0377"
FT   CDS_pept        388838..389599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52100"
FT                   /db_xref="GOA:Q1GW72"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW72"
FT                   /protein_id="ABF52100.1"
FT                   /translation="MPLGGVQQWIEAERARPPAPTRAWYWTLALGIAVLVFGAWLTQIF
FT                   PQQGHAIAPGYGAPVLALEFAGGQDDLEAIFGVESDPQQVARLAAMRTGNERDYLYMLL
FT                   YAGFLACGCFALWRELRARALLAATMLPAAAALCDAYENWLLFDIQAAFTAGDYSPAMA
FT                   SLPYPVAAKFLLLALTNVVIGAAATQFGRWWALFGTLAILAAIPTVMAIITPAAFAWML
FT                   IPSAAGGWLLLLALAAAGSWRAIARGQPLAG"
FT   gene            389645..390484
FT                   /locus_tag="Sala_0378"
FT   CDS_pept        389645..390484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0378"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52101"
FT                   /db_xref="GOA:Q1GW71"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW71"
FT                   /protein_id="ABF52101.1"
FT                   /translation="MYDYVTITADDATAPARVRDGTIKLHDEAGFAGMRKAGRLSAEIL
FT                   DALVPFVQPGVTTAAIDDLVRTMMLEGGGIPATLGYRGFTHSCCTSINHVVCHGIPDDK
FT                   PLREGDIVNVDVTSIVDGWHGDTSRMYLVGEVPIKARRLVEVTYECLMLGIEQAKPGNR
FT                   MGDVAHAIQTHAERHRYSVVRDFCGHGLGQMFHDAPEVVHAGRPGTGPELRPGMFFTIE
FT                   PMINTGKYAVKMLADGWTAVTRDRSLSAQFEHSIGITETGCEIFTASPKGLNAPPWG"
FT   gene            390686..392869
FT                   /locus_tag="Sala_0379"
FT   CDS_pept        390686..392869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0379"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52102"
FT                   /db_xref="GOA:Q1GW70"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW70"
FT                   /protein_id="ABF52102.1"
FT                   /translation="MAKRVFSAALLGGAALALAACNASKNEAIAAGSLDDAERASEALL
FT                   KTGGNGDDWGAIGFSYDEQRFSPLTDINDRNVGDLGIAWFADLEDARGQEATPVVVDGV
FT                   MYVSHAWSKVSAWDAATGKPLWKYDPKVPGERAVHACCDVVNRGVAVWGDKVFVGALDG
FT                   RLIALDRTSGKELWATQTFDADRPYTITGAPRVVKDMVLIGNGGAEFGVRGYVTAYDAD
FT                   TGRQRWRFYTAPNPKKAKDGAASDAIFASKGNATWSDTGEWQTSGGGGTVWDAIVYDKD
FT                   LDQIYLGVGNGNPWNHGTRSNGEGDNWFLSSIVALDATTGAYKWHYQETPAETWDYTAT
FT                   QPIILAEQAVNGTPTKVLYHAPKNGFFFTIDRATGKLLDAKPFVDGINWASGYDLATGR
FT                   PIENPEARFYRTGKPFIAIPGALGAHNWHPMSYNPATGLVYIPAQQIPQAYVADMNELD
FT                   RRKVVGFNVGTSLTGTMLPDDKAAYRAAVAATTGRLVAFDPRTGKVAWGVDHPAAWNGG
FT                   TMTTAGNLVFQGTSTGRFRAYAADTGKQLLDLDMQSGIVGAPSTFRVNGVQYVAFQTSK
FT                   GGAFPLVAGVAGGATRKVPNIPRLVVLKLGGRAQLPALPRATTLAWNPPPQFGTAAQVA
FT                   TGKALFGRYCIVCHGDSAIGNGFTPDLRVSGTLANPEAWKAVLLDGALKDRGMVGFAKV
FT                   LTPADAAAIRAYVIDRSIWTRENLPNASAPVGR"
FT   sig_peptide     390686..390763
FT                   /locus_tag="Sala_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.443 at
FT                   residue 26"
FT   gene            complement(393186..393380)
FT                   /locus_tag="Sala_0380"
FT   CDS_pept        complement(393186..393380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52103"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW69"
FT                   /protein_id="ABF52103.1"
FT                   /translation="MPIREQGIDVYGFGEQKTPESFRQACRRFIYTENLLPEAPTSDEP
FT                   SRQDARPATHEECSYDTPS"
FT   gene            393767..394336
FT                   /locus_tag="Sala_0381"
FT   CDS_pept        393767..394336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0381"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52104"
FT                   /db_xref="GOA:Q1GW68"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW68"
FT                   /protein_id="ABF52104.1"
FT                   /translation="MPNQRWSLDFVHDQMASGRRFRVLNVVDDVTRECLAAVPDTSISG
FT                   RRVVRELTALIERRGKPGMIVSDNGTELTSNAVLAWCGEIGVEWHYIAPGRPMQNGYVE
FT                   SFNGRMRDELLNETLFLSMAHARVEIAAWVDDYNRERPHSSLGYATPAAFAAELDKQWP
FT                   ASLRPTGSATQPIASTALMRKTTARL"
FT   gene            394545..395678
FT                   /locus_tag="Sala_0382"
FT   CDS_pept        394545..395678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0382"
FT                   /product="DegP2 peptidase. Serine peptidase. MEROPS family
FT                   S01B"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52105"
FT                   /db_xref="GOA:Q1GW67"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW67"
FT                   /protein_id="ABF52105.1"
FT                   /translation="MDRSPNLKVSKSKTYFELLIIMNVLLLAASAALLINQSAPVAEPR
FT                   VVTARGDLGADERATIDLFRNARESVVFISTRQRVADFWTRNVYSVPRGSGSGLVWDEA
FT                   GHIVTNFHVIEGASEAQIQLADGRQFSATLVGVSPQHDLAVLKIGGAGFTAPARVPIGT
FT                   SIDLQVGQNVFAIGNPFGLDWTLTKGIVSALDRSLPNENGPDIRHLIQTDAAINPGNSG
FT                   GPLLDSAGRLIGINTAIYSPSGASAGIGFAVPVDTVMRVVPQLISEGRYTRPSLGFESD
FT                   DDINDRLKRASGIEGVFVLRVDPGSSADRAGLVAAQRTRRGVAPGDIVTALNGKPVSRV
FT                   GDLLARLDDFRVGQSVELTLMRGGEERMVRLELEPGS"
FT   sig_peptide     394545..394673
FT                   /locus_tag="Sala_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.612 at
FT                   residue 43"
FT   gene            complement(395730..396230)
FT                   /locus_tag="Sala_0383"
FT   CDS_pept        complement(395730..396230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0383"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52106"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW66"
FT                   /protein_id="ABF52106.1"
FT                   /translation="MAIRDLIPWKSQGQDIAPRQEERVDHPVMSLHRDINRLFDDMFRG
FT                   FSMPSLPSIGRSLGLPRVELSENDKEIRVTAELPGMEEKDIEISLDNHQLVIRGEKKSE
FT                   TSDEERGYSERSYGRFERRIGLPSQIDEDKVEAAFRNGVLTVTVPRTAEAAHGRKTIPI
FT                   NAG"
FT   gene            complement(396334..396843)
FT                   /locus_tag="Sala_0384"
FT   CDS_pept        complement(396334..396843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0384"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52107"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW65"
FT                   /protein_id="ABF52107.1"
FT                   /translation="MPRLLNKEDLEMRTAFDLTPYRRSTVGFDRLFDALENSFRAETQD
FT                   GYPPFDIVRTGEDSYRITLAVAGFRPDEIDITSHQNQLVISGQKIEKDEDGVEFVHRGI
FT                   AARAFERRFQLADYVEVRDADYEHGMLTISLQRIVPESLKRRKIAIGSREHVNDDTPQL
FT                   PEDKAG"
FT   gene            397236..398333
FT                   /locus_tag="Sala_0385"
FT   CDS_pept        397236..398333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52108"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW64"
FT                   /protein_id="ABF52108.1"
FT                   /translation="MAIFISLSVTDKTTSKQDAATVRTALLEEAVGALQPIFGARGASA
FT                   TRIQAVLGRSPDKDATFSLSVHLHLPGQRIVAVHSKGDDLRSLARDVIDKLTSATRRHL
FT                   ERLAHGSEFARKRRRERLYEITTGADQRPERERSLVEARLAEIRPKLETAARRELAYLR
FT                   AVSKLPTGYPEAADIVDEAIMRVIASDHGVVDAGELKIAALRELFAVIDAEIAAQQISM
FT                   SAIPLDSEVPQDAEDEAEAMVEEEFYEFYQPDDHVTLADVLPVELSQTKVALDEMHVAG
FT                   VVAALRDLPNLWRRVFVLRQQDLFAPKQVSEVVDRALDEIEDIFEKVSAFLDARLAEWG
FT                   ADSWEEIFRSKGCRCCRQAPMRTGV"
FT   gene            398363..399766
FT                   /locus_tag="Sala_0386"
FT   CDS_pept        398363..399766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0386"
FT                   /product="cardiolipin synthetase 2"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52109"
FT                   /db_xref="GOA:Q1GW63"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW63"
FT                   /protein_id="ABF52109.1"
FT                   /translation="MIFSIAVIAAIATASHAIIHKRDPRSATIWLLVVALVPLGGSLCY
FT                   LLFGINRVNRKAMRLRAARPAKSELSNLGSAGMDLPPHLASLARLGRDVSGKELLPGNR
FT                   CTPLFGGTEAYPQMLQAICEAKHSIALASYIFEGKGIGALFVDTLAQARSRGVSVKVLI
FT                   DDAYARLSNSDAYGALRLHGIDVALFNPPVIPARLHGLHLRNHRKLLIVDGYRGFTGGM
FT                   NIHRPYWCPKAPESAFRDLHLEVSGPVVGQMRETFERDWYDSKEEELDESFWTGKSGGP
FT                   ITDGFSLARGIESGPDETLDRMRWIFIGAINAAQKKISIRTPYFLPDQPTIAALGAAAL
FT                   RGVRVEIVVPRNSDHLFVQWASKAHYWQIIEHGVCIYERPGPFDHGKLMIIDDAWVCVG
FT                   SANWDARSLRLNFEFNLEIYDRRLALELGDDFARIRSASKKVRPTDLSDMPYFVKLRNG
FT                   FARLFSPIL"
FT   gene            399785..401482
FT                   /locus_tag="Sala_0387"
FT   CDS_pept        399785..401482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0387"
FT                   /product="sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52110"
FT                   /db_xref="GOA:Q1GW62"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW62"
FT                   /protein_id="ABF52110.1"
FT                   /translation="MEELFFSVFILFASILVAGLLFHLMKAPTILGYIAVGILLGSSVT
FT                   GLFPDGPALDFMAEAGIILLLFMVGLEFSLTEFWSDKGKILKAGALQGFLVGLPVGSLV
FT                   WCLGWGIAPAILLGASVAMSSTALSAKQLADHGELTTRHGRVAISVLVFQDLAAIPLLA
FT                   MLAIWQSGGQPGPVEISLEILKVLAIFAVALVLARPVLRSLLMAIYRRGNSELLVLAAL
FT                   AIIAMAAQSAHLAGASAALGAFLAGLILGESDVRHRIEEDLRPFRDVFASIFFVSIGLQ
FT                   LDLSQLGSSPLAVLAWLLVLLPAKALLNFIALKISGSSARDALQTAVILAHGGEFGLLL
FT                   LSGALTASLISTEMGQPLLLALVVSMGLGPILFRSSETIARNLCGGKSGMTNLPQREEV
FT                   EVAREVRACINHIVFCGADNLARSAARAVRLAELDFVMIEPDLRLYLTAREEGLPVILG
FT                   DPGRTATLEAARANVAAAIVITKPFSQRQNRIVDWFLEGNAHGKIVLLGTSQDRDETMH
FT                   TDQRILQLDPELYLGMDLARLVLSAVDLPKNEIEKISCTLTSDAADHA"
FT   gene            complement(401535..402176)
FT                   /locus_tag="Sala_0388"
FT   CDS_pept        complement(401535..402176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52111"
FT                   /db_xref="GOA:Q1GW61"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW61"
FT                   /protein_id="ABF52111.1"
FT                   /translation="MSDREDDQTVDTVEIREVVGIVYNHNALEEMATQLVAAGVDRNDI
FT                   SLMADWNTVIEKLGLTYPDPGAVVDNPETPRRRLTTRDEHATVTGTVFGTLIATGALAA
FT                   GVPIIASGGAIPLALAACTAGGGIGAMLAKLVRKNLLTRDDADAIEHDINRGGIAVFVR
FT                   VDNADEEQRAIDIMRRNGAHNVHAHTITLRKELSDLPLANVQPDPWLADD"
FT   gene            complement(402315..402815)
FT                   /locus_tag="Sala_0389"
FT   CDS_pept        complement(402315..402815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0389"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52112"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW60"
FT                   /protein_id="ABF52112.1"
FT                   /translation="MMKIKDLVPWTRSENPRQPVSNAEQEEAHHSLKRDINALVDKFVE
FT                   KIGNLDLPWQDNEAKSDVVQAGDAVEISIELPGMDLADIDLSISGDMLVVKGEKKVERQ
FT                   EEKQGYFLSERAYGQICRAIPLPPGLDTDAAKADLKNGVLTISIPQSAEARSSMKKISV
FT                   NKA"
FT   gene            complement(402828..403220)
FT                   /locus_tag="Sala_0390"
FT   CDS_pept        complement(402828..403220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0390"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52113"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW59"
FT                   /protein_id="ABF52113.1"
FT                   /translation="MSNDMETTTNEKLAQQAEQAQPVQMPLTDIVETSDGAILLIELPG
FT                   CSSDDLDIELANGVLTVAARPSVSMPQEEELQHIEFVSTAYERSFQVSKDFDPDKTDAS
FT                   MRDGVLTLRLHRSEKLAPRKISVKAG"
FT   gene            complement(403230..403655)
FT                   /locus_tag="Sala_0391"
FT   CDS_pept        complement(403230..403655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0391"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52114"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW58"
FT                   /protein_id="ABF52114.1"
FT                   /translation="MMVYPARIYRADPFEILRKGLSGLPTARVSSAAAFPKLNIWRTGQ
FT                   GAAIVAEMPGINPQKVDITVKENLLSISGERAQPDCGNDARWMRRERSYGQFTRAVTLP
FT                   FRIDPENVEARYSNGILFIAAGLSDADKPRKIAIKAG"
FT   gene            404253..404468
FT                   /locus_tag="Sala_0393"
FT   CDS_pept        404253..404468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0393"
FT                   /product="transposase (class IV)"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52115"
FT                   /db_xref="GOA:Q1GW57"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW57"
FT                   /protein_id="ABF52115.1"
FT                   /translation="MIHAADIQDRDGAPLVLAEIIKRFPWLRHVFADGGYAGDKFKQAL
FT                   RRFGKWTIEIIKRSDAVKGFEVLPRR"
FT   gene            404489..405199
FT                   /locus_tag="Sala_0394"
FT   CDS_pept        404489..405199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0394"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52116"
FT                   /db_xref="GOA:Q1GW56"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW56"
FT                   /protein_id="ABF52116.1"
FT                   /translation="MAEQEPTPRQGLRADHRPCNRMALHRLDPDLYPPQRKIMKSQPII
FT                   SNQTLSGWALRYRLTTCGERQIVEVLLPGSIIGLQSLLLGLQNEGVSSLTRVSLCVLGS
FT                   VAVGELFAHQPSLARGLVNSLLQDQNRADRQMTLDAKTSSASSLGHFLLEIFDRAGPLG
FT                   GQNQRWCHFPLQRGDLSGNLGISPTHVSRSTSELSKLGLATIPGNTLKIIDRQALVRFS
FT                   GYQRKHAEVERLLL"
FT   gene            405475..405960
FT                   /locus_tag="Sala_0395"
FT   CDS_pept        405475..405960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0395"
FT                   /product="Ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52117"
FT                   /db_xref="GOA:Q1GW55"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW55"
FT                   /protein_id="ABF52117.1"
FT                   /translation="MSMRYVMDSNLDDPKRIVVVDGLKKFLADTYTLYLTTHNFHWNVT
FT                   GPHFNSLHQMFMVQYNELWLAVDLIAERLLTLGSFAPGSYKQFAQLTSLPDVPDSPPEA
FT                   MEMVSLLMKGNQLAARTARCVVPDAEEIGDQATSDLLVSRIAVHEKVAWMLRATLAG"
FT   gene            406261..407373
FT                   /locus_tag="Sala_0396"
FT   CDS_pept        406261..407373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0396"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52118"
FT                   /db_xref="GOA:Q1GW54"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW54"
FT                   /protein_id="ABF52118.1"
FT                   /translation="MPQAGLFGLSEHLKRLSAHGDPLEVLARVVDFEAFRPVLDVSLAY
FT                   SDGAKGGWPPYDPVTMLKVLVLAAQNNVADGRMEYLIRDRLSWLRFLGFDLGAPTPDAN
FT                   TMRLCRERLTQAGALDMLFADFDPWIALGLRELGVAIACIDARQAHQSLKAMKANKTDL
FT                   HDAAALAQLARTGFYKDMHVKSPAAHGVRSVITARGHLVEARVRLDNTIRGLCATFGIR
FT                   LGAGQGERFLARMRVAASVPGLCEAVASLLRARERLVEEIGQMDRQLKAISLASLASQA
FT                   LMSIPGVGVQTSAAFAAAVDDASRFKRSRTASAYFGLVPRRHQSGELDWTGRITKQGDG
FT                   TVRKLLYEAANSILTRTRGTPPMTAALPGS"
FT   gene            407422..407781
FT                   /locus_tag="Sala_0397"
FT   CDS_pept        407422..407781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0397"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52119"
FT                   /db_xref="GOA:Q1GW53"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW53"
FT                   /protein_id="ABF52119.1"
FT                   /translation="MGGITVFGGPERRRRWSDEERRQILEDAFAPGACVAQVARHHDVS
FT                   TALIYTWRRKLCAVAAELPCEEGFVEAIVIEDQDTEASTTQPAIVVDLPRGGRVSVFSS
FT                   APPAVAAAIMKVLIR"
FT   gene            407787..408224
FT                   /locus_tag="Sala_0398"
FT   CDS_pept        407787..408224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0398"
FT                   /product="IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52120"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW52"
FT                   /protein_id="ABF52120.1"
FT                   /translation="MPTGGKVWLALGHTDMRRGMRSLALQVQQSLKKDVHAGDLYVFRG
FT                   KNGSLCKILWHDGIGMSLYAKRLEKGRFVWPAAKDGTVAISASAMASLLEGIDWRNPQG
FT                   NLATNPGRLIAWAAAKSRKSWGLCRSCAMKRHGYRRGIQRA"
FT   gene            408303..409688
FT                   /locus_tag="Sala_0399"
FT   CDS_pept        408303..409688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0399"
FT                   /product="transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52121"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW51"
FT                   /protein_id="ABF52121.1"
FT                   /translation="MAKVRAINADLLARNAYLELMNEKMRRDKFGASSERSRRLRDQLE
FT                   LTFEELEANASEAELLGQIAAAKTTAVTAFTRKRTTRRDLPADLPREKVVIPAPQACPC
FT                   CGSHDLGHLPADITETLERVPARHKVIQTVREKVSCRQCEKISQPPAPFHVTPRGMFGP
FT                   HFLANLAFQKYGLHQPLNSQRDRLEREGIPLSLSTLADQIGAICVAVKPLFLLLEAHAL
FT                   SADRLHADDTTVPLLAKLKTEVARIWDYVRDDRPFGGPAPPVALCYYSRNRKGEHPRAH
FT                   LAGYSGILQVDKFAGFNDLFREGRGEKPMTRANCWAHSRREFFKLVDIRQQMKRRNAVA
FT                   PLISPLASEALERIDRLFAIERDINGKRAAERLAVRQEQSAPIVVDLESWMRETRASLS
FT                   RHDAVTKAINYFLNDWEGFTTFLADGRICLTNNSAERELRAVARGRKAWLFVGSDRAVS
FT                   ARR"
FT   gene            409685..409858
FT                   /locus_tag="Sala_0400"
FT   CDS_pept        409685..409858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0400"
FT                   /product="transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52122"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW50"
FT                   /protein_id="ABF52122.1"
FT                   /translation="MMFSLFGTARLNGVDPLAWFTDVLTRIADIPQSRLHELLPWSWKA
FT                   AQQPKDHAELAA"
FT   gene            complement(410461..410997)
FT                   /locus_tag="Sala_0401"
FT   CDS_pept        complement(410461..410997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0401"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52123"
FT                   /db_xref="GOA:Q1GW49"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW49"
FT                   /protein_id="ABF52123.1"
FT                   /translation="MSDNAKNGENEDGSPSAVGKSVESEVLPEPEEGDALQDRLLRALA
FT                   EAENARKRAEKAGTEGRQAGMAQLLSELAPALDNLDLALEALAGSHEIEPSLIKGLEAT
FT                   RRAINDALLKAGVKILRPSIGEDPDPNVHEIIGTVPSTGSNAGQIVSVAQSGYMIGPRL
FT                   VRAARVIVSREVDAS"
FT   gene            complement(411015..412946)
FT                   /locus_tag="Sala_0402"
FT   CDS_pept        complement(411015..412946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0402"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52124"
FT                   /db_xref="GOA:Q1GW48"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW48"
FT                   /protein_id="ABF52124.1"
FT                   /translation="MAKVIGIDLGTTNSCVAVMEGGKPKVIENSEGARTTPSIVAFTKD
FT                   GERLIGQPAKRQAVTNPDNTLFAIKRLIGRRFDDPTTKKDMELVPYKIVEGPNGDAWVE
FT                   AAGEKYSPSQVSAFILQKMKETAEEYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVERIINEPTAAALAYGLDKDEGKTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDSAVVEYLADSFKKKENMDLRTDKLALQRLKEAAEKAKIELSSAAQTEINLPFI
FT                   TARMEGGTTTPLHLVQTVTRSELEKLVDGLIKRTLEPCKKAMADAGIDKGAIDEVILVG
FT                   GMTRMPKVREVVEDFFGKKPHTGVNPDEVVAMGAAIQAGVLQGDVEDVLLLDVTPLSLG
FT                   IETLGGVFTRMIDRNTTIPTKKTQTYSTADDNQQAVTIRVFQGEREMAADNKLLGQFDL
FT                   VGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEQQIRIQASGGLSEADIDQMVRD
FT                   AEKFAEEDKKRREAAEARNQADSLVHATEKQLEEHGDKIDADTKAAVEAAIAETKTALE
FT                   GDDHDAINAKAQALTDAAMKMGQQIYEKEQASAAGSADAGRAAGSEASDDEEVVDAEFS
FT                   EVDDDKKD"
FT   gene            complement(413007..413822)
FT                   /locus_tag="Sala_0403"
FT   CDS_pept        complement(413007..413822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0403"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52125"
FT                   /db_xref="GOA:Q1GW47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW47"
FT                   /protein_id="ABF52125.1"
FT                   /translation="MDLPEKRLSGTFWHRRPVMKRQFQSSFRDMMPAGTSSVTPLPSTE
FT                   DLTSMLAVLAAGLETLEFADEQEAIKLRRKMRLALLNSARLVSNWSVPAAHSPLQELVD
FT                   VPELIEHLMDQIQSGIPVEAEFEKTLETGLWPVRVAPASFASALSALLENAFLAAGGNG
FT                   GKVSLRLRNRPAIDALPERIEIEVADNGPGLRRDAIALAFEPFYSNWGADQRLGLGLTH
FT                   AQRFAQKSGGSISLVPRSPSGVRAVLWLPRAYDHSASRSSQIADVILLR"
FT   gene            complement(413875..414807)
FT                   /locus_tag="Sala_0404"
FT   CDS_pept        complement(413875..414807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0404"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52126"
FT                   /db_xref="GOA:Q1GW46"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW46"
FT                   /protein_id="ABF52126.1"
FT                   /translation="MADPYTILGVSRTADQSAIKKAYRKLAKELHPDRNKDKPDAAARF
FT                   AEVTQAYDLLSDAEQRARYDRGEIDEHGNPRAPYGFEDFQGHGPFSGGGPFRSAQDGAT
FT                   SFHFSGDSEELGDIFADLFGRGRGAGGREYRPRGSDVLYAVNVPFENIATAKPFAINLD
FT                   GGEQLEVKIPPGTQSGDRLRVAGKGRPGPGGRGDAILELTVTLHPFFRQDGDDIRLDLP
FT                   IRWDEAVLGAKVRVPTIDGPIMLTVPKGSTSGRVLRIKGKGMARRQGGRGNQLVRLMVD
FT                   LPQNDKSLEAWAKEWREKNEYNPRSKLGV"
FT   gene            complement(414851..415291)
FT                   /locus_tag="Sala_0405"
FT   CDS_pept        complement(414851..415291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0405"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52127"
FT                   /db_xref="GOA:Q1GW45"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW45"
FT                   /protein_id="ABF52127.1"
FT                   /translation="MEADKIKVVCPHCDAVNAIPPDRPAQAAKCGKCHKALFNGSPVDL
FT                   LGQRFDRHITRSDIPVVVDFWATWCGPCRAMAPSFAQVTIAIEPRARFAKVDIDKAPEL
FT                   AARYGVQGVPALLIFKNGRLVDQRSGALPPSALRQWVEAHIG"
FT   gene            complement(415330..417918)
FT                   /locus_tag="Sala_0406"
FT   CDS_pept        complement(415330..417918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0406"
FT                   /product="ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52128"
FT                   /db_xref="GOA:Q1GW44"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW44"
FT                   /protein_id="ABF52128.1"
FT                   /translation="MNLEKFTDRAKGFLQSAQTVAVRMSHQRITPVHILKALLEDEEGM
FT                   AAQLIQRAGGSPPAAIGEVEKALHKFPAVSGSGAQTPPALDNDSARLLDQAEQLAKKAG
FT                   DSFVPVQRILQAMALSDSTDAGKALQAAGVNAKSLEAVIQEVTGGRTADSASAEESYDA
FT                   LKKYARDLTQAARDGKLDPVIGRDEEIRRTIQILARRTKNNPVLIGDPGVGKTAIAEGL
FT                   ALRIANGDVPDSLKGRTLMALDMGALIAGAKYRGEFEERLKAVIDEVKNSDGQIILFID
FT                   EMHTLIGAGASEGSMDASNLLKPALSRGELHVIGATTLDEYQKYVEKDAALQRRFQPVY
FT                   IDEPSVEDTISILRGLKEKYELHHGVNITDSAIVAAAQLSDRYIQNRFLPDKAIDLMDE
FT                   AASRIRMEVESKPEEIENLDRRIIQLKIEESALAKESDEASKDRLATLRKELAELEQKS
FT                   SELTTRWQNERDKIQAEAKIKEQLDLARLELEQAQRAGDLQKAGELSYGTIPSLEKQLE
FT                   EARGANETALLREEVTEEDIASVVSRWTGVPVDKMMEGEREKLLKMEEFLGRRVIGQQQ
FT                   AVQAVSKAVRRARAGLQDPNRPLGSFLFLGPTGVGKTELTKALAEFMFGDERAMVRIDM
FT                   SEFMEKHAVARLIGAPPGYVGYEEGGVLTEAVRRRPYQVVLFDEVEKAHQDVFNVLLQV
FT                   LDDGRLTDGQGRVVDFSNTLIILTSNLGSQFLSNLTDDQKVEDVEPQVMDVVRSHFRPE
FT                   FLNRLDEIILFHRLSQEHMAPIVDIQVKRVQKLLKDRKITLDLTEGARNWLGRVGYDPV
FT                   YGARPLKRAVQRYLQDPLAEKLLAGEILDGSTVKVDEGEEGLVFVIPSQI"
FT   gene            complement(418042..418392)
FT                   /locus_tag="Sala_0407"
FT   CDS_pept        complement(418042..418392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0407"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52129"
FT                   /db_xref="GOA:Q1GW43"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW43"
FT                   /protein_id="ABF52129.1"
FT                   /translation="MIMLLSEGQMSEYKGAALMIDAFPKVRALLADRGYDADWFRAALA
FT                   ERGIAACIPSKNNRKVPIPHDTALYRQRHKVENMFGRLKDWRRIHTRYDRCAHTFMSAI
FT                   CIAATVIFWLPQ"
FT   gene            418721..419134
FT                   /locus_tag="Sala_0408"
FT   CDS_pept        418721..419134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52130"
FT                   /db_xref="InterPro:IPR035223"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW42"
FT                   /protein_id="ABF52130.1"
FT                   /translation="MRLSRVYERRRSQRFHPFETLMEVVMEQIAKNEWAELCDRISKRL
FT                   LGLRAEIEVQSLDLGDQIEAEFLPILGITYDHKDDVVVIALEGLAHLIPHPVDIQTKGY
FT                   DDNIEAVLIVDKEGVRHLTSFREPLKLPPPPAE"
FT   gene            419189..420106
FT                   /locus_tag="Sala_0409"
FT   CDS_pept        419189..420106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52131"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW41"
FT                   /protein_id="ABF52131.1"
FT                   /translation="MTFRNLAHGVAAIALLAATACSDNAEKAADGQEASASATDTDQAA
FT                   GGATAEDQVQLGTLLKEAVSALDETQAAISAIDAGNNKGAIDALARATGKLEIILTREP
FT                   NLALAPVANSVIEHDVLATPGDVKALSDRIEDLTDEGRLQEARRLMEGLASEMVIRTSN
FT                   LPLGTYPDAIKRAAALLDEQKPQEAKLVLLNALSTIVVTETVIPLPIVRAEASVEAARV
FT                   VAAKENRTEQDNQAIAAELQKAREQIEMAQALGYATKKDLDDLQDAIKELERETGGGNA
FT                   ATRLFERIKGLFGKAREAVQPTKN"
FT   sig_peptide     419189..419266
FT                   /locus_tag="Sala_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.477 at
FT                   residue 26"
FT   gene            420204..420824
FT                   /locus_tag="Sala_0410"
FT   CDS_pept        420204..420824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0410"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52132"
FT                   /db_xref="GOA:Q1GW40"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW40"
FT                   /protein_id="ABF52132.1"
FT                   /translation="MATLAHKIPFPVCSLVGNWWTFVLRGVLALILAVLAVLMPASALL
FT                   GLTIIFGAFSMVDGIFSLIAAFRNIRAGEKWGWLAFNGVVGIGTGIVVLITPMMASFVL
FT                   SLFLWWMIAFWSSASGIAQIVTAIRLRKEIKGEFWLGLGGLLSLALAGFVIWMLLTAPV
FT                   ETFLALGWVLAFYAAMFGTVMLLLGFRLRRAAKADDTGVQPAS"
FT   sig_peptide     420204..420341
FT                   /locus_tag="Sala_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.620) with cleavage site probability 0.310 at
FT                   residue 46"
FT   gene            420935..421555
FT                   /locus_tag="Sala_0411"
FT   CDS_pept        420935..421555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52133"
FT                   /db_xref="GOA:Q1GW39"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW39"
FT                   /protein_id="ABF52133.1"
FT                   /translation="MTAKGAMEGKRPRIREIVWLAGILAALVLGYALYHQLYVGASSFP
FT                   FVQETILVFLGALATIFLTAMLLNRQTELELSKEARVHLFDQKNSVYMSAIEKVAEIAE
FT                   QRDPDPALIDELRVIGHKLAVIASPEVIKSFQSVLDKLIRGLRDGNLTNADAEEVMHAV
FT                   AELTIGMRSDMLDEIGSAKNDTAQELIRRNSRQMERLDDLDEA"
FT   gene            421590..422132
FT                   /locus_tag="Sala_0412"
FT   CDS_pept        421590..422132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52134"
FT                   /db_xref="GOA:Q1GW38"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW38"
FT                   /protein_id="ABF52134.1"
FT                   /translation="MHRGHNRPPRLSKQPGTNTISADVPMAKIYQEPRSTLQGGHRPQP
FT                   WYLEFEARRPLGRDVFTGWITNDDPYRHIRVQFPDRDSAIAFAERQGWEYRVIHNSESR
FT                   HLSSKIDQLYRGSDAPGNWPIRWSGEGKQISQNRLYRGAQAGERAEREKEFDPVDEALL
FT                   ESFPASDPPAFTGATIG"
FT   gene            422145..423096
FT                   /pseudo
FT                   /locus_tag="Sala_0413"
FT   gene            423120..423605
FT                   /locus_tag="Sala_0414"
FT   CDS_pept        423120..423605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52135"
FT                   /db_xref="GOA:Q1GW37"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW37"
FT                   /protein_id="ABF52135.1"
FT                   /translation="MLANFLRLRKMTRAEWSAMSFYEKFEDAIVIVLSGIIAIVVIAAV
FT                   WSLLREVVTSLVLGALDPLDFATFQTVFGMIFTAVIALEFKRSLLVAADRGFGVLQVRT
FT                   IILIALLAIVRKFIILNLADTSAAKVAALSGAVLALGAVFWLVRDQDRQERLEQAQE"
FT   gene            complement(423702..423857)
FT                   /locus_tag="Sala_0415"
FT   CDS_pept        complement(423702..423857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0415"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52136"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW36"
FT                   /protein_id="ABF52136.1"
FT                   /translation="MKSGVIDPAKVVRTALQDAASVASLLITSEALVAELPKEDASPAP
FT                   VPAMNF"
FT   gene            424080..424355
FT                   /locus_tag="Sala_0416"
FT   CDS_pept        424080..424355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0416"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52137"
FT                   /db_xref="GOA:Q1GW35"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW35"
FT                   /protein_id="ABF52137.1"
FT                   /translation="MKTTRKRYSADFKAKVALEAIRGDLTLAELAAKHGVHHTMIASWK
FT                   RQAIDGMAGTFSGAGDAAKVISESEVEKLHAKIGQLVVELLICAEN"
FT   gene            424434..425963
FT                   /locus_tag="Sala_0417"
FT   CDS_pept        424434..425963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0417"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52138"
FT                   /db_xref="GOA:Q1GTQ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GTQ6"
FT                   /protein_id="ABF52138.1"
FT                   /translation="MIDMDLLSVIRRWHFRQGMAIREIKRRTGLSRNTIRKYLRADAVE
FT                   PVFKVPDRPSKLDPFSEKLTGWLRVESGKSRKQKRTAKQLYADLVTLGYDGSYARVAAF
FT                   ARDWKRDRQYEQQTSGRGTFVPLVFQPGEAFQFDWSEDYAVLGGKQVKLQVAHTKLSHS
FT                   RAYIVRAYLLQTHEMLFDALTQAFRVLGGIPQRGIFDNMKTAVDKIGRGKARQVNARFA
FT                   ALASHYLFETDFCNPASGWEKGQVEKNVQDARHRLWQPMPSFPDLAALNAWLEEQCVAQ
FT                   WAEIQHGTLPGTIADVHAEEVISLMPMGRPFDGFVEQTKRVSPTCLIAFERNRYSVPAS
FT                   FANRPVSLRVYPERLVIVAEGQVLCEHERIIDRSHQKPGRTIYDWRHYLAVVQRKPGAL
FT                   RNGAPFLEMPEAFRQLQTQLLKRLGGDKEMVEILSLVLHHDEQSVLCAVELALEDGVPT
FT                   KTHVLNVLHRLIDGKAPPAPTIDAPQALRLSTEPKADVGRYDTLRELRHAS"
FT   gene            425953..426720
FT                   /locus_tag="Sala_0418"
FT   CDS_pept        425953..426720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0418"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52139"
FT                   /db_xref="GOA:Q1GTQ7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GTQ7"
FT                   /protein_id="ABF52139.1"
FT                   /translation="MRHDPASAAVVVMLRGLKMYGMAQAVGDMIEQGAPAFEAAVPVLS
FT                   QLLKAEMAEREVRSIAYQIKAARFPAYKDLAGFDFAASEINEALVRQLYRGDFMDSADN
FT                   VVLIGGPGTGKSHIATALGVQAVEHHRRKVRFFATVDLVNALEQEKAANKAGQLAERLL
FT                   KLDLIILDELGYLPFSPSGGALLFHLLSKLYERTSVVITTNLSFSEWASIFGDAKMTTA
FT                   LLDRLTHHCHILETGNDSFRFRASSTAPKSRKG"
FT   gene            complement(426817..427104)
FT                   /locus_tag="Sala_0419"
FT   CDS_pept        complement(426817..427104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52140"
FT                   /db_xref="GOA:Q1GW32"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW32"
FT                   /protein_id="ABF52140.1"
FT                   /translation="MRCWQGTPTTRCAVGRTRLTRANARSSAFPPLPVREVPMKRNLVN
FT                   FTRGSQLLGHFSFMFAAGLKGPLIIAALVISWTSWWTISAGLTDHEVYLC"
FT   gene            complement(427812..428060)
FT                   /locus_tag="Sala_0420"
FT   CDS_pept        complement(427812..428060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW31"
FT                   /protein_id="ABF52141.1"
FT                   /translation="MNSDPPVWEEVRQGFLLSFCSQTVSASLSRNVKAGRKRQSGVSER
FT                   SRSVSRSGISRTFNAAASIASACVGKASEELIETPFG"
FT   gene            428472..428840
FT                   /locus_tag="Sala_0421"
FT   CDS_pept        428472..428840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52142"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW30"
FT                   /protein_id="ABF52142.1"
FT                   /translation="MVFLRERPLQRLRRSATPAPQTIFLHAPAVPRSGAEGTNGQQEGN
FT                   TMARSKPTARDALRKLREQRAQLENEEARLREEAATELGKLLIECGAETIEPAQLRQIV
FT                   RASMALGIEETLKRIAPA"
FT   gene            complement(428957..429379)
FT                   /locus_tag="Sala_0422"
FT   CDS_pept        complement(428957..429379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0422"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52143"
FT                   /db_xref="GOA:Q1GW29"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW29"
FT                   /protein_id="ABF52143.1"
FT                   /translation="MDPECSIRRKPMTNLVILVGRIARDPETRTTQGGTSITSISVVTD
FT                   RPARKDGKTYKDKNGYTAKDSEFHRITCFNGLSQNVAKYCTKGQLVTVEGRIHYTQWED
FT                   QSGAKRYGCEIIADKVDFLTKGRSGGNEGAPDIDED"
FT   gene            complement(429651..430079)
FT                   /locus_tag="Sala_0423"
FT   CDS_pept        complement(429651..430079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW28"
FT                   /protein_id="ABF52144.1"
FT                   /translation="MAHCYYHALSSVRKWGGRVDDYLPLHQWFDQSKAILADPRHRALR
FT                   HHAEGIFMLETLFGETLVNADGRVVPVRLVGEQHVREDLGSIPSFADWARLITPQAWML
FT                   RGNPLDGAEGVTIDMPVPGEAVASRTRPPAGGEVRTVI"
FT   gene            complement(430090..430551)
FT                   /locus_tag="Sala_0424"
FT   CDS_pept        complement(430090..430551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52145"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW27"
FT                   /protein_id="ABF52145.1"
FT                   /translation="MIDIEAVMADFAVRQAQRQAQVVEEIQQLKTVILPRLQEAGIARV
FT                   EIRFDGCGDSGAVEECACLDAAGAAIACPDVTILEDEAGNSDGDGSAELHSLGQALEQL
FT                   TYLALERHHPGWEINDGACGELVIDVAEATFVLDCSLRFIATDDHSTEL"
FT   gene            complement(430674..431627)
FT                   /locus_tag="Sala_0425"
FT   CDS_pept        complement(430674..431627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52146"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW26"
FT                   /protein_id="ABF52146.1"
FT                   /translation="MHTSFADQLAGLDLAGFSIGPAPVSTSDFPVREAVVQTLEAVWSD
FT                   LFAMVSGTALEADAEDLGWAFVNIFHRSAERKSTALDRATDEVRALIATADGSEVHTHD
FT                   LETQVERAQCAESAMLALEEMREVAAGLYLNEFGSSWKPVSSSRFNHSAMLTSALVEGR
FT                   DFLRARAEAKRRAAVPEGTPVVFAGGRTRHATEDDALTFGNNVWATLDKVRDRVPDMVL
FT                   IHGGDTKGVDRLASSWAERRGIPQVTFSLDMRLGARAGFKRNERMLSLDPRYVIAFPGN
FT                   GVLERLVIEAKARRITVVDRRGPLGTNPKNTSARTD"
FT   gene            complement(431930..432352)
FT                   /locus_tag="Sala_0426"
FT   CDS_pept        complement(431930..432352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52147"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW25"
FT                   /protein_id="ABF52147.1"
FT                   /translation="MGRSVSYPSGAIVAFTVLDVESDDDWEFEYEWLREDLRERAANAF
FT                   PSLIPHDGWRGREDRILMRNAYADFGVSVYGGLVAVWIVERDDGPYWDADWRTARSPRA
FT                   RRWLSQIASRFDALFGDFDCLGHMSNGEGVYTKRAA"
FT   gene            complement(432364..433305)
FT                   /locus_tag="Sala_0427"
FT   CDS_pept        complement(432364..433305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0427"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52148"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW24"
FT                   /protein_id="ABF52148.1"
FT                   /translation="MAYRKGQSGGLSPATRITQEIIARLEAGTKPWIKPWRGVPVSRPL
FT                   RACGIPYRGMNVFWLWMVADMCGYASPFWMTYNQAQSLGAQVRKGEKSTIAIFYKSYTK
FT                   EVEAPDTGEKTDEARRVLKAYPVFNADQVEGLPERFHPAATLELVEPEGREAELDAFFA
FT                   AIPVNLRHQGCEAYYEPTADRVTMPPVSLFGGFDHYYATLAHELSHWTGHASRLGRDLK
FT                   NRFGTSAYAAEELVAELSSAMLGAELGLPVTHLDSHASYIEHWLKLLKDDDRAILTAAA
FT                   KAEEAASLLLKLGGKIIPEQSDDASDDAALAA"
FT   gene            complement(433473..435461)
FT                   /locus_tag="Sala_0428"
FT   CDS_pept        complement(433473..435461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0428"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52149"
FT                   /db_xref="GOA:Q1GW23"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW23"
FT                   /protein_id="ABF52149.1"
FT                   /translation="MIKSIPLNKLVQSPRNVRRHSDPASDAELKASIAACGLLQNLIVR
FT                   PTAKAKFEVEAGERRRRAMLALADEKILARDHEVTCLVLEDSAEVAVETSLAENFHRLA
FT                   MNPADEAQAFAALVAGGATVEDVARRFGLTVRFVDGRLRLANLAPVVFEALASGEITLD
FT                   IAKAFGATSDQDIQARVFEQVSSAYYAPNPDSIRRMVLSGTVRGSDPRARLVGRDAYIA
FT                   AGGRIERELFDNDDSESWVDVALLESLAAAEMEEQAKALATEQGLAWVKPTLDPYASHD
FT                   LVEGLVRLPADPAPMTEAELARLDELDASYDEHAAILEDEDSAEEAVAAAEAAIEAIER
FT                   ECQDIRARPPVIAPELKAEAGMILVLSRDGTPVLQPVFYGERQADPAEADDGIEVVAGD
FT                   EGSDRRRTTLSKRLVDELAMQRRDILALHVASDPGLALDIMVFTLADSDTHDWRARPST
FT                   TLRAPVPAGPIIGFEAKDAPASSALAELRSGLDESWRAGANATSRFDLFRALSDDSRAA
FT                   WLGHVVARSLEASLNMEGERQLPFQDHLGSLIGIDMAQWWRPTAANYFDRVSKQVILDA
FT                   LTDVGGLELSSRFASVKKGDLAMSAERVFAGTYITEVEVREKALAWVPEVLRFASAAPE
FT                   AGEAEIDATDADPGDDTEDQSPRELAA"
FT   gene            435883..436536
FT                   /locus_tag="Sala_0429"
FT   CDS_pept        435883..436536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52150"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW22"
FT                   /protein_id="ABF52150.1"
FT                   /translation="MVSEVSGASDRQSAVRLLACIDAAGATADADQWGEDVVATLHAQS
FT                   RLQALDFWMRNPDYLANELLTVFEETGDASLIHLAERIFDDREPDLRRLPMIRYHFGAF
FT                   EPLDNALSILVAAGLLKIRRQGSPGQVREHIYLLTIKGREAMASLAEAAPELAWYRDRA
FT                   AIVTRVAGDKGGKALKDRQYLQAEYAGTELNHIIAPITERVRKRLDAILERAGR"
FT   gene            436533..438461
FT                   /locus_tag="Sala_0430"
FT   CDS_pept        436533..438461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW21"
FT                   /protein_id="ABF52151.1"
FT                   /translation="MTASWLEMVAEKAGMSPAEAEIALRRRGITADRPMRPARTLTITA
FT                   IAFKGEKGGKAQGAIDFCWEGLRPGIWAITSEKNFAGKSSIIEIILWCLRGTPKDLQGD
FT                   VRKWLSWVALDFLVDAQPYRIEFTVDAGVPTGTLMLIRPSGAPTIVDHFSSDEGFAAGM
FT                   SQFMMNTLDLDPIPAMQGKDGDKMAVEHGWTALSGGLYFGGDHKLLLGDVQMGGLPARM
FT                   LQMYVGLPWALTVMQARTVKKEVEQEQDQGNKAAARAAEEAAKARTRLEADLAAAQKTL
FT                   AGLSSTQATAKELERLAGEVARLSPIAIDQAKRHATAQAELKALRELADTDERALRNLR
FT                   ENIVAEQFFNGLEPVCCPRCEAKVSGERIKRESVDLNCSLCAEHIPVETMEGVSETIEA
FT                   GERRAQASRAAVERAVAHESALRRLAEDASKAVDAARAALEKAATGITFQQRREAELAV
FT                   ARLEGALKERKIDGVAPTPSPDLALVRAATKEAETAYDQSRGDILQRLSEEILTLGQRL
FT                   GVRMLEGVKLGSNATLALTKGGESTSFSKVTAGERLRLRLATAVALLRVAQERGLGRHP
FT                   GLLIIDSPGAEEVSDIDLAALLGELQTIAKETPGLQILVASANPPAIVSQLGEDRCRIA
FT                   EKDAYLW"
FT   gene            438445..440391
FT                   /locus_tag="Sala_0431"
FT   CDS_pept        438445..440391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW20"
FT                   /protein_id="ABF52152.1"
FT                   /translation="MHICGDRARERRGVTVIDAISRCLAQGEVVTLERIGGANRLALER
FT                   DALLQAPFLDVLVTMTVTAPETDQAILDSLLTDGFAAAPSPTVLRDAAHLLIEAPHLRD
FT                   RLGRTLTPILLDKVADRSDPRTDLMAAYALEALFRLALADAMNRHRLLALLTEIDGTPS
FT                   ELFAAHAAKLLGAAFTQWGGSDLIAALERLLPSAEAEAAFELGLITLGDGLAQASMPDI
FT                   LGRLEAAQLRFRQAARADEDRADAVAYDAIIDIIRGFWNEAGAADLHASLSRLERAITD
FT                   RQALLRAASLPPWLAPRADREIAWVGLARGARRAVDDLSRPSWLNAAATLNALLAIYDA
FT                   ERTVKAGPGLSLLIRPRIEAAFVRERGLAEHLDRLLREPDLFGIDACLATQLRTGVQRR
FT                   SEETEASRKAEENASYPLLTSVLHGLPGADQLPQITAAALESALGRQANQAEQFTNPVI
FT                   NQLFRELTEAVASCTDYHGETKDGFDALLAQILMFCADRQDAGRKQLGPRTDYLRADDA
FT                   KEGDLQSDLREFIKGNITTAEVLTEVEGIATGRSDIYVGFGGVRFISELKRHFGAVDRE
FT                   VARSYFGQAGAYQATNVRLGFLGILELVGRPGPPPTIAECLWHTDYIPEGSTLARHIIV
FT                   FRVPGMLKTPSSL"
FT   gene            complement(440845..441573)
FT                   /locus_tag="Sala_0432"
FT   CDS_pept        complement(440845..441573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0432"
FT                   /product="IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52153"
FT                   /db_xref="GOA:Q1GUV5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GUV5"
FT                   /protein_id="ABF52153.1"
FT                   /translation="MQRHEMIEAMRSLGLKGMAGAFDEAVTTGLQRKRTTHEILTDLLR
FT                   AEAAHRHAASIRYRMTAAKLPVIKDLDAFAFEGTPINEELVRSLHTGSFLPGRRNIVLI
FT                   GGTGTGKTHLATAITASVVRAGARGRYFNTVDLVTRLEEEARIGKAGSIAAQLGRLDLV
FT                   VLDELGYLPFARSGGQLLFHLISKLYEQTSVIITTNLAFGEWPTVFGDPKMTTALLDRI
FT                   THHCDIVETGNDSWRFKNRS"
FT   gene            complement(441560..443074)
FT                   /locus_tag="Sala_0433"
FT   CDS_pept        complement(441560..443074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0433"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52154"
FT                   /db_xref="GOA:Q1GUV4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GUV4"
FT                   /protein_id="ABF52154.1"
FT                   /translation="MLVVETVVRIRREHASGKAIKAIARDLRLSRKVVRKAIRAPEGAF
FT                   DYRRTVQPLPRLGPFQERLDTLLMENEARHRRDRLRMTRIHDLLCREGFEGSYDAVRRY
FT                   ARRWTEARRKDAGDGAPAFIPLMFKPGEAYQFDWSHEDVEIAGKPMRVKVAQMRLCASR
FT                   AVYVRAYPRETQEMVFDAHARGFAFFGGVPLRGIYDNMKTAVTTVFVGKERVFNRRFLV
FT                   MADHYMVEPTACSPAAGWEKGQVEHQVQTIRGRFFQPRLRFASIEELNGWLEAECLRWA
FT                   ATHAHPEQKELTVAEALELERPALQPMLAPFDGFHETTHAVTGTCLISFDRNRYSVMAK
FT                   AARRAVQVRAYADRIVVRLGDEVIAEHARHFGRDRTIYNPWHYLPVLAHKPGALRNGAP
FT                   FQGWDLPPALTRLRRKLGGGDDADRRFVRVLASVMTDGLEAVEAAIREALDSGAVSDEV
FT                   ILNILARYRDPPSERPLDVVADLKLSHPPIADCARYDTVRGLHAAA"
FT   gene            443253..443660
FT                   /locus_tag="Sala_0434"
FT   CDS_pept        443253..443660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52155"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW17"
FT                   /protein_id="ABF52155.1"
FT                   /translation="MFWKPQVALLVSERTLLPVLMPLAPAATLARRFPTQLALVLKDHG
FT                   VPSEFIAEEVWQMDKVQYAKTANRSVVGILNEFVKQAEFWLAAYAYEKGDDDDLLAISA
FT                   KLAETPCSPLYKGPVSPDKALHELVKAGSQA"
FT   gene            complement(443726..444460)
FT                   /locus_tag="Sala_0435"
FT   CDS_pept        complement(443726..444460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52156"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW16"
FT                   /protein_id="ABF52156.1"
FT                   /translation="MSETAEIPVSRVEWKGAVRIIRSAFPPIDLFEDIADPADWPLLIS
FT                   AEQKTNPRIMATIGNLDLVPVDRRVGGNGASYLMAPFTHVSTDRPSRFTDGSYGVLYVG
FT                   DRFETALFETIYHHARFMARTREEPGWTSQFREIIMSVDVDLHDLRTLVGKPDSALDPD
FT                   SYAASQALARHLRGAGSNGIAYPSIRHPGGECVALFYPDCASNPLQGRHLDYHWDGARV
FT                   DLVRDAGSGAVFRIVDLPPDPA"
FT   gene            complement(444457..444870)
FT                   /locus_tag="Sala_0436"
FT   CDS_pept        complement(444457..444870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52157"
FT                   /db_xref="InterPro:IPR020358"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW15"
FT                   /protein_id="ABF52157.1"
FT                   /translation="MLALQPVDTAVTAFRPDPITQDEAAAMFRAVLNLFGKWELTDEQA
FT                   ATLLDMPVRSYRRWKAEGPGRISRDARARLSNLMGIHKALRIIFSEATRGYTWIKAANE
FT                   AFGGASALEVMLGGELTDIMRVRRYLDAERGGW"
FT   gene            complement(444934..446769)
FT                   /locus_tag="Sala_0437"
FT   CDS_pept        complement(444934..446769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0437"
FT                   /product="putative methylase/helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52158"
FT                   /db_xref="GOA:Q1GW14"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW14"
FT                   /protein_id="ABF52158.1"
FT                   /translation="MENRRKPASLAATLDINCDCKEYVIDYLAKSFPVRLMAVFTDENG
FT                   NPRSEPMTDEDGAPVLCRSALAARDRMIEQLCALPPIATALDAIIERFGVDQVAEVTGR
FT                   TRRLIVGRDGRQKLQSRSPRANVAETQAFMDGAKRILVFSDAGGTGRSYHADLAARNQA
FT                   RRVHFLLEPGWRADAAIQGLGRTNRTNQASAPLFRPVTTDVRGERRFISTIARRLDSLG
FT                   ALTRGQRQTGGQNLFDPADNLESIYAKEALHRWFGLLFTGKLEAVSLGRFQELTGLRIE
FT                   APDGSMVDDLPSIQRWLNRILALPIALQNAIFDEFMGLVEARIDAARQAGTLDLGLETI
FT                   AVEDFTVLSDTLLRTDPASGATTHLLELEIARALKPLTLTRLEEIHGITGQRQRPVRNA
FT                   RSGRVALLVPARSILADDGTRVARFELLRPMKHSHITEDQLAESSWEGISVDVFREAWV
FT                   AEVEEARTSHKRERLYLATGLLLPVWDKLPSDFVRVSRISAADGRSLLGREVPAHCVPE
FT                   LCRALGLEREQTLSADDIVQTVLATGRAMEFTGRELLMVKRSLVNGSQRLELTGWSAAR
FT                   LDWYKAQGCFTEIIRYQTRLFVPIEGAASVIARLA"
FT   gene            446826..448373
FT                   /locus_tag="Sala_0438"
FT   CDS_pept        446826..448373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0438"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52159"
FT                   /db_xref="GOA:Q1GW13"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW13"
FT                   /protein_id="ABF52159.1"
FT                   /translation="MRSRSLLSFRAARLRVEDPPSHDALLTAFLSSLSLDERSGSAILF
FT                   GAAARHFLHWMELHGIAIRTIDDRTVRRFEKHRCRCHRYSAQQPVYKADIAARVRRFVR
FT                   FLEDQGYVGVDDGIDDLPRHLADYFDGIDRLQLAQGPAQSYRSEAEHFAAWLRIARRQW
FT                   ADIDDTIIDQYGAHDCRCPVWRKRGKLVASGAKRRRRGARHFVEFLRDRGVIPSVELVS
FT                   DDDPHMAAYLAWLKQHRGATDETIRRYRADIRRLAPMLGEPSQWDAAVLRRAFQQRSKE
FT                   TPGSASLLVTIIRSYIRFLVVQGICRPALLHAIPSVQRYRLSTLPRHVNPATIEQIIGA
FT                   CPTDRPVEVRDKAIILLLARLGLRAGDIRDMHLDDIDWRSGHLTVKGKTRRPDRLPLPQ
FT                   DVGDAILDYIATARPKTADPHLFVRAQAPFRSFRSSAEIAGIVARTHERGGIEGVPTGS
FT                   HIFRHSLATNLLRAGAGLESVGTILRHSSPETTAIYAKVDLPMLMKIAQPWPGEPSC"
FT   gene            448367..449281
FT                   /locus_tag="Sala_0439"
FT   CDS_pept        448367..449281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0439"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52160"
FT                   /db_xref="GOA:Q1GW12"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW12"
FT                   /protein_id="ABF52160.1"
FT                   /translation="MLSTQIARYVSLYRSLGRKFSEQERLLRQYAAFAERFGDRHTRVQ
FT                   RIYDWCHTASSQNVARHRYDAARNFSLFAHAEDPDNEVPPVGVFGRGKRPRPTPTIIEA
FT                   DQVRAIMAAALNVPPHGTISPYTYHYLFGLLAATGLRISEALALQCNDLVEDGLVVRNG
FT                   KFGKQRLIALQPSTRQALEAYIAIRAKHPAKCNDLFVTIRGRAPHKVRAHVVFVRLARL
FT                   LGYRGATGTAGMRLHDLRHTFAVRSLESCPRDREAIAHHMAGLSVYLGHASIANTYWYL
FT                   EATPVLLRDIAAASEQLFQGEAA"
FT   gene            449278..450282
FT                   /locus_tag="Sala_0440"
FT   CDS_pept        449278..450282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0440"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52161"
FT                   /db_xref="GOA:Q1GW11"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW11"
FT                   /protein_id="ABF52161.1"
FT                   /translation="MTALALHLSAYLREHLPRERAVSPHTVKTYANCFVLLVQFAADRL
FT                   KRRPTDLEVEDLGTDMIMAFLDHVEIGRGSCVRTRNGRLAAIRSFFRYIEYRIPACLDQ
FT                   ALRVRAIPTKKTDKALIDYLDRAEIKALLDTPDPRTRLGTRDRAMLHLTYAGGLRVSEL
FT                   VTLQLGDFPDRSLSTMHIMGKGRRERVLPLWKETQIALRAWLAIRPQVEVTEIFLNANG
FT                   QPMTRDGFAFRLAEHVKTAATKQPSILGKRVTPHVLRHSCAMHTLAATGDIRKVALWLG
FT                   HASIQSTETYLRADPEEKLQILAAHGAPAIKPGRFKPPSDALITMLTDVRRRA"
FT   gene            complement(450421..452895)
FT                   /locus_tag="Sala_0441"
FT   CDS_pept        complement(450421..452895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0441"
FT                   /product="putative methylase/helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52162"
FT                   /db_xref="GOA:Q1GW10"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW10"
FT                   /protein_id="ABF52162.1"
FT                   /translation="MSNSSLAFAFDEPSPPAVATAAQVMASELAAGRALSRSDVTRIMS
FT                   EHFGGSDALGRWSVRDAHAALELAQVQYLQACDQIQLSSPIDEAEQFFFSLDDRIPTQT
FT                   NRSDEQIEWQQFATPPRLAWLAARACALVADELVLEPSAGTGMLAVWATKAGTHLALNE
FT                   ISPLRRDCLTAVFPAAHVTGHDAELIDELLDPAIAPSVVLMNPPYSHGIERGHDGRTGA
FT                   RHLRSAWNRLAPGGRLVAIMPEWFDCARFLARAKGPVSMRLNAAVERAFIKNGTGITTR
FT                   LLVLDKVEGVNEPVAIRTNEFRQLVDLVDALPARASRQAIAEQSTLPARAPFRLLTAPR
FT                   RPPPAPSTTTRAASMTIGALTYEALEKPAPLGAQVGHYLPYRPSRIVINGAAGHPTPLV
FT                   ESVAMGSISAPKPDAVPQLPDGLIVKGLLSAAQAETLIYAASAHARDLHGRFEPEDKGC
FT                   SLKASAEGQVYRQGYFLGDGTGAGKGRQVASVILDRWVRGERRHIWISKNEALLEDARR
FT                   DWAALGGLPIDIQALASWKLGTPIAMRDGILFVTYPTLRSGRSDATRLDQILAWAGEEF
FT                   NGVIVFDEAHAMANAAGGEGSRGKVKGSEQGIAGVRLQNLLPRARVLYASATGASDVNN
FT                   LAYATRLGLWGPETAFANREAFVTDIRDGGIAAMELVARDLKSLGLYTARALSFAGVEY
FT                   EILEHCLTEDQISVYDAYAEAWAIIHANLREALEATRIVDSETGGTLNSGAKSAALSIF
FT                   EGTKQRFFAQLLLSMKLPSLLPAIDTAIADGHAVVVQLVSTAEAMLDRRLADLSDEERE
FT                   ALEIDLSPREYI"
FT   gene            complement(452936..453865)
FT                   /locus_tag="Sala_0442"
FT   CDS_pept        complement(452936..453865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0442"
FT                   /product="virulence-associated protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52163"
FT                   /db_xref="GOA:Q1GW09"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW09"
FT                   /protein_id="ABF52163.1"
FT                   /translation="MPPLDKAHQLERRARTIVESLQGTWSRGKGMCCCPAHDDRTPSLS
FT                   VTLGRKAILFHCFAGCLNEDVIAALDRQGVRSRDLFNASDAETIEKHRYRDFSPNARRL
FT                   WQSATASSDSPAVQYLAQRGLLRGSDQLRYLARTPLGPRGAVQFLPAMLAAVTTDIGII
FT                   AVHRTFLDLASGKLAAFERPKRALGTLGCGAVRLVPPVQGRLGLAEGIESALSAMQLFG
FT                   VPCWATLGNERFGLVSIPESVRELFLFIDNDAGGALAEKRALKAYAAPSRVIHSRVPAS
FT                   PGFDWNDELKSRLARKPDPLGRGEGAFG"
FT   gene            453990..454646
FT                   /locus_tag="Sala_0443"
FT   CDS_pept        453990..454646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0443"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52164"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW08"
FT                   /protein_id="ABF52164.1"
FT                   /translation="MTIKTLLIAGIAITSAIPASAQELPTPATIEATASHSDGIRIAKT
FT                   SNGFQLVEHGLWRSAQDGPAPVVTVPRTGRVNLPYRYERNPQPGPSGFRRASYLPHIYA
FT                   AEAKYSLPAGLLDALVWTESRYNPLAVSPAGAAGLGQLMPATAKELGVFNRFDPMANIF
FT                   GAARYLRQMLDRFGVVHLAVAAYNAGPRAVERAGGIPRNGETPGYVRDVLRHWQF"
FT   sig_peptide     453990..454055
FT                   /locus_tag="Sala_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(454701..455954)
FT                   /locus_tag="Sala_0444"
FT   CDS_pept        complement(454701..455954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0444"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52165"
FT                   /db_xref="GOA:Q1GW07"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW07"
FT                   /protein_id="ABF52165.1"
FT                   /translation="MPLTETQAKNAKPRERAYKLADSEGLFLLVQPNGTKLWRMKYRFA
FT                   GKEKLLSFGAYPALGIAAARDKRKAAKALLAEGKDPMKAKREVISENGDTFYMVAKRWH
FT                   ENRQSALNPAHAERVWSRMERDVFPSLGQRLIHEITAPEVLEMIRKIEIRGALDISRRA
FT                   KQGVGQVFQFAIACGLASSDPTAHLSGALKPRPRVKHMSRLPLDEVPAFLEKLRAYQEE
FT                   GDRRSAITRDAVLFALLTWVRTKELRLAVKSEFENLDGTDTVWRIPAARMKMGREHLVP
FT                   LSAQAALIARKMVSTATGDHLFPGTHPDKPLSENTMIYALYRLGYHSRQTIHGFRGLAS
FT                   TWANEQLVEFGKPAMWIRKYHEDWVEMQLAHSEKNDVRGAYNAAEYLAPRRRMMQDWAD
FT                   FLDGRKVLDIRKGRKRAA"
FT   gene            complement(456132..456208)
FT                   /locus_tag="Sala_R0003"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(456132..456208)
FT                   /locus_tag="Sala_R0003"
FT                   /product="tRNA-Met"
FT   gene            complement(456270..456875)
FT                   /locus_tag="Sala_0445"
FT   CDS_pept        complement(456270..456875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52166"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW06"
FT                   /protein_id="ABF52166.1"
FT                   /translation="MGSGNSGTTRPRLADPDDSGPDIPPPVRFPGAAPIIVTASMGAAD
FT                   QRRFDALRAAHFPPERNHLAAHVTLFHQLPPSCLDELARLLRRIAADTPPPAAMLREVY
FT                   LLGRGVAFRIDSPDLLAIRERIADHFWGMLTAQDRGTPRLHITVQNKATTAAARALLAA
FT                   LAADFRPRSLTIAGLAAYHYRGGPWESAFALSFRGARR"
FT   gene            complement(456968..457726)
FT                   /locus_tag="Sala_0446"
FT   CDS_pept        complement(456968..457726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0446"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52167"
FT                   /db_xref="GOA:Q1GW05"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW05"
FT                   /protein_id="ABF52167.1"
FT                   /translation="MTTAKLFLHGVPDSPAIWRPLLAALDLGGTPVAVPALPGFTAPLP
FT                   AGFAATKEVYADWAVKQAEALFAAHGPIDIVGHDWGALIAQRVAMLRPDLIRSWAISNA
FT                   VIESDYRGHRIARIWNTPILGELFMALSRADKLAAALAAQGMPADIAAEEAAQWKNRDK
FT                   RRAILKLYRSAKGLSFAQDWALDIPKLPARGALIWGAGDPYVELAVAQRYAAATGTPLT
FT                   VIDGAGHWAIAERPGAVAAALRAFWDGTAI"
FT   gene            complement(457723..458871)
FT                   /locus_tag="Sala_0447"
FT   CDS_pept        complement(457723..458871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0447"
FT                   /product="Kelch"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52168"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW04"
FT                   /protein_id="ABF52168.1"
FT                   /translation="MIRTVSITLALVIGLAGCAANGEDAAGLQAADLRFEDGPRLGAPR
FT                   AAHQLIATADGKLLAIGGCVRSGCDVGPASATVDIIDAASMALIGSGRLLAAHVQPSAV
FT                   ALRDGRVLITGGWIDGRPATAIEIFNPATGRSVAGPALGGPRANPAVVGLADGRVLIAG
FT                   GYDGQDALGDALIFDPASGTLSATGRLVTPRAGASATLLSDGRVLLVGGGRAERSPRIA
FT                   LASAEIFDPATGRFEAAGSLAQGRYKHGALRLDNGDVLIVGGATERDSAGKLRSVERFD
FT                   AATGRFVVAGQLLAGRYKLADALLLLPGNRVLVAADDMAPEIFDVARGRSSRVDYDLGE
FT                   RWNFMAMVRVDSRRALLAGGYSEKGIDPTDRSWVIHLPTGAS"
FT   sig_peptide     complement(458803..458871)
FT                   /locus_tag="Sala_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.880 at
FT                   residue 23"
FT   gene            complement(458901..459839)
FT                   /locus_tag="Sala_0448"
FT   CDS_pept        complement(458901..459839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0448"
FT                   /product="aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52169"
FT                   /db_xref="GOA:Q1GW03"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW03"
FT                   /protein_id="ABF52169.1"
FT                   /translation="MHPFRWLRIAILTLALAACSPGAPKDAEVVIPKGASIARAGEILE
FT                   EAGLVSASSFRNQARFFGSDEPIKPGEYKIEKGMDAGDILKLLQSGKTIQRLVTIPEGM
FT                   PSIMVWERLMAEERLTGEIPVPAEGSVLPDSYAFTTGESRAAVVARMQAAMDRVFAELW
FT                   AKRSPRTAVRNRNEAITLASIVEKETAVPAERRTVAGVYTNRLAVGMRLQADPTIIYPI
FT                   TRGKPLGRRILRSEIQAVNDYNTYAMAGLPRGPIANPGRASIAAVLDPEANDYLFFVAR
FT                   GDGSHVFARTLAEHNANVQKWYALRRERGEM"
FT   gene            459925..460227
FT                   /locus_tag="Sala_0449"
FT   CDS_pept        459925..460227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52170"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW02"
FT                   /protein_id="ABF52170.1"
FT                   /translation="MVNRHSSLVARKWGLFALSLLTGHRHAALRVAKKLHFRLAILRMS
FT                   IGQRVRTPSEASANSVLLGSGPINYPFEASKWRRYRALAGAAGSIATRKAAKVRD"
FT   sig_peptide     459925..460008
FT                   /locus_tag="Sala_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.913) with cleavage site probability 0.912 at
FT                   residue 28"
FT   gene            460587..462050
FT                   /locus_tag="Sala_0450"
FT   CDS_pept        460587..462050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0450"
FT                   /product="TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52171"
FT                   /db_xref="GOA:Q1GW01"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW01"
FT                   /protein_id="ABF52171.1"
FT                   /translation="MRQDIRRRRIVPLMGALSVLIAPELAWAQEGAASATGGLDEIVVT
FT                   ARKREENLQSAPLSVAAFSGDTLARAGIDEFAEIATRVPGFTLNPDNVSEPNIFLRGIG
FT                   TDIESAASSAAIGFFLNDVYLPRASGTAIELFDLERVEIVRGPQGTLYGKNVVGGAINF
FT                   ITRKPTDAFRAGVEAGIGNYGSFDVKATIAGGIGEGLSGSLAAAARRRDGFAFNSFTGN
FT                   DVEDLSAFGLMGQLRYQPGDSLDILLTGDLTRRRARGKWVDIQTPSTHNIPFVNPDPRR
FT                   GPNNVDGRQDADLGGIHLSANWDSGAGTLTLISAYREGDFSVLNNDAGSFIDFTRLVYD
FT                   GNGRIDFLAIDRSRFNDDYFINDKDAIHLLAQQAPRAQVRFGRHGDQQPLTLGRKPRLV
FT                   VPAQLARRDAARPALPLDRRIRAGDAPPDLRCRPARRRAQCPRGNRPCRRSIELARLVP
FT                   VGLPRSQQVESENQRCLNPQSIRSNKRAR"
FT   sig_peptide     460587..460673
FT                   /locus_tag="Sala_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(462047..462814)
FT                   /locus_tag="Sala_0451"
FT   CDS_pept        complement(462047..462814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0451"
FT                   /product="glutamine cyclotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52172"
FT                   /db_xref="GOA:Q1GW00"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GW00"
FT                   /protein_id="ABF52172.1"
FT                   /translation="MPFVLALALLADSPAATPAPPPRVERCGYRIVQSFPHDPSSFTQG
FT                   LFWHDGHLYEATGQYGQSRVARLDLKTGKALVETPLPSDQFGEGITRWGDQIIGVTWKN
FT                   GIGHRWRIRDLKPLGTFRYAGEGWGVTMVGKDLVLSDGTPQLRFLDPATMVERRRVTVR
FT                   FAGRPVAMINELETIDGRIWANVWMTDFIVQIDPATGDVAAIIDLSGLHADAGARGTDG
FT                   VLNGIAWDANAKRLFVTGKYWPKLYEIALANCR"
FT   gene            complement(463029..464672)
FT                   /locus_tag="Sala_0452"
FT   CDS_pept        complement(463029..464672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0452"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52173"
FT                   /db_xref="GOA:Q1GVZ9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVZ9"
FT                   /protein_id="ABF52173.1"
FT                   /translation="MAAKDVKFSRDARERILKGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEIELKDKFENMGAQMLREVASKANDKAGDGTTTATVLAQAIVREGM
FT                   KSVAAGMNPMDLKRGIDLAVTKVVEDLKARSTPVSGSSEIAQVGIISANGDVEVGEKIA
FT                   EAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEKMIVELTDPYILI
FT                   FEKKLSNLQSMLPILEAVVQSGRPLLIIAEDIEGEALATLVVNRLRGGLKVAAVKAPGF
FT                   GDRRKAMLQDIAILTKGEMISEDLGIKLENVTLNMLGQAKRVTIDKDNTTIVDGAGDAE
FT                   AIKGRVEQIRAQIETTTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDA
FT                   LHATRAAVEEGIVPGGGTALLYATKALEGLKGANDDQTRGIDIIRKAIETPLRQIAANA
FT                   GHDGAVVAGNLLRVGDVEQGFNAATDVYENLKAAGVIDPTKVVRTALQDAASVAGLLIT
FT                   TEAAVSELPEDKPAMPMGSGGMGGMGGMDF"
FT   gene            complement(464759..465046)
FT                   /locus_tag="Sala_0453"
FT   CDS_pept        complement(464759..465046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0453"
FT                   /product="chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52174"
FT                   /db_xref="GOA:Q1GVZ8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ8"
FT                   /protein_id="ABF52174.1"
FT                   /translation="MQFRPLHDRVLVRRIEAEEKTAGGIIIPDTAKEKPQEGEVVSVGT
FT                   GARADDGKVTPLDVKAGDRILFGKWSGTEVKVDGEELLIMKESDILGVIA"
FT   gene            complement(465182..466615)
FT                   /locus_tag="Sala_0454"
FT   CDS_pept        complement(465182..466615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0454"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52175"
FT                   /db_xref="GOA:Q1GVZ7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ7"
FT                   /protein_id="ABF52175.1"
FT                   /translation="MLHQPTSAAAHRAQGFRDEFRATLALAWPLVLTNLTMSLIGATDV
FT                   LMVGRLGPTELAASSLGFNLAMLLGIFGMGLVMGASPLMASEIGRRANSVRDIRRTFRQ
FT                   TLWLVAIVAVPMLAILWNTGAILDLLGQDRALAALAQDYVRAYMWSIPLFLATLAFRNF
FT                   LAALERPMWSLVVGVVGVLGNILFNYALIFGKFGMPALGIVGAGVGSVLTNMVMLLLMV
FT                   GVVYRDRQFRRYHLLGRWWRSDWPRFAQMTRIGTPIAVSHAFEAGVFSAAVMLMGWIST
FT                   AAVAAHAVALQLASLTFMVPMGLAQAATVRVGIGHGRADAHHIRRAGWTSFAMGTGFMA
FT                   AMAIIMLAIPGTLAGLFIDRTNPANAEVAELAVSFLVIAALFQVADGAQVVAQGMLRGL
FT                   HDTFVPMLFALFGYWVIGIGVGAWLAFERGWGGVGIWTGLATGLSIVAVLMLTRWMQRE
FT                   RLGLVRQTAPLRESVAAPI"
FT   gene            466957..467709
FT                   /locus_tag="Sala_0455"
FT   CDS_pept        466957..467709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0455"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52176"
FT                   /db_xref="GOA:Q1GVZ6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ6"
FT                   /protein_id="ABF52176.1"
FT                   /translation="MTIDPQFFEARDGVRLAWRETGEGRPVVLLHGLFSSGEVNWIKFG
FT                   TAARIAAEGYRVIMPDLRVHGSSDAPHDAQHYPPDVLVRDVEDLVAHLGLVDFDLGGFS
FT                   LGARTSVRAVVAGMKPRRLILGGMGLAGLAGWQRRGAFFRRAIAEYETAKRGDDTWLSI
FT                   QFMKTMKVDRIAAGHLLESFTDTPPEALAALTMPVLVVCGEQDQDNGSAEELVAVLADA
FT                   RLATIPGTHMSSVTEPALGEAIAAFLTA"
FT   gene            467931..469769
FT                   /locus_tag="Sala_0456"
FT   CDS_pept        467931..469769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0456"
FT                   /product="Peptidyl-dipeptidase A"
FT                   /EC_number="3.4.15.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52177"
FT                   /db_xref="GOA:Q1GVZ5"
FT                   /db_xref="InterPro:IPR001548"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ5"
FT                   /protein_id="ABF52177.1"
FT                   /translation="MKAMISTLSLALSLAVASPAFAQAAPAATPAAAPTAAEAEAFIAA
FT                   AEKDLFDYTVEAAQVNWVNATYITEDTDAMAARINAVGTEKAVKYALEAAKYSDVPGLS
FT                   AETKRKLNILRTGLVLPAPTTPGAATELNRIATDLQSQYGKGRGTLNGKEIAGSDIEAE
FT                   MGNLERTPVELAEMWTSWHDNVGAPMKQDYARMVAIANAGAKELGFADTGAMWRSGYDM
FT                   PPEEFARLTEKIWQDMKPLYVALHTYVRWKLNEKYGDAVQPKTGPIRADLLGNMWAQEW
FT                   GNIYPLVAPPGTGDLGYDIGELLAAQGKTPLDMVKIGENFYSSLGMAPLPDTFWKRSMF
FT                   TKPADREVVCHASAWNIDNKDDIRIKMCIKVNADDFVTIHHELGHNYYQRAYNQQPFLY
FT                   LNGANDGFHEAIGDFVALSITPQYLVDIGLLDKAKVPSADKDIGLLLRQAMDKVAFLPF
FT                   GLLIDRWRWGVFDGTIQPADYNKAWTEMRTRYQGIVPPAARPADAFDAGAKYHIPGNTP
FT                   YTRYFLARILQFQFYEAACRQAGWKGPLHRCSFYGNREVGAKLNAMLEMGASKPWPDAL
FT                   EAFTGKREMSGKAMADYFAPLKKWLDEQNKGKPQGW"
FT   sig_peptide     467931..467999
FT                   /locus_tag="Sala_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.664 at
FT                   residue 23"
FT   gene            complement(470045..470326)
FT                   /locus_tag="Sala_0457"
FT   CDS_pept        complement(470045..470326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0457"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52178"
FT                   /db_xref="GOA:Q1GVZ4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ4"
FT                   /protein_id="ABF52178.1"
FT                   /translation="MRRQMLDDLRDQPLTTGALCTHFADIDRCTVMQHLKVLEEAGLVI
FT                   AERRGRERWNHLNAMPIQDIHDRWIGPHAAAASARLARFKQAVEADKA"
FT   gene            470427..470909
FT                   /locus_tag="Sala_0458"
FT   CDS_pept        470427..470909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52179"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ3"
FT                   /protein_id="ABF52179.1"
FT                   /translation="MELKFRVAARIAKPIDEVFEAVADPAKLSAYFTTGGAKGRLETGA
FT                   TVTWDFHDYPGAFPVYVIEVVKDERIVLEWQASEGEAPNVEGGELADADYRTRVTMSFK
FT                   ALDDGRTLVEISEEGWRENQAALSASYGNCQGWAQMLCALKAWIEHGINLRADMYK"
FT   gene            471043..471864
FT                   /locus_tag="Sala_0459"
FT   CDS_pept        471043..471864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52180"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ2"
FT                   /protein_id="ABF52180.1"
FT                   /translation="MKRLVLTIALVAGLPAAANAATCEQSFEKKGNPVTGLRFIATTNV
FT                   PGMSAASAVGQLNGIVAAKGYDILAAEQESGTMLIEQPQTGKSRSFPIEIAADGAGNVR
FT                   MEARLRAAMGVPEAAAKAEMCGILAQLKGGKAGEALAAKGMKATTAPGAPIRMSVLRFS
FT                   QDITGEADKNSAAVPLRYKNKSFTLYGPVAYVGPVGDSYRVEWKLVSNVLTDIVPGRSS
FT                   AGMNVNCVLAKGQGPYALQLKPGKHAELTGTFDRLDYGLSLVWLKDCRPVK"
FT   sig_peptide     471043..471105
FT                   /locus_tag="Sala_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.922 at
FT                   residue 21"
FT   gene            complement(471874..472134)
FT                   /locus_tag="Sala_0460"
FT   CDS_pept        complement(471874..472134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ1"
FT                   /protein_id="ABF52181.1"
FT                   /translation="MDFDDQLRRYFGTADLDAIHPEARAAGTERMRVDFALETNPGRRF
FT                   ALWALMYMLGDAPDLDVAFKDASERDAARDFMDMVDRAGGD"
FT   gene            472246..473724
FT                   /locus_tag="Sala_0461"
FT   CDS_pept        472246..473724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0461"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52182"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVZ0"
FT                   /protein_id="ABF52182.1"
FT                   /translation="MKTSIEIGTDAAGQDVRIDVQELLATRLLVQGNSGSGKSHLLRRI
FT                   LEESAALVQQIVIDPEGDFVTLADAFSHVVINGGDYDEREIAAMGARIREHRASIVLSL
FT                   ESLDIEAQMTCAAAFLNALFDAPREHWFPALVVVDEAQMFAPSASGDVSDTVRRASLSA
FT                   MTNLMCRGRKRGLAGAIATQRLAKLAKNVAAEASNFLMGRTFLDIDMARAADLLGMERR
FT                   QAEAIRDLERGHFLGLGPAISRRPLAIRIGATRTATRMGTHSLMPLPVADGADMRSMLF
FT                   AEEEAPAAPRAVAVEPEPEPVAAGELLERIAASEPLHADAAAPPVLDIVEAAAEAEEAD
FT                   AVVIATLQAMLDDPDSGFQSEAMLFQDFSVRCRMAKLRKVPLDLAAFRRRFALAKGGVF
FT                   DPSEPRWRGALAVADRLPDDMVAPFLQIARAAMEGAPCPDDEALGRAYGSRSPGRIRRL
FT                   IDYMEKQGAIVVRADFGGRRSIGIPELGLSTEAE"
FT   gene            complement(473876..474244)
FT                   /locus_tag="Sala_0462"
FT   CDS_pept        complement(473876..474244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0462"
FT                   /product="type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52183"
FT                   /db_xref="GOA:Q1GVY9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY9"
FT                   /protein_id="ABF52183.1"
FT                   /translation="MTTPRLPLPRRHERTRVAIDVTVNGVLNFVEGRITDLSEGGARID
FT                   GASMPARSRCEIHYGGQVVYAVVMWSEVDRMGVRFPYELTHGPLYNALDRARVAALIDP
FT                   AQIFHGRRTVTFGRRGLN"
FT   gene            474351..475952
FT                   /locus_tag="Sala_0463"
FT   CDS_pept        474351..475952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0463"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52184"
FT                   /db_xref="GOA:Q1GVY8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY8"
FT                   /protein_id="ABF52184.1"
FT                   /translation="MTDLHLHPSLREAAQTSRAWPFEEARKLVKRYPEGKPGGAPVLFE
FT                   TGYGPSGLPHIGTFNEVLRTTMVRRAYETLTGGAPTRLVAFSDDMDGLRKVPDNVPNGA
FT                   MLREHLGRPLTAIPDPFGKYESFAHHNNAMLREFLDRFGFDYEFVSSTERYTSGAFDEA
FT                   LKNVLRHNQDILDIMLPTLRAERAATYSPVLPVSPKSGIVLQVPVTVVDAEAGLVSFED
FT                   EGETITHSILRGGAKLQWKVDWAMRWVALGVDYEMYGKDLTDSGVQSGKIARALGGRKP
FT                   EGLIYEMFLDEKGEKISKSKGNGLSMEEWLTYGSEESLAFYAYREPKAAKQLHIGVVPK
FT                   AVDEYLQMRGTYPAQEPDKRLGNPVHHVHVARGQDVPETVLPVTYGLLLNLVGVMGADA
FT                   SKEQIWRYLGQYVAGADAATYPELDRLIDNAMAYNRDFVAPTLQRRKPAGGEVAALREL
FT                   DARLAALPADASADDIQNIVYEIGKDEAHGFDNLRDWFRALYETLLGSSAGPRMGSFIA
FT                   LFGVENTRRLIAEALA"
FT   gene            475999..476481
FT                   /locus_tag="Sala_0464"
FT   CDS_pept        475999..476481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0464"
FT                   /product="asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52185"
FT                   /db_xref="GOA:Q1GVY7"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY7"
FT                   /protein_id="ABF52185.1"
FT                   /translation="MIDIFTTGGTIDKVYFDALSEFQIGPAAIPDMLRENNVLVPHRVT
FT                   QLMRKDSLELTDADREAIRAAVAASDAARILVTHGTDTMVVTGRVLAGIEGKTIVLTGA
FT                   MQPASVRASDAEFNVGFALAAAQTLPPGVYVAMNGMIFDPQRTVKDRAGGRFVQEG"
FT   gene            complement(476482..477513)
FT                   /locus_tag="Sala_0465"
FT   CDS_pept        complement(476482..477513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0465"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52186"
FT                   /db_xref="GOA:Q1GVY6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY6"
FT                   /protein_id="ABF52186.1"
FT                   /translation="MPAVRLFPPDRFFDRAQWSAITRPSSWRGIWLVAHAWIVSVALVG
FT                   LAAWLQNPLAWLVAVIFVGGRQLGLAILMHEGAHGALHPSRRLNNFLGQWLAGAAVGSD
FT                   LIAYRTYHLQHHKYTQQPEDPDLALSKPFPTTRASLWRKVVRDLSGQTFVKQRMAQFGF
FT                   ALVGLKAMLRGEAVQKVGASTRAGTPFNKQSDDGMTSPTIDVAGAMAVTRAVGRFLLVQ
FT                   AVLLGASLALYGWTPYLLWLAGLATTFQLYLRIRNIAEHACTTTGSDDPFTHARTTHAG
FT                   WLARATVAPYWVNYHAEHHLFMGVPCYRLPQVHAALGRAGKHDSMTIAPSYAAVLRQVT
FT                   AAG"
FT   gene            477662..480298
FT                   /locus_tag="Sala_0466"
FT   CDS_pept        477662..480298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0466"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52187"
FT                   /db_xref="GOA:Q1GVY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY5"
FT                   /protein_id="ABF52187.1"
FT                   /translation="MGVRRNIIRSSRDDFAVHESPFDSPEFVAQLLRVATLWHYVLIGR
FT                   LLAFAVFSVLPGVAGFFDQPSLWLTMASGLMCDAALTVMGQAMRRPRPALAARARQVAM
FT                   LSAALVALGTLFNAAAMFAAIAMPDGGRHFDAFTAIQIGSLLVAASAVSIVRPLFFSFS
FT                   GAVAFGGALGVASWPFALAGAVFLALLIVMMREDVRHQRRATAAARRAISEQQRALNLM
FT                   RDFERAGRGWFWETDRDGQLVYISPTVAARLGRPLAELIGRPFTDIIRKRIGNDESEER
FT                   TLGFSLSSRTPFKELTVQAAAPGEERWWSISGHPISNALGHFQGFRGSGTDLTDQKRSE
FT                   REINQLARYDTLTGLANRRHITDLLERALRTHIGQPQPCALLLMDLDRFKAVNDTLGHP
FT                   VGDQLLQQVAGRLTQIVGDKGQVGRLGGDEFQIVLPQLNHPEKIAGIANAIILSLAKPF
FT                   AIEGEQVRIGSSIGIAVSDGEGVSASALVRNADLALYAAKDAGRGVYRFYADAMHNQAS
FT                   ERKAIEDALRDALAKDELRLLYQPIVDVATERISGFEALIRWNHATAGTISPEKFIPIA
FT                   EESNLIVPIGEWIIRTACAAIATLGSGYRVAVNVSPRQFANEALPATILSAVSGAGIRP
FT                   EQLELEITEGVFLDESAENLAMFRKLKRTGVRLALDDFGTGYSALGYLKKAPFDKIKID
FT                   QSFVLGAADKSSMNAAIIASIVGLASALDMETTAEGVETHDDLALVRSLGCSHVQGYIY
FT                   GQPMQLAEVVGLLRAGGGRVEARGYRSARAPRLTVFRTIHVDSGGYRYEAILRNIAPGG
FT                   ALVEGLWNVPPGTRLTLEFGRGLRVDAEARWSADNRTGVQFSAAVDIEELIGARVAPPR
FT                   GRPRRAA"
FT   gene            480514..481503
FT                   /locus_tag="Sala_0467"
FT   CDS_pept        480514..481503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0467"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52188"
FT                   /db_xref="GOA:Q1GVY4"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY4"
FT                   /protein_id="ABF52188.1"
FT                   /translation="MTAPIRDSLSGLDLRAEIDRLRKERNAVILAHYYQKPEIQDLADF
FT                   VGDSLELSRKAAETDAEVIAFCGVKFMAETAKILSPEKIVILPDMDAGCSLEDSCPPEQ
FT                   FKRFREKHPDHIALTYINCSAAVKALSDIIVTSSSAETIISQIPPEQKIIFGPDRHLGG
FT                   YMNRKFGRDMLLWPGVCIVHEAFSETELLKLKAQYPGAPVAAHPECPPHIVEHADYVGS
FT                   TSGILQFAKSFKGDTLIVATEPHIIHQMELALPEKTFIGAPGADGNCNCNICPYMALNT
FT                   MEKLYIALRDLQPRIEMDEELRLAARKSLDRMLEMASGTVGKGDLGRA"
FT   gene            complement(481594..481986)
FT                   /locus_tag="Sala_0468"
FT   CDS_pept        complement(481594..481986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52189"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY3"
FT                   /protein_id="ABF52189.1"
FT                   /translation="MVWSAPFRGPASPERPFIISSRASAETAALQKRWTAFQLPDRVRF
FT                   NSWESQRSVIEPSVAFLVKPVRSRPASLATTLDVPAVRRLCRPMIGSCHERFSTPTKKA
FT                   RKWRPKGPRLWISPALATSGFGAAFL"
FT   gene            482465..482731
FT                   /locus_tag="Sala_0469"
FT   CDS_pept        482465..482731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0469"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52190"
FT                   /db_xref="GOA:Q1GVY2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY2"
FT                   /protein_id="ABF52190.1"
FT                   /translation="MVGLIVTLIVGGIIGWLASIVMRTDAQQGIILNIVVGVVGAFLGN
FT                   FLGSFFGMGASLDSFSPIGLLWAFIGAIVLLGVINLIRRGSVR"
FT   gene            482855..483127
FT                   /locus_tag="Sala_0470"
FT   CDS_pept        482855..483127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0470"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52191"
FT                   /db_xref="GOA:Q1GVY1"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY1"
FT                   /protein_id="ABF52191.1"
FT                   /translation="MLTWIIAIVMGGIIGWLASIVMRTDAQQGIFLNIVVGCVGSILGR
FT                   FLFGRFLGGGHLRGDAFDPMTLLTAFIGAVILLAIVNLVRRGRVR"
FT   gene            483394..484608
FT                   /locus_tag="Sala_0471"
FT   CDS_pept        483394..484608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0471"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52192"
FT                   /db_xref="GOA:Q1GVY0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVY0"
FT                   /protein_id="ABF52192.1"
FT                   /translation="MPGRDFGVNYERKVDSMDSLAGTQSFYEEADDSRRKRTRLIVAVV
FT                   LIVLALAAAYYAFSSGRGAADAGGGEEATVPNITVVIPGRVSVEAVITTNGTIAARREM
FT                   PVGVAGEGGQVERVLVEPGQWVDAGQTLAVIDRSVQSQQAASLAAQIRVAQADANLAQA
FT                   ELERAEALVSRGFISKADMDRKRATRDAANARVRVAQAQYAEARARNARLNIVAPAAGL
FT                   VLTRQVEPGQIVGAGSGVLFRMARGGEMEMLAQMAEADLARVRVGTRATVTPVGTDVEI
FT                   PGQVWQVSPVINMDTRQGMVRIAIPYSSVLRPGGFADARLVSGTAELPLLPESAVQSGP
FT                   EGNYVLIVGKDNKIERKPVKVGTVSDAGVSIASGLTGNERVVTLAGAFLNVGDTVKPVL
FT                   QKSSQ"
FT   gene            484650..488066
FT                   /locus_tag="Sala_0472"
FT   CDS_pept        484650..488066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0472"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52193"
FT                   /db_xref="GOA:Q1GVX9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX9"
FT                   /protein_id="ABF52193.1"
FT                   /translation="MSFRNISAWCIRNPVPPIVLFVLLLLAGLVSFNRMDVNDNPDVEF
FT                   PAVRVVVSQPGAAPTELETQVTQRVEAAVRGVSGVDEMSSYVNEGSSITNVQFAIGTPI
FT                   DRAYNDVNQAISQIRSDLPDGILEPQVVRVDIAGGPITYFAVEATDMTLEQLSWFVDNT
FT                   VAKELLSIPGMSQVRRSGGVDREIRVILDPARMQSYGLTASQVNQQLRQVNVNAAGGRT
FT                   EIAGSEQAVRVLGNAGSAFQLGETRIAIGNGRTIRLADVAKVTDGYAEQRNLAKIGGRQ
FT                   VLSFSIEKAKGASDVTVHDETMKKLEQIKKANPKVDFTILFTRTEYTKEQYRSSMLAMI
FT                   EGAVLAVVVVFLFLRDWRATLISALAIPLSAIPTFWFMEMMGFSLNGLSLLALSLVAGV
FT                   LVDDAIVEIENIVRHMRMGKTAYQASIDAADEIGLAVVATTMSIVAVFLPVALMPGVSG
FT                   QFFIQFGMTVVFAVLMSLAVARMITPMIAAYFLSAQGEQDHANGPWIDRYERLLSWTLD
FT                   SSKQKVVKARYEAFPTRLIYFLVPAIVAGLAVAGLTFQYFQPVPAGQDAPNPALHFLLM
FT                   TPLSAIVAFLVSSLLMILGGALAYAAGMRRFALTNWAKFMLQRAYARLFDHRVWIVGIG
FT                   VAAFISSLVLFGILPQQFQPTTNSDYSQIRYELPPGSTLAQSETIADQINAILRDDPVV
FT                   ENAFYDVEVGGGNAFLTLKKDRPVTSVEWERSLQPKMAAIPDARVNFQSQSGGFSGRDI
FT                   TFVIGGDDPVALERHARQIVKEMEGLKELRAPRIEGDIPRPEIIVNPRMDLAAELGVTT
FT                   AALSQTIRIATLGDIDQNAAKFSLSDRQIPIRVLLSEDSRRSLATIENLPVPTSRGTTV
FT                   PLKAVAEIGFGAGPTELRRYNQTRRIVIGADLAPGLVTGDAQKKIDALPSIKTMPQGIR
FT                   KVVQGDAKWQAEMLTNFMIAVVSGLLLVFATLVLLYRRFLSPLVNMSSLLLAPLGGLLG
FT                   LWITGMEVSMPVFIGLLMLLGIVAKNSILLVDFAIEEMDKGIGKTAALIDAGRKRAQPI
FT                   VMTTVAMVAGMIPTAISLSGDGAWRAPMGVVVIGGLILSTVLTLLIVPAGFSLADSIEK
FT                   RLGRFFSRNLLTYRPGDDTRPHGAAAPEPAE"
FT   gene            488139..489404
FT                   /locus_tag="Sala_0473"
FT   CDS_pept        488139..489404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0473"
FT                   /product="protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52194"
FT                   /db_xref="GOA:Q1GVX8"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX8"
FT                   /protein_id="ABF52194.1"
FT                   /translation="MTNLASRRPIGVAIPAKPSSIRIVATGMLVVMAIVFVGAKTYQDA
FT                   HPAIGFVRAFAEAGLVGGLADWFAVTALFRHPMGLPIPHTAIIPRNKNRIGDTLARFLL
FT                   TNFLLPRLIARKMQAVDVAGAVGKFLSEPAEGGGRLRLGASRIIADGLGALDQQRLGGM
FT                   VKSAIADRLRELDVAPLLGQALQAALAEGRHQPLLDAMVKWGSKTLELNEHLIHQMVHD
FT                   NSNAIVRFTGLDESISNRIVAGLSKLLSEMAVDETHPLRLRVEEGLAKMALDLQHDPEV
FT                   KARVARVRDELLENKAVKRWLDGLWEQGRAALLKAARNPDTMLAGRIGELVTQFGAMLG
FT                   EDVHIKRTLNRYARRAVVGMVDSYGEAALKLVSDTIRGWDAKTITDRLENAVGDDLQYI
FT                   RINGTLVGGLVGVAIHTVDVLI"
FT   gene            complement(489401..490189)
FT                   /locus_tag="Sala_0474"
FT   CDS_pept        complement(489401..490189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0474"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52195"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX7"
FT                   /protein_id="ABF52195.1"
FT                   /translation="MARMLIFGMGYAAGHLAERLRARGWEVTGTTRDGRADSIAFGDET
FT                   AVLAALRTATHILSSVPPAGEADPVLARYGEAIALAPATWTGYLSSTGVYGDAGGAWVD
FT                   ESAPVRGRRAGRNAADAAWSALRGDMCVFRLPGIYGPGRSILDRIAEGRAHRIALPDQV
FT                   FSRIHVDDIAGGIIASFRGPAGVYNLADDEPCHQNRLVEWGCAMLGAPLPPMQSLDEAG
FT                   LSPAARAFYAENRRVANGKAKRLLGWRPRYPSFREGLASL"
FT   gene            490236..492830
FT                   /locus_tag="Sala_0475"
FT   CDS_pept        490236..492830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0475"
FT                   /product="Peptidase M1, alanyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52196"
FT                   /db_xref="GOA:Q1GVX6"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX6"
FT                   /protein_id="ABF52196.1"
FT                   /translation="MTDASSTPAIPVTIHRGDYRPPEWQVPDVALDFALGIEETRVSAA
FT                   LSVQRTTDGPAPLLLRGDGLTPAAVRVDGEVWNDWRMDGSDLIVDLGERTAAVVEIDTV
FT                   VNPAANTQLMGLYASNDMLCTQCEAEGFRRITFHPDRPDVLSRYRVRMAGDKTRFPILL
FT                   SNGNCIDRGEGDGGTHWALWEDPWPKPSYLFALVAGDLVANRDSFTTMSGRTVELGIWV
FT                   RAGDEDRTGHAMQALKNSMRWDEEVYGREYDLDLFNIVAVGDFNMGAMENKGLNIFNTR
FT                   YILADPDTATDMDYDGVEGVVAHEYFHNWSGNRVTCRDWFQLSLKEGFTVYRDQCFSAD
FT                   MGSAAVKRIEDVRLLRAAQFPEDAGPLAHPIRPDSFQEISNFYTATVYNKGAEIIRMMA
FT                   TMVGPERFRKGTDLYFERHDGEAATCEDFVRAIEDGAGIDLQQFRRWYEQAGTPRLKLS
FT                   LVEEAGQWSLDIVQTVPPTPGQPEKQPMMMPLRLAAFAMDGSGAHLADTLVTISGATQR
FT                   IALGRFAVRPALSVNRGFSAPVIVDFARAPGELAWLAAHDDDPFARYEALQQLMLDTLV
FT                   AAVSGKDRDPQTVIDAVAQTLSGRAADPAFVAEAVLLPSEAFIGDQMLTVDPDAIRRER
FT                   LALQAAIGAALESEWRAILDGAAPPATDLSRGAKGGRRLRGVALAYLAATGMDDAAALA
FT                   FRVFSQADGMTERQAALATLAHGDSDERAHALDIFYQRYRDNPLVLDKWFQVQAWSVRP
FT                   DTVDAVRALAQHPDFTLTNPNRVRALYGALTGNQAAFHQADGAGYRLIADLVIALDPKN
FT                   PQTAARMIPPLGRWKRFDERRQALMKAELERILAQPGLSRDTTEQASKSLLG"
FT   gene            complement(492990..493310)
FT                   /locus_tag="Sala_0476"
FT   CDS_pept        complement(492990..493310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0476"
FT                   /product="small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52197"
FT                   /db_xref="GOA:Q1GVX5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX5"
FT                   /protein_id="ABF52197.1"
FT                   /translation="MGWIILAIAVFTEICWALSLKWAATLGTWQASIVPIALSFLNMAL
FT                   LALAMREISAGTAYAIWTGLGAVGVIIGGTILFGEKISPMQAGFMVLIVVGVAGTKLFA
FT                   AN"
FT   gene            complement(493422..494192)
FT                   /locus_tag="Sala_0477"
FT   CDS_pept        complement(493422..494192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0477"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52198"
FT                   /db_xref="GOA:Q1GVX4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX4"
FT                   /protein_id="ABF52198.1"
FT                   /translation="MRDWGAGSPVLFLSGWALPSDFWGYQMLAVARQGYRAVAYDRRGH
FT                   GRSADPGRSYDHDTLADDLASVIDALGLGGVTVVAHSMGGTEVARHFARHGGGGIARVV
FT                   LVGTITPFLMKSPDNPAGVDPALLAEGAALLARDFPAWIEVNTPPFFTPDTSPAMIRWG
FT                   QNMMMSTSLLGAAQLAAANFATDFRPDVRQINVPTLLIHGDRDVSAPLALTAQATAALL
FT                   PQATLKVYEGAPHGLPLTHVERLNGDLIAFLTGG"
FT   gene            complement(494439..495038)
FT                   /locus_tag="Sala_0478"
FT   CDS_pept        complement(494439..495038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52199"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX3"
FT                   /protein_id="ABF52199.1"
FT                   /translation="MIRRIRTPLLALLGAATLSACFSLGGKPPPFLLTLDPDAAPATGT
FT                   ARTAADAATLTILIPTAPQKLRTTRIPVQQDDASIAYVQDAQWVEAPQRLFQRLVSETV
FT                   AARTSRVVLDEGQYLTAPGEQLAGQLMEFGVDARSNEALVVYQAMLVSAGGKTVTQRRF
FT                   ETREPIGGKVEAKPVGEALTRAANRVALDVAAWLGE"
FT   sig_peptide     complement(494958..495038)
FT                   /locus_tag="Sala_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.657 at
FT                   residue 27"
FT   gene            complement(495047..495988)
FT                   /locus_tag="Sala_0479"
FT   CDS_pept        complement(495047..495988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0479"
FT                   /product="Mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52200"
FT                   /db_xref="GOA:Q1GVX2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX2"
FT                   /protein_id="ABF52200.1"
FT                   /translation="METRSNNILVGAFVLLFTAALAFFVVWLANDSGGAKREYDIFFKQ
FT                   SVDGLNKGAQVQFSGVPSGQVREIALWPDDPQFVRVRIEVNEGVPVLQGTTAALEGVGF
FT                   TGVSQISLDGAVKGAPPITDKGPAGKPVIPTRVGGLGEILNTAPQLLQRLSTLTERLAE
FT                   LADDENQASIRGILNNVEASTAILARNGPAIERALADTRIAIQQTGIAAEQIGNLAAAA
FT                   QGTIDRNVDPAMANLRDTLKSANASMKTLEGAIADARPGLKTFSETTIPEANALIRDLR
FT                   RTSASLSSLTDKLDQQGAGAVLGGSKLPDYKE"
FT   sig_peptide     complement(495902..495988)
FT                   /locus_tag="Sala_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.571 at
FT                   residue 29"
FT   gene            complement(495988..496866)
FT                   /locus_tag="Sala_0480"
FT   CDS_pept        complement(495988..496866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0480"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52201"
FT                   /db_xref="GOA:Q1GVX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX1"
FT                   /protein_id="ABF52201.1"
FT                   /translation="MAGKQNSEIREELAAADAVRPEAFDRAICIRGLRNQFGDAVVHDG
FT                   LDLDVRSGEILGVVGGSGTGKSVLMRSIIGLQTPTAGEIEVYGKTLDTIADEEESRDLR
FT                   RRWGVMFQGGALFSTLSVAENIQVPLREFYPRLDAKLLDEIAAYKVQMVGLPPDAGPKY
FT                   PAELSGGMVKRAGLARALALDPALLFLDEPTAGLDPIGAAKFDALIRELADTMGLTVFL
FT                   ITHDLDTLYATCDRVAVLAEKRVIAVGTIPELLATQHPWIQDYFNGPRGRAAASGNQSA
FT                   KSPVLGGDRNS"
FT   gene            complement(496866..497972)
FT                   /locus_tag="Sala_0481"
FT   CDS_pept        complement(496866..497972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0481"
FT                   /product="protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52202"
FT                   /db_xref="GOA:Q1GVX0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVX0"
FT                   /protein_id="ABF52202.1"
FT                   /translation="MVARADFEHSEGADGVEVRFTGRLTLARLGDLPARLDALGPIATL
FT                   DLSAIDRIDTVGAWIVTRTAADHDARITGASADAQRLLDALASDKSEYRVHRDRRPAWV
FT                   RMLEQIGTASVAVWNELLGIVGFFGAMIVAIFNQIRARRRLRWNAIVTRFQTVGVDALP
FT                   IIGLMSFLIGIVIAQQGAVQLEQFGLEVFTINLVGRASIRELGLLMTAIMVAGRSGSAF
FT                   AAQIGTMKLTEEVDAMRTIGVSPMEAIVLPRVAASTITMPLLGFYASLCAIAGGGLFCW
FT                   VGLDIPPLTYIQRLREIIPMTDFWIMLIKAPVFGILIGVTGCYEGMQVRQNAEEVGQRT
FT                   TSAVVAAIFLVIVLDAFFAVFFSSLGWN"
FT   gene            498075..498794
FT                   /locus_tag="Sala_0482"
FT   CDS_pept        498075..498794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0482"
FT                   /product="HAD-superfamily subfamily IB, PSPase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52203"
FT                   /db_xref="GOA:Q1GVW9"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW9"
FT                   /protein_id="ABF52203.1"
FT                   /translation="MEEPLATPTPGYAHRVAIYDMDRTITHSGTYSGFLIHVALRRQPW
FT                   RLLLLPLIGLAGAAYALRLIDRARLKAINLRLLVGKRFSRAEIAPLAESYADKVVACGV
FT                   HPAALEQIAADRAAGYRLLLATASFHLYVDAIARRLGIDDVLATRLDEPDGADHIHARL
FT                   SGDNCYGDAKFARISGWLTDNAITREDAHIRAYSDHVSDHPMLRFADEAVATTPSRGLK
FT                   RLAPRMGWQVVDWRARK"
FT   gene            complement(499052..500344)
FT                   /locus_tag="Sala_0483"
FT   CDS_pept        complement(499052..500344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0483"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52204"
FT                   /db_xref="GOA:Q1GVW8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW8"
FT                   /protein_id="ABF52204.1"
FT                   /translation="MAMRGKPKTNSKKIGDRELSPATLMMGLGYDPVLSEGSLKPPIFL
FT                   TSTFAFESAAAGKRFFEHITGKREGPADGLVYSRFNGPNQEILEDRLAVWDGADDSLVF
FT                   SSGMSAIATLLLALVGQNDVIVHSGPLYAATETLIARILSRFGVSFVDFPAGASRDDID
FT                   VILARAQALASQKGGKVALVYLESPANPTNALVDVEAVRAARDTAFPGEQKPAIAIDNT
FT                   FLGPLWQQPLKQGAELVIYSLTKYAGGHSDLVAGGVSGDQRLLDIIRPMRNTIGTICDP
FT                   NTAWMLLRSLETLELRMRRAGENALKVCTFLRDHPKVEGLGYLGFISDARQKDIFDRHC
FT                   TGAGSTFSLFIKGGEAESFRFLDALQIAKLAVSLGGTETLASHPAAMTHLSVPDERKKA
FT                   LGITDNLVRVSIGIEDPDDLIADFAQALDAV"
FT   gene            complement(500415..501821)
FT                   /locus_tag="Sala_0484"
FT   CDS_pept        complement(500415..501821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0484"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52205"
FT                   /db_xref="GOA:Q1GVW7"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW7"
FT                   /protein_id="ABF52205.1"
FT                   /translation="MTRTRWLGLIGGLVVFCTMLLAPAPAGMELTAWRIAALTVLMAIW
FT                   WMTEALPLTVTALLPFLTVPTFGVMDANAIAKEYYSPILFLILGGAFLALAIERVGLHR
FT                   RLALALLKRASPTASGLLFAFMAATALLSMFISNTSTTLIMIPIALAVVRAGGVREGET
FT                   NGFAGAVMMGIAFAASLGGLGTLVGSPTNAIAAGLIEKALDLRIAFLDWAIYGVPVVIL
FT                   SVPVAMFAVARVQRLADHPFDGRAAAAALGNQAIWSTAERRVVPIFLAVLAAWIAQPWL
FT                   EPFLPDGALTDGTIAVAGSLLLFVLPDGTGRPLLIWKEADRAPWGVIMMFGGGLALAAA
FT                   ITASGLAAWLGAVLAPLGSIPTIALAAIIVALTILVTEFASNVATASGIMPVLAALIAA
FT                   TGADPILLALPVAMAASWGFMLPSGTGPNALAWATGHIALPRILKAGFALDIIGVPLLI
FT                   GVIWAIAAIA"
FT   sig_peptide     complement(501738..501821)
FT                   /locus_tag="Sala_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.781 at
FT                   residue 28"
FT   gene            complement(501941..502702)
FT                   /locus_tag="Sala_0485"
FT   CDS_pept        complement(501941..502702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0485"
FT                   /product="protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52206"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW6"
FT                   /protein_id="ABF52206.1"
FT                   /translation="MNAPFVTAPTLDGIAHGFFGRRGGVSTGDLASLNCGLGSGDDPAL
FT                   IAENRRRVADAVLPGAALTGLYQVHGNRCIIVDERTDLAARPEADAMATRTPGLLLGIL
FT                   TADCVPVLFADREAGVIGAAHAGWKGALAGVTDATLAAMESLGARRATIAAAVGPCIGR
FT                   ASYEVDDGFVERFVADDPANERFFAAAKPGHAMFDIAAYVAARLAAAGVARIAIGGQDT
FT                   YALPQDYFSYRRACHKGENSYGRQLSVIGLR"
FT   gene            complement(502699..503217)
FT                   /locus_tag="Sala_0486"
FT   CDS_pept        complement(502699..503217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0486"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52207"
FT                   /db_xref="GOA:Q1GVW5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW5"
FT                   /protein_id="ABF52207.1"
FT                   /translation="MSAIQLAEPADAEAISAFAEASFKDTFAHLYDPADLAAFLADWNP
FT                   PARVRAQIADPDHGIALVRGEGGAILGFIKMGPVDFDLPPDQPTDDAVELHQLYVAEAA
FT                   KGTGVAAALMDWGIAWARARASILYLSVFVENNRAQAFYRRYGFVDVGRNAFRVGNHID
FT                   EDRFFRLDL"
FT   gene            complement(503214..504284)
FT                   /locus_tag="Sala_0487"
FT   CDS_pept        complement(503214..504284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0487"
FT                   /product="protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52208"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW4"
FT                   /protein_id="ABF52208.1"
FT                   /translation="MPLREAPPTPRQLINDIAAARPVTVADYMAAANAHYYATRDPLGA
FT                   AGDFTTAPEISQMFGEMVGIWIADLWTRAGNPAFRYVELGPGRGTLAADALRTMARFGC
FT                   EPVGIHLVETSPALRAAQLARLPAAQHHDEVDALPGDAPLLIVANEFFDALPIHQYVRT
FT                   ADGWRERMVGRAGDARMAVAGDVSADEAIPAALRGAAEGTIVETMPVAAAIMQRCAFRL
FT                   SRQGGAMLAIDYGYTGPAAGDTLQAVKAHGFADPFADPGEADLTAHVDFAALADAARSG
FT                   GVAVAGPSPQGAWLRRMGIDARLASLVAAAPARADELQGRRDRLVNADAMGELFKAIAF
FT                   TAPNWPTPAGFTGDPL"
FT   gene            complement(504271..505146)
FT                   /locus_tag="Sala_0488"
FT   CDS_pept        complement(504271..505146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0488"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52209"
FT                   /db_xref="GOA:Q1GVW3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW3"
FT                   /protein_id="ABF52209.1"
FT                   /translation="MFLFATLAEATQYLNFEDMMGPNSEIAFSVFGLPIRWYALAYLAG
FT                   IFVGYWYLLKLIGRPGAPMARRHADDMIFYAMLGIILGGRLGYVLFYNLGAYIEDPLAV
FT                   FKLWDGGMSLHGGVVGVLVAIWYVTRKDQLSFLRFCDYIACVVPFGLFFGRLANFVNGE
FT                   LWGRATTVPWAIIFPDSGTMDPRHPSQLYEAGLEGLLMMAILAFFFWRTDARYKPGFLF
FT                   GTAAIVYGLSRFAVEFVREPDAQLGTLPWGLTMGQTLTIPMLLAGIWLVATAKGRRQRI
FT                   EPIAGPDAVA"
FT   gene            505224..506933
FT                   /locus_tag="Sala_0489"
FT   CDS_pept        505224..506933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0489"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52210"
FT                   /db_xref="GOA:Q1GVW2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW2"
FT                   /protein_id="ABF52210.1"
FT                   /translation="MPSALDLRLEAAYNLITGPGGPIQVGSVERFGRQLPFITNAPTNL
FT                   ADYVAYFAMQHGDATFLVEGDERLSFKQVYMAARQVAAGLIEGFGVERGDRVGLAMRNA
FT                   NAWCVAYIGILMAGGCATLLNGWWQGGELAAGIENSEAKLVIADPQRAARLAEPGVEHG
FT                   AKVVTLDITRPIDEAIAPIASKGSAATVLPTLTGQDLATILFTSGSTGQSKGAYSRHEA
FT                   VVQAIFNYVTQTATIVHLLTEDGQMSDIQPATLICTPLFHVTAEIPVFLQSFALGRKLV
FT                   LMPKWNAEEAMRLIQDEQVNYFVGVPLMSYEILTHPNRKNYDLSTCKSYAGGGAPRPPE
FT                   HVKRLATEMGEAKPLLGYGLTETNAVGCGIINENYVAKPLSTGPASKPLVDLAILDDNG
FT                   DPVPQGGIGEVCIRSVANFEGYWNNEAATRAAFFDNGYFRTGDLGYLDEDGYLFIVDRK
FT                   KDIIIRGGENISCQEVEAAIYEHPETNECAVFGLPDERLGEVVGAVIWMKPGSGVTADA
FT                   MCSFLSARLAPYKVPYKIWMSNEALPKLGSEKIDKVSLRSQYREAYAAEVVA"
FT   gene            506982..507839
FT                   /locus_tag="Sala_0490"
FT   CDS_pept        506982..507839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52211"
FT                   /db_xref="GOA:Q1GVW1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW1"
FT                   /protein_id="ABF52211.1"
FT                   /translation="MRGWEGVLETMTDLAPAPPPTRVYRHRLPTRIWHWVNAVTLLILL
FT                   MSGLMIFNAHPRLYWGQYGANADYAWFAIGSTADTGYVRIGAARVETTGLLGRWTDAEG
FT                   VEKTWAFPGWATIPTSYSLADGRRWHLLFAWVLAISLTLYMLWTALGGHLKKDLHVRRD
FT                   EWSPRHIWHEIKDHARLRFPTGAAAARYNILQKLSYIGIIFILLPLMIATGLTMSPGIN
FT                   AAAPWLLDLFGGRQSARSIHFIGAWALVAFFLVHIVMVMLAGPVNELRSMVTGWFRLPA
FT                   EKAK"
FT   gene            507836..508606
FT                   /locus_tag="Sala_0491"
FT   CDS_pept        507836..508606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0491"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52212"
FT                   /db_xref="GOA:Q1GVW0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVW0"
FT                   /protein_id="ABF52212.1"
FT                   /translation="MSGVMMPRRELIVRAGGLAAALPLLGACDAINDAPAVRRILSMGE
FT                   EMNRASQRALIDREALAREFTRADLSPVFRSNGTRLPPGAAYAAHAAGGFADWRVAVTG
FT                   LVTRPLSLSMADIRAMPQRTQITRHDCVEGWSAIGEWTGPQLRRILAAAGVKDRARYIV
FT                   FRCADRLGETLYYESCDMIDALHPQTILAWALNREVLPIANGAPLRLRLERQLGYKHAK
FT                   YVTAIEAVASLDGIGAGKGGYWEDRIDYEWYAGI"
FT   gene            508634..509920
FT                   /locus_tag="Sala_0492"
FT   CDS_pept        508634..509920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0492"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52213"
FT                   /db_xref="GOA:Q1GVV9"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV9"
FT                   /protein_id="ABF52213.1"
FT                   /translation="MLPEMSILRPFLSRIVRKGCLTVIAPDGSRETFGEVAPGYPDVTL
FT                   RFTSRRGMRRILLDPRLGAAEAFMDGEMELVQGDIMDLIGLIRMNTPWDRGAKLKDKGW
FT                   FGRRADGLKTRLGSINRRRRSRANVKHHYDIGNDLYRLFLDDDMQYSCAYWPRENMTLE
FT                   EAQAAKKAHIAAKLALAPGQRILDIGCGWGGMAITLAQLEAVEVLGITLSEEQLVLARE
FT                   RAAAAGVADRVTFELIDYRDLAAREAGRFDRIVSVGMFEHVGATNFETFFRAAANLMTA
FT                   DGVMLLHTIGRFGRPGATDAFTRKYIFPGGYIPALSETLAASEKSRLIATDIETLRLHY
FT                   ALTLRQWYARTLAHESEIVQMMGDRFFRMWCFYLAGATAAFEYGGMGNYQIQFARNRHA
FT                   LPLTRDYMAAAEADYLRLVSRSSFGPSPG"
FT   gene            complement(509925..510362)
FT                   /locus_tag="Sala_0493"
FT   CDS_pept        complement(509925..510362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52214"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV8"
FT                   /protein_id="ABF52214.1"
FT                   /translation="MAKAELKTKATEVSVADFIAAVPDARRREEAAVVDAIHRRVTGHE
FT                   PKMWGPSIIGYGSYDYVYESGRSGTFCRAGFSPRKAAMTIYLMGRYCDRQKDADALFAR
FT                   LGKHRTGKSCLYINKLADVDLDVLEQLVALSWDAMNERYPD"
FT   gene            complement(510391..512457)
FT                   /locus_tag="Sala_0494"
FT   CDS_pept        complement(510391..512457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52215"
FT                   /db_xref="GOA:Q1GVV7"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV7"
FT                   /protein_id="ABF52215.1"
FT                   /translation="MRLTLAFVSVAAATFALSSPAAAEEGMWTFDAVPTDAIKAAYGWA
FT                   PDQKWLDHTRAAAVRLTGGCSASFVSNEGLILTNHHCVVGCLQNLSSADSDLVAGGFNA
FT                   ADRARELKCPGQQAEVVTAITDVTGSIRAAIGSLTGEALVKARDARIAEIESAECPDRD
FT                   TTRCQVVTLFGGGQYKLYKYRKYSDVRIAWAPEFQAAFFGGDPDNFNFPRYAMDAAFLR
FT                   AYENGKPAATPAHLKWNPRAPQEGEITFVVGNPGSTQRLLTETQRAFQRTERLPLTLLL
FT                   LSEYRGRLIASMDESPEKAREGADELFGIENSFKALSGQFRALNDPAFTAQMAAAEAEL
FT                   REKVRGNAEIGDPWSEIDAAMAKRRDTYLDSVFLERGPASFSTLAGYAQTLVRAAEERA
FT                   KPNSERLPGFTDSALPLTEKRLTDPVPTYPWLEELAVAFWASKAREYLGTDNDDIKALL
FT                   GKESPEALAKRLVTGTRLADPAYRQQLWDGGAAAIAASDDPMIRFFARLDPRSREIKAA
FT                   FDRDYDAPVTAAQARLAKARFAAYGDALYPDATFTLRLSYGQVKGWTERGKPVPAMTRI
FT                   GGTYDRATGQLPYKLAEAFVTAESRIDKNGVYDFVTTNDIIGGNSGSPVIARDGSVIGT
FT                   AFDGNIHSLGGNFGYDGTLNRTVAVSTAAIQQALDVIWPAPALAAELKGGKRR"
FT   sig_peptide     complement(512386..512457)
FT                   /locus_tag="Sala_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            512621..513838
FT                   /locus_tag="Sala_0495"
FT   CDS_pept        512621..513838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0495"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52216"
FT                   /db_xref="GOA:Q1GVV6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVV6"
FT                   /protein_id="ABF52216.1"
FT                   /translation="MSDSIKRVVLAYSGGLDTSVILKWLQVTYGCEVVTFTADLGQGEE
FT                   LEPARAKAELMGIKPEHIYIDDLREEFVRDFVFPMMRANARYEGDYLLGTSIARPLISK
FT                   RLVEIARETGADAVAHGATGKGNDQVRFELSAYALNPDIKVIAPWREWDLTSRTALIAW
FT                   AEQHQIPVPKDKRGESPFSTDANLLHTSSEGKVLEDPWEETPDYVYSRTVNPEDAPDTP
FT                   EYITIDFERGDGVALNGQAMSPATLLAALNDLGRKHGIGRLDLVENRFVGMKSRGMYET
FT                   PGGEIYARAHRGIESITLDRGAAHLKDELMPKYAELIYNGFWFAPEREMLQAAIDHSQA
FT                   NVTGTVRLKLYKGNASVVGRKSPFSLYSERHVTFEDDAGAYDQKDAAGFIRLNALRLKL
FT                   LARQGR"
FT   gene            513849..514859
FT                   /locus_tag="Sala_0496"
FT   CDS_pept        513849..514859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0496"
FT                   /product="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52217"
FT                   /db_xref="GOA:Q1GVV5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV5"
FT                   /protein_id="ABF52217.1"
FT                   /translation="MTATRFFSDNAAAVHPAVMEALVAANHVDTAYDGDALSQSLDAAF
FT                   SDLFETDCEVVWVSTGTAANSIILAHFVRPWQGILCYEEAHIEVDECGAPTFYSGGATL
FT                   MPLPGRGAKIDTAALKARIAGIRQDVHQVQPAAVSITNATEYGLAWRPQEIGEISEIAR
FT                   RKGLKLHMDGARFANAVAFLGCAPADVTWRAGVDALSFGFTKNGAMMAEAIVFFGGSGG
FT                   AGVRELKKRGGHLLSKGRFVAAQIRAMLKDDLWLANARAANAGAAKLAAACGSRLLYPV
FT                   EANELFVRLSNDEAAKLRGAGFDFYDWGEGAARLVVSWDQDAEAVAPLAAAIGAL"
FT   gene            514856..515815
FT                   /locus_tag="Sala_0497"
FT   CDS_pept        514856..515815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0497"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52218"
FT                   /db_xref="GOA:Q1GVV4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV4"
FT                   /protein_id="ABF52218.1"
FT                   /translation="MSAAPTTLLSPRVLLPFLLVTLIWGSTWIVIKGQLGVVPPSWSVT
FT                   YRFAIAAAAMFAFALIRGERLRLDKRAMLFAAALGVAQFALNFNFVYRAEQHITSGLVA
FT                   VLFALLIVPNTLMGRAFLKTPLEGRFLLGAGIAIVGVGLMILHEYRAAALGAGEVLLGT
FT                   ALTLAGVMSASIANVMQGTAIARAQSMVVMIGWAMLFGALADGAWAWITTGPPVVEPTA
FT                   VYLGGVLYLGVVASAVTFPLYFNVIRAVGPGQAAWSSVLIPIIAMGFSTAFEDYRWAML
FT                   SVAGGIVALIGLVIAVARRPERPSVSGNMVSLPVDSDG"
FT   gene            515862..517142
FT                   /locus_tag="Sala_0498"
FT   CDS_pept        515862..517142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52219"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV3"
FT                   /protein_id="ABF52219.1"
FT                   /translation="MIRKLLVFAVAATLAQPAFAQPFCQAGAYRGADGDFVALAKSTVN
FT                   PAGGLRYLFRDGRRGSTGDADAPLDCAPDGVRIGKGAEAETWARIALRETPATFDSAGS
FT                   KLSGMLIEPPGSDPQRPLVVMVHGSERTSPIGGIYGYAMAAQGLSVFVYDKRGTGASEG
FT                   EYTQNFELLARDAAAALGQARAMLPGHAGRAGFFGGSQGGWVAPLAATLTPADFVAVGF
FT                   GLVASPIEEDREQMISEVRAAGLGADAEALVNRLSAATARLLLSNFKDGYVELDAARAA
FT                   LADKPWATQIRGEHSGMMLRMSNAELRRIGRARFDNLELIWDYDAVAALRRLRTPLLWV
FT                   LAGEDREAPIETTRAALAELRAAGQPIDVYLFPGTDHGMIEFTTGPDGKRSYTRITDGY
FT                   LKLLGDWMKGEARGTYGRAETLTPTPR"
FT   sig_peptide     515862..515924
FT                   /locus_tag="Sala_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(517129..518412)
FT                   /locus_tag="Sala_0499"
FT   CDS_pept        complement(517129..518412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0499"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52220"
FT                   /db_xref="GOA:Q1GVV2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVV2"
FT                   /protein_id="ABF52220.1"
FT                   /translation="MDQIVIRGGQRLKGRIPISGAKNAALTLLPCALLTDEPLTLRNLP
FT                   RLADVDGFGHLLNQLGCSTTIEGSRPEDFGRVMTARATTLTSTVAPYDIVRKMRASILV
FT                   LGPLLARAGEATVSLPGGCAIGNRPIDLHLKALEAFGAEIELASGYVKAVAAGGRLAGG
FT                   RFTFPVVSVGATENAVMAAVLAKGTCVLENAAREPEIVDLCNCLVAMGAHIEGIGTETL
FT                   TIEGVDRLHGATYRVMADRIEAGSYACAAVITEGDVELVGAKASEMEATLAALREAGAT
FT                   VEETKGGIRVAMAGRAQPVTLSTAPYPGFATDMQAQFMAMATLGTGASLFTETIFENRY
FT                   MHVPELARMGCDIQVKGRTAVVRGVDRLIGAPVMATDLRASMSLIIAGLAAEGTTEVNR
FT                   VYHLDRGYERLEEKLQAVGADIERISAG"
FT   gene            complement(518704..519309)
FT                   /locus_tag="Sala_0500"
FT   CDS_pept        complement(518704..519309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0500"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52221"
FT                   /db_xref="GOA:Q1GVV1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV1"
FT                   /protein_id="ABF52221.1"
FT                   /translation="MVTKSLELIFDFGSPNAYLAMKALPDLLDRTGADLVITPCLLGGI
FT                   FKATGNKAPMVQYADAPAKLAYENLEMRRFIARHGLTRFRLNPHFPVNTLLIMRGAIVA
FT                   EDEGLLDDYVDAVNRAMWEEGLKMDDAEVVTSFLSANGFDGPALLARTQEPDIKARLVQ
FT                   NTEAAVARGVFGIPTFFVGDEMFFGKDRLGQVEEALLG"
FT   gene            complement(519303..520034)
FT                   /locus_tag="Sala_0501"
FT   CDS_pept        complement(519303..520034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0501"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52222"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVV0"
FT                   /protein_id="ABF52222.1"
FT                   /translation="MSHPAAVIIGAGDATGGAIARAFAAAGLTACVNRRARNADQLEAL
FT                   AQSIRDAGHKARAFPADARDENAMIELFDTVEAEVGPVEVAVFNIGANVNFPIAETTLR
FT                   VYTKVWEMACLGGFLMGREAAKRMAPRGRGTIIFTGATASLRGGSGYAAFSGAKGALRM
FT                   LAQSMARELGPRGIHVAHTVIDGAIDTDFIRGRHPDFDNARAQDLILNPEAIAANYVTL
FT                   HKQPKSAWTHELDLRPWGETW"
FT   gene            520101..520604
FT                   /locus_tag="Sala_0502"
FT   CDS_pept        520101..520604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0502"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52223"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU9"
FT                   /protein_id="ABF52223.1"
FT                   /translation="MIGTMPKRADLSDTFCPVGRSAELLGDRAVLLILRDLFFGRRRFE
FT                   AIATNTRLGPQLVSARLKLLEREGVVERHAYQQRPPRHEYRLTAKGKDLFDVLYAMRNW
FT                   AERWAYDEGETGSGPAVRYSHRTCGADVGTSTVCPGCGELLRYGDLKGELSAALRAEQA
FT                   ARGA"
FT   gene            complement(520607..520972)
FT                   /locus_tag="Sala_0503"
FT   CDS_pept        complement(520607..520972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0503"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52224"
FT                   /db_xref="GOA:Q1GVU8"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU8"
FT                   /protein_id="ABF52224.1"
FT                   /translation="MMLPASSPHMVRAMADKDDDATGTPGVGIATRTRAKPKKPSMYKV
FT                   LLLNDDYTPMEFVVMVLQRFFNMDIERATQVMLHVHQQGVGVCGVFSYEVAETKVNQVM
FT                   DAARQNQHPLQCTLEKA"
FT   gene            complement(521166..521912)
FT                   /locus_tag="Sala_0504"
FT   CDS_pept        complement(521166..521912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0504"
FT                   /product="Phasin"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52225"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU7"
FT                   /protein_id="ABF52225.1"
FT                   /translation="MATKMDSAEKAFEAATLETAAKPVATPAVPAPTAAPAVAPAVAPT
FT                   KTKPVKAKAKPVAKKAAAPKAAATKAAPAKAAVKKTAPKAAPKSVAATASKGFKTMNDT
FT                   VKKIAEDAKVRAEALTADFNEKAKEAMAKTSKLAEEAVEFNKANLEALVESGKIAAKGM
FT                   ETLGQEGVAFARKSFEDTTAALKGYTAVKSPTEFFKLYAENSKKAFDAAVAQTSKTSEL
FT                   VVKLTNDSFAPISNRVSVITSKMKAA"
FT   gene            complement(522038..523810)
FT                   /locus_tag="Sala_0505"
FT   CDS_pept        complement(522038..523810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0505"
FT                   /product="Poly(R)-hydroxyalkanoic acid synthase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52226"
FT                   /db_xref="GOA:Q1GVU6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU6"
FT                   /protein_id="ABF52226.1"
FT                   /translation="MTDMGEDKSSGAANPFMPSPDDVQHWTSVMGRAQQMMLDYVLGQA
FT                   NQRNSAAANLFDPASWLQNPTTQLWAEQSTKMWEQGAAFWASLATLQPSLTPDADARQD
FT                   KRFADPDWTTNPVFALIRQTYGLLAEQLLATTRNMQGIDEQARAKLEFAAKNMAEALSP
FT                   SNLAITNPEVIKRAVETRGESLLKGLGHMLSDLSRGQLSHVDPDAFEVGVNIATTPGKV
FT                   IHETDLYQLIQYDPATKDVFAVPLVIFPPWINRFYILDLNPQKSFVKWATEQGLTVFMV
FT                   SWKSADASMSEIVWDDYVSAQVDAIDTVRDLLDVPHVHTIGYCVAGTTLAATLAMLAAR
FT                   GEADGVKSATFLTAQVDFELAGDLKLFVDDAYLALLQQLSAPGYLDGRYMAATFNSLRG
FT                   RDLIWNYVVNNYLLGNDYPPFDLLYWNGDTTNLPAKWHRQYLTELYRDNRMVIPNSLSV
FT                   CGTPIDLRKIATPAYIQAGREDHIAPAASVWRMMHHLSGPRTFLLAGSGHIAGVVNPPA
FT                   AGKYQYWTGDNDAVTLDDFIAGATETKGSWWPHWAGWIAAQDDKKVPAKGARIPGKGRR
FT                   KAIEDAPGRYVKQR"
FT   gene            523927..525147
FT                   /locus_tag="Sala_0506"
FT   CDS_pept        523927..525147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0506"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52227"
FT                   /db_xref="GOA:Q1GVU5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU5"
FT                   /protein_id="ABF52227.1"
FT                   /translation="MSDDEFYRIKRLPPYVIAEVNAMRAAARAAGEDIIDLGMGNPDLP
FT                   PPDHVIDKLCEVARKPDAHGYSQSKGIPGLRRAQANYYGRRFNVDLDPESEVVVTMGSK
FT                   EGLASLATAITGPGDVVLAPNPSYPIHTFGFIIAGATIRSVPTTPDENYWRALDRAMAF
FT                   TVPRPSILVVNYPSNPTAEAVDLAFYERLVAWAKENKVWVLSDLAYSELYYDGNPTPSI
FT                   LQVPGAKDVAIEFTSMSKTYSMAGWRMGFAVGNKRLIAAMTRVKSYLDYGAFTPIQAAA
FT                   CAALNGPQDIVEKNRQLYQKRRDVMVESFGRAGWDIPSPPASMFAWAPLPPALREMGSL
FT                   EFSKQLLTHAKVAVAPGVGYGEDGEGFVRIAMVENEQRIRQAARNIRKFLAMHGVNTPS
FT                   IAAGGAG"
FT   gene            525148..525630
FT                   /locus_tag="Sala_0507"
FT   CDS_pept        525148..525630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52228"
FT                   /db_xref="GOA:Q1GVU4"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU4"
FT                   /protein_id="ABF52228.1"
FT                   /translation="MSLDASAIAQTIQLSVTPVFLLVATGSLLNVIAGRLARVVDRSRV
FT                   LMERWPETEGAEHDRIVAELRVADRRMAVINNSILAAVAGGIVVCLLVALLFTQAFTGA
FT                   NLAVAASWAFAAAMLLLLVSLILFLIEVRLAIRTIRVPMDLLEIEEIGWNKRRDRR"
FT   gene            525790..527106
FT                   /locus_tag="Sala_0508"
FT   CDS_pept        525790..527106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0508"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52229"
FT                   /db_xref="GOA:Q1GVU3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU3"
FT                   /protein_id="ABF52229.1"
FT                   /translation="MNEKPALAAGLGSAPVDSAAAQTRTMLWILLIVYIFNFLDRQIVN
FT                   ILAEPIKADLGLSDTELGLLAGPAFAVFYALLGIPIARYADKDGTNRVRLIAAALAIWS
FT                   AMTAVCGLAQNFVQLLLARIGVGVGEAGCTPAAHSLITDSVPPEKRSSAIAFYGMGVPI
FT                   GSLLGLIIGGIVNDLYGWRIALMLVGAPGLLLALIVLFVMREPRHRRTAEAAASAAAVV
FT                   RLSTGEAMREIFTSRAFLYILIAASVTAFLGYGKALWTISYFIRSHGLSTTEAGLSMAV
FT                   VLGLAGVFGTWLGGKMADMFGKRDRKHILTFPAYGMAVAAPILFLGYYMENWLVAVALL
FT                   IVPTILNSAYYGPAYGCVQGLVRPQARAVAASIMLFGQNLIGLGFGPFLFGVLSDLLAP
FT                   AYGQESVRYVLYGAAWLGLIPAFFFWRASLRLKAELKSG"
FT   sig_peptide     525790..525849
FT                   /locus_tag="Sala_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.468 at
FT                   residue 20"
FT   gene            complement(527209..527799)
FT                   /locus_tag="Sala_0509"
FT   CDS_pept        complement(527209..527799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0509"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52230"
FT                   /db_xref="GOA:Q1GVU2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU2"
FT                   /protein_id="ABF52230.1"
FT                   /translation="MTRTILVLYGSYRRDRQGIKLANWLVDAFGARGDTAELIDARAAG
FT                   LPMLDRMYKEYAKGEAPPAMAELAHKIRAADGFVFVTGEYNWGPQPGLKNLTDHYLEEW
FT                   FWRPAAIACYSAGPFAGVRAMMGWRDILGEMGMAVISSILTVGRIGHAFDGDGKPTGDD
FT                   GVRLEKAFPRFADDLNWWIDAAKAQRERQAPPY"
FT   gene            complement(527847..529136)
FT                   /locus_tag="Sala_0510"
FT   CDS_pept        complement(527847..529136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0510"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52231"
FT                   /db_xref="GOA:Q1GVU1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVU1"
FT                   /protein_id="ABF52231.1"
FT                   /translation="MANVTVIGSQWGDEGKGKIVDWLASRADAVVRFQGGHNAGHTLVV
FT                   GEQVYKLSLLPSGIVTGTLSIIGNGVVLDPWALRDEITKLRGQGVEINADNFAIADNCA
FT                   LILPFHRDLDALRETAAGAGKIGTTGRGIGPAYEDKVGRRAIRVCDLAHLDHLEPQLDR
FT                   LTAHHDALRAGFGEPPIDRDKLVADLREIADYVLEYAQPVWKRLKKVRKAGARILFEGA
FT                   QGVLLDIDHGTYPFVTSSNTVSGTAASGSGLGPGAVGFVLGIAKAYTTRVGSGPFPTEL
FT                   EDETGQRLGERGHEFGTVTGRKRRCGWFDAVLVRQSCAVSGVTGIALTKLDVLDGFDTI
FT                   RICTGYRLRGKILDYFPAHAADQAAVEPIYEEMDGWHESTAGARSYADLPAQAIKYIQR
FT                   VQELIETPIALVSTSPEREDTILIRDPFSD"
FT   gene            529271..530215
FT                   /locus_tag="Sala_0511"
FT   CDS_pept        529271..530215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0511"
FT                   /product="LipQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52232"
FT                   /db_xref="GOA:Q1GVU0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVU0"
FT                   /protein_id="ABF52232.1"
FT                   /translation="MNGRRWIGWLGLLAFVIGSGGIPGPLADARERLRDRIGARLAEHM
FT                   GADNAPKAPGSETISYGRDPLQALDLWRAKSAKGPAPLIVFVHGGGWKRGDKDNATGRF
FT                   KAVHYPEQGYAFASINYRLVPAATVEQQAADVAGAVKALIDRADSLGIDRRRIVLMGHS
FT                   AGAHLVALVGTDQRYLRGAGLSFADIAGVIPIDGAAYDVAAQMQDGPPIMQKTYRQAFG
FT                   SDPVRQKALSPTQQAAAPNAREFLLLYVQRADGVRQAKALGAALEKGGSRVEHGSFPGE
FT                   GLKGHAEINRSLGDPAYAPTGFVDDWLRRVFAR"
FT   sig_peptide     529271..529354
FT                   /locus_tag="Sala_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.764) with cleavage site probability 0.516 at
FT                   residue 28"
FT   gene            complement(530372..531061)
FT                   /locus_tag="Sala_0512"
FT   CDS_pept        complement(530372..531061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0512"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52233"
FT                   /db_xref="GOA:Q1GVT9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT9"
FT                   /protein_id="ABF52233.1"
FT                   /translation="MDHPIFARWPAKYPDRLQLFSAPTPNGVKAGIMLEETGLSYEPHR
FT                   IDIMANESHDPAFLALNPNGKIPAIYDPQGPGGKPLALFESGAILIYLADKSGQFLSPD
FT                   PAARYETIQWVMWQMGGVGPMFGQLGFFHKFAGREYADKRPRDRYAAESARLLGVLDDR
FT                   LAARPWVMGADYSIADISLLGWVRNLIGFYDAAEIVGFERFARVQRWLDAGLARPGVQR
FT                   GLEVTAG"
FT   gene            complement(531064..531351)
FT                   /locus_tag="Sala_0513"
FT   CDS_pept        complement(531064..531351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0513"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52234"
FT                   /db_xref="GOA:Q1GVT8"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT8"
FT                   /protein_id="ABF52234.1"
FT                   /translation="MDDQLSRYRQSIDNIDAALVYMLAERFKVTKAVGELKAREGLPPA
FT                   DPGREERQIERLRALARDADLDPEFSEKFLRFIIDEVIRHHQQAKREQGA"
FT   gene            531457..532470
FT                   /locus_tag="Sala_0514"
FT   CDS_pept        531457..532470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0514"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52235"
FT                   /db_xref="GOA:Q1GVT7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT7"
FT                   /protein_id="ABF52235.1"
FT                   /translation="MTAEIHQLRGTVPPSLDPMMTLVAADMNEVNAVILDRMQSEVPLI
FT                   PELAGHLIAGGGKRMRPMLTLACGRLLDYPGRRHCKLAAAVEFIHTATLLHDDVVDKSD
FT                   LRRGRKTANVIWGNSASVLVGDFLFSRAFEVMVEDGSLKVLKILSRASAVIAEGEVNQL
FT                   SAQRRIETSEDQYLAIINAKTAELFAAACKIAAVVAERDEATEAALDAYGRNLGIAFQL
FT                   VDDAIDYVSDAETMGKGVGDDFRDGKVTLPVILAYARGSAEERDFWKQAITGHKTSDED
FT                   LVYATSLLRKHDTIADTLARARHYGQRAVDAIGGFRASQAKSALTEAVAFAVARAY"
FT   gene            532490..532867
FT                   /locus_tag="Sala_0515"
FT   CDS_pept        532490..532867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT6"
FT                   /protein_id="ABF52236.1"
FT                   /translation="MGPTAESPDAYIAALSGWQLDRCTMMRAAIMGAAPFDETIKWTNL
FT                   VFLANGPCILIRAEAHRVLLGFWRGKRLRELDPRIRASGKYELGNLVMSEDTEVTAEQV
FT                   ACLAAAAHRLNIELGNPAARR"
FT   gene            532864..535332
FT                   /locus_tag="Sala_0516"
FT   CDS_pept        532864..535332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0516"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52237"
FT                   /db_xref="GOA:Q1GVT5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT5"
FT                   /protein_id="ABF52237.1"
FT                   /translation="MTQLPLPIDAVLPDIMAALVLKPNAVVVAPPGAGKTTRVAPAILD
FT                   QPWCKGAVWLLSPRRLAARGAAERISEEMGEAVGGAVGYATRLDSKQSATTRLLVMTPG
FT                   LFRNRILADPELRGVSAVLFDEVHERSLDGDFALALAIDAQQGLRDDLRLVAMSATLDG
FT                   ARFGALLGDAPVVKSEGKIFPLDLRHIGRRAEDRLEASVLAAVRQAMADEADGDMLAFL
FT                   PGAADIERAANAVDEARLPLAVHRLHGQIDPALQRKALVRDPEGRRKLILATSIAETSL
FT                   TIDGVRIVIDAGLSRRPRFDKAAGISRLVTERASQASATQRAGRAARQGPGAAYRLWEA
FT                   AATAGMPPFDPPEIHESDLMPVVLDCASWGIIDPRQLGWLDPPSPAAVAEAKTRLQAIG
FT                   ALGEDGRITAHGKALAAIPLPVPLAHMLLDAARAGEGELAGRLAVLLTEPGLGGRGVDV
FT                   EARLARWRAQRDERSGGAFRLARRLSGIAEKLAAGAGEAAPRSLGGWIATAWPDRVARR
FT                   RAGQRGEYLSVGGRAYRLDPVDPLAGSEWLAIADAQGHAAGVRILAAAAIDAVEVETLF
FT                   ADHIVVHSASRYDSANDRVDHRRERRLGAIALTSGPAPRGDTAADDIAVRMAAVRDKGL
FT                   GLIGWGPAAQALRQRASFAGLDALSTNALGDNLEIWLEPLLADCRGLRDIGDRRLADAL
FT                   MAMLDWPARQLLERHAPADYVTPAGSRHPIDYGADGGPTVSVRVQEMFGQSRHPVVGDP
FT                   PVPLILALTSPAHRPIQTTRDLASFWAGSWHDVAREMRGRYPKHSWPDDPAGARPTLMT
FT                   KAAQARREGQ"
FT   gene            535398..535676
FT                   /locus_tag="Sala_0517"
FT   CDS_pept        535398..535676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0517"
FT                   /product="ETC complex I subunit conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52238"
FT                   /db_xref="GOA:Q1GVT4"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT4"
FT                   /protein_id="ABF52238.1"
FT                   /translation="MKARIYQKPKNAMQSGRAGTGRWMLEFAPAEARKPDPLMGWAGSG
FT                   DTQRQLRLSFASREEAVAYAEKYGIDAEVMPTPVRKLKIQAYADNFR"
FT   gene            complement(535836..536051)
FT                   /locus_tag="Sala_0518"
FT   CDS_pept        complement(535836..536051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52239"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT3"
FT                   /protein_id="ABF52239.1"
FT                   /translation="MSKLHLVFGGRVSDPQGLDFVDLANLDVVGLYPDYKSAEKAWRSA
FT                   AQRTVDDAEMKYVVVHLHKLLQPEAE"
FT   gene            complement(536131..536487)
FT                   /locus_tag="Sala_0519"
FT   CDS_pept        complement(536131..536487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52240"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT2"
FT                   /protein_id="ABF52240.1"
FT                   /translation="MKPFSETARETRAKASELAEKTAENARLTAEAAKARIQEGYGRAR
FT                   AATEDLAARASEQAGVAREAASEAYAKGKVQAKRANSKLKDVAEKQPLALVAGAVAIGA
FT                   LLGSLLPKGRSGEE"
FT   gene            complement(536471..536854)
FT                   /locus_tag="Sala_0520"
FT   CDS_pept        complement(536471..536854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52241"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT1"
FT                   /protein_id="ABF52241.1"
FT                   /translation="MPRTRNRLITAARRSMLQRAELYRRLDVAKAALHPAALLDRGKYR
FT                   VRTKVDDAAHAVRQEFRDNRWPIAIAAAAGIAWLLREPIKEHAPRLARKVQDVVAGIAD
FT                   RFRADATDEDGAGQVEENDEAVQ"
FT   gene            complement(536854..537303)
FT                   /locus_tag="Sala_0521"
FT   CDS_pept        complement(536854..537303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52242"
FT                   /db_xref="GOA:Q1GVT0"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVT0"
FT                   /protein_id="ABF52242.1"
FT                   /translation="MASPDPETPAPVGRSFDGISHGYAPDARPATSEPVPLDQIARDVV
FT                   ENLSATAKAELALIEARGELALHGATWSAAWGAVAACALGVAMLALAFGAILALAPHTG
FT                   ALLATIIVVAVLLLIAALAGWRARRAYDDIRTALRRDLVNEGVDD"
FT   gene            complement(537311..537901)
FT                   /locus_tag="Sala_0522"
FT   CDS_pept        complement(537311..537901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52243"
FT                   /db_xref="GOA:Q1GVS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS9"
FT                   /protein_id="ABF52243.1"
FT                   /translation="MPARAAPDTTEEDKMMAKAATPATKKAAAPRPKAPAKAAAAKAAP
FT                   ARKPASTKAAKEHPIRDQLAVTRDTIKSEASKKAASLKQEAAALKKQATASARDAATRG
FT                   KDKAAEAVGSLARLLEDSAGTVDTKFGKQYGDYARSAAATVAGLASTLDKKDLDELAAS
FT                   TRDMVKKNPAIAVGAATVIGFVLARMLKGGSND"
FT   gene            538057..539331
FT                   /locus_tag="Sala_0523"
FT   CDS_pept        538057..539331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0523"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52244"
FT                   /db_xref="GOA:Q1GVS8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVS8"
FT                   /protein_id="ABF52244.1"
FT                   /translation="MTAIIDIHGREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGA
FT                   HEAVELRDGDKGRYLGKGVTKAVAAVNGDIAEALVGLDAEDQREIDMAMIDLDGTPNKS
FT                   RLGANAILGVSLAAAKAAADARGLPLYRYVGGVSARTLPVPMMNIINGGEHADNPIDVQ
FT                   EFMIMPVGAGSIAEAVRWGSEIFHTLKKGLSQKGLATAVGDEGGFAPNLASTRDALDFI
FT                   AASVDQAGFKLGTDVVLALDCAATEFFRNGKYEISGEGLSLSPEQMAEYLAALVKDYPI
FT                   KSIEDGMSEDDFAGWKALTDLIGGTCQLVGDDLFVTNPARLEQGIKDGLANSLLVKVNQ
FT                   IGTLSETLDAVDMAHRARYSAVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLA
FT                   KYNQLIRIEEELGDMARYPGAAIFG"
FT   gene            539401..539724
FT                   /locus_tag="Sala_0524"
FT   CDS_pept        539401..539724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0524"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52245"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS7"
FT                   /protein_id="ABF52245.1"
FT                   /translation="MTQRHKLRKSMRRATGPALAVIAVLAMLGYAIFGPTGLYAWGEYS
FT                   QSVEKKRVVLSELVKKERELQNRVNLLDQRRVDPDLAEEYVRSKLGAYHPDEVIIPMEP
FT                   EAK"
FT   sig_peptide     539401..539523
FT                   /locus_tag="Sala_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.866 at
FT                   residue 41"
FT   gene            539985..541055
FT                   /locus_tag="Sala_0525"
FT   CDS_pept        539985..541055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0525"
FT                   /product="Pyruvate dehydrogenase (lipoamide)"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52246"
FT                   /db_xref="GOA:Q1GVS6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS6"
FT                   /protein_id="ABF52246.1"
FT                   /translation="MAKAPARKTAAPKKVAATPAPASNREGPRDPVPYDATPQELEKFY
FT                   RDMLLIRRFEEKAGQLYGLGLIGGFCHLYIGQEAVAVGLQSALDGDKDSVITGYRDHGH
FT                   MLAYGIDPKVIMAELTGRAAGISKGKGGSMHMFSVEHKFYGGHGIVGAQVSLGTGLAFA
FT                   HKYRGDGGVAMAYFGDGAANQGQVYESFNMAELWKLPIIFVIENNQYAMGTSVNRASAE
FT                   DQLYRRGESFRIPGMQVDGMDVLAVRGAAEAALEWVRAGRGPVLMELKTYRYRGHSMSD
FT                   PAKYRSREEVQAVRDKSDAIEHLKKLMEGAGIGEDRIKDIDKEIRAIVAESADFAESAP
FT                   EPDLSELYTDVLVEQY"
FT   gene            541057..542457
FT                   /locus_tag="Sala_0526"
FT   CDS_pept        541057..542457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0526"
FT                   /product="Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52247"
FT                   /db_xref="GOA:Q1GVS5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS5"
FT                   /protein_id="ABF52247.1"
FT                   /translation="MAIELKMPALSPTMEEGTLAKWLVKEGDIVKSGDILAEIETDKAT
FT                   MEFEAVDEGTIGQILVPEGTDNVKVGTVIATIQGEGEEQNVAPAQAGAASNSEPTPAAP
FT                   APAGATDEPAPAPAPVADRPAATERASDPAIPEGTAMVKLTVREALRDAMAEEMRRDDR
FT                   VFVMGEEVAEYQGAYKVTQGLLQEFGARRVVDTPITEYGFAGLGAGAAMGGLRPVIEFM
FT                   TFNFAMQAIDHIINSAAKTNYMSGGQMRCPIVFRGPNGAAARVGAQHSQNYGPWYASVP
FT                   GLIVIAPYDAADAKGLLKAAIRTEDPVVFLENELLYGRSFEVPDVDDFVLPIGKARVMR
FT                   EGRDVTVVSYSIGVGLALEAADSLAGEGIDAEVIDLRTLRPLDTATVLASLKKTNRLVV
FT                   VEEGWPVCSIASEIAMVAMEQGFDDLDAPVMRVCNEDVPLPYANNLEKAALIDTPRVVT
FT                   AVKAVLNR"
FT   gene            542505..543173
FT                   /locus_tag="Sala_0527"
FT   CDS_pept        542505..543173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS4"
FT                   /protein_id="ABF52248.1"
FT                   /translation="MPSKPTPAPAFAGATAEPSAYPDMRDPRVMVAVPRARRAAMAALW
FT                   GLAARLTRLLLDAREPLIGQIKLAWWRDMMAMLAADPAALPKGEPLLADLAASWAGQGG
FT                   LDALVDAAETMLLAEGDTGRRVASVRFGAHLFALSGGTERGGQRWGLVWGAGVVGAEAE
FT                   ARQLLQDAKISGVPSRRDYAGKRALLMLDRWAAAIAARDGERHLRSEGLLLLRIGLFGR
FT                   "
FT   gene            543258..543974
FT                   /locus_tag="Sala_0528"
FT   CDS_pept        543258..543974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0528"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52249"
FT                   /db_xref="GOA:Q1GVS3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS3"
FT                   /protein_id="ABF52249.1"
FT                   /translation="MFNGLIAYLDSIKARDPAPRSRWEILLYPGLLAVGLHRIAHWLFE
FT                   ARLFFLARFVNHLSRFLTAIDIHPGAKIGRHLFIDHGFTVIGETAEIGDNVTIYQCVTL
FT                   GGTDPANGIAGKRHPTLADDVIVGSGAQILGPITVNARARVGANAVVTKDVPEGAVMVG
FT                   IPARSTLVDAAEYAREFVPYGTPCSEIFDPATQKVELLQCQLEQMQKQLAALIAQRDVA
FT                   EADEEAPRRKGGRKSA"
FT   gene            543974..544321
FT                   /locus_tag="Sala_0529"
FT   CDS_pept        543974..544321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52250"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS2"
FT                   /protein_id="ABF52250.1"
FT                   /translation="MGTVTPLPFAGRTAPLQTGFERPELLRILDLYGRMVAAGHWRDYA
FT                   MDFHRDAAIFSAFRRAAERPEYRIEKRPALRNRQGMWALVSEAGAILKRGDELSNVLAP
FT                   VERKLMKLVAD"
FT   gene            complement(544299..545363)
FT                   /locus_tag="Sala_0530"
FT   CDS_pept        complement(544299..545363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52251"
FT                   /db_xref="GOA:Q1GVS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS1"
FT                   /protein_id="ABF52251.1"
FT                   /translation="MYSESDLQAAVDAKILTPEAAAAFRGHIASVRAAPGADEESFRLI
FT                   TGFNDIFVSIAAVILLVAVAWIGESIHSALAGAFVAGSAWLLAEYFTRRRRMALPSIIL
FT                   VLAFAGGVFATMAGFLVEHGEAIFGRSPGDTVGALLVGSIAAVTAGATWLHWKRFMVPI
FT                   TVAAGTAAIAATAIALILSLTGVPDHNPTLVMALVLVAGLGVFTLAMWWDKSDRARQTR
FT                   RSDVAFWLHLLAAPMIAHPIFHLLGVTEGDNIGSGAAVMVVAIYVLFGLIALAIDRRAL
FT                   LVSALAYVLFALTQLFNQFGAVELNVALTAFVIGSALLLLSAFWQNARAVVVGILPTTI
FT                   ANQLPVAVSPQPAS"
FT   gene            complement(545637..546539)
FT                   /locus_tag="Sala_0531"
FT   CDS_pept        complement(545637..546539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0531"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52252"
FT                   /db_xref="GOA:Q1GVS0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVS0"
FT                   /protein_id="ABF52252.1"
FT                   /translation="MTINFDGRVAIVTGAGGGLGRAYALELARRGAKVVVNDLGGARDG
FT                   TGHSDAALAVVEEIRAAGGTAMPDGGSVTEYEQMVEMVAKAKEEWGGVHILINNAGILR
FT                   DKSFAKMDPADFDLVVKVHLLGSAYVTKACWDIMRDQAYGRILMTASSTGLYGNFGQAN
FT                   YGAAKLGLAGLTKTLHLEGAKYNIRCNTIAPVAGTRMTEDIFPAELFEKFTPANVVPAA
FT                   LYLVSEDAPTNMIIGAGAGAYHAAYVTMTPGVALPEGERTPEGVAAAWDKIIDRTGDTV
FT                   PQSGSEQSMNVMRALMALG"
FT   gene            546739..548091
FT                   /locus_tag="Sala_0532"
FT   CDS_pept        546739..548091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0532"
FT                   /product="phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52253"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR9"
FT                   /protein_id="ABF52253.1"
FT                   /translation="MRHSLTAALLATSILCLPSTARAQTMTAEEAAALRAELAALKAQV
FT                   ATLESRLDAATGQPAPAAQPKSPSVAAKPASEIGWKGAPEIRTADGWSFKPRGRMQVDL
FT                   AAVDTPVGATDARGGLKTEFRRIYLGVDGKIPGGFAYRVEADVANNSVELTDVYLTYGT
FT                   GPLSVTAGQIKPFWSLDEMTSDLFTSFMERAAFAQAFGFERRVGLSAQYRRGDLLLQAG
FT                   VFGDNAGDLLDDSNNAVSLDGRVVWMPKLGDTQLHLAASGHWRDPNDPAALGRYRARPF
FT                   AHTTDVRLVDTGLIDVASERGIGLEGAVIAGPFHAAGEGYWHRVNRTGPADPTFFGGYA
FT                   EVGMVLTPGDRRGYKDGGFDRLKPTKPITAGGVGAFEVNARYDHLDLNDGGIVGGRQQA
FT                   ALISLVWAPVDYIRINANYGKLWVGDARVATATGDRDYTADTFGLRTQVDF"
FT   sig_peptide     546739..546810
FT                   /locus_tag="Sala_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            complement(548107..549528)
FT                   /locus_tag="Sala_0533"
FT   CDS_pept        complement(548107..549528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0533"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52254"
FT                   /db_xref="GOA:Q1GVR8"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR8"
FT                   /protein_id="ABF52254.1"
FT                   /translation="MRLMPVTDAMFLWGESREMPMHIGGINLYTLPDGVDETEWLNEQL
FT                   TLLRQSEGLRRPFSEVLKLTPFGQYGPIRLVPDRDIDMHYHVRAAALPKPGRYREMFEL
FT                   ASRLHSGLLDRTRPLWEITLISGLPNRQIATFKKVHHALMDGAASIHFYNSMLSPDPDE
FT                   RRTASPLSVEAYEAYKRSFPAPKKPPRPDLTDIKAIGDFLKEQWGNSVGVTKAMNQYLA
FT                   AMFGIGGDGLATPFAGVPRTSFNRNITGARRFVAQSWSLERVRAMGKAYDGTINDAVLG
FT                   MCAGAMRKYLQSLNELPDKPLKAMAPVSIRPKDDIDSGNSVASVTANLATHIDDPATRM
FT                   AMIQESMNSAKAQLRAMTAQQIRLYTAITSFPMMLTALTRTADKFPAYSVTISNVPGPR
FT                   EQMYWNGARLDGMYPASIPVDGMAMNITQVSNFRNIDFGITACRRSVPHAQRMIDYLED
FT                   SLVELETAAGIKKAK"
FT   gene            complement(549935..550342)
FT                   /locus_tag="Sala_0534"
FT   CDS_pept        complement(549935..550342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52255"
FT                   /db_xref="GOA:Q1GVR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR7"
FT                   /protein_id="ABF52255.1"
FT                   /translation="MSDLPAVQPARLSNDPYETSGVQAGFQLPRWMWRAMFACYAIFFV
FT                   GIGAATGRDTATIFALVISLLYMLMYFVTAGLLHAQKGPEHDSPLDRVGGTLDTWTGPM
FT                   DRGTVAAQLLAVPAGFAFLGLTFFAIRAASF"
FT   gene            complement(550335..550820)
FT                   /locus_tag="Sala_0535"
FT   CDS_pept        complement(550335..550820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0535"
FT                   /product="Truncated hemoglobins-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52256"
FT                   /db_xref="GOA:Q1GVR6"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR6"
FT                   /protein_id="ABF52256.1"
FT                   /translation="MQPIRAHAPAHPHAAAARAARRADAKVIGIDEAFIAAFVDDFYAA
FT                   IRADALLGPVFAARIDDWPAHLAQMNRFWQSILLAAGSFSGNPMVKHLAIPGLDDAHFA
FT                   HWLDLFYATLHRLAPTPEAAKLVGEKARMIAESLLTGIRLHRDRDADLFSKVELPHV"
FT   gene            550902..551333
FT                   /locus_tag="Sala_0536"
FT   CDS_pept        550902..551333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0536"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52257"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR5"
FT                   /protein_id="ABF52257.1"
FT                   /translation="MRLSLHSDYALRILMALAATGEQMSVDEIASHYGISRNHLAKVAQ
FT                   RLQALGYVSAQRGRGGGLTLARAPSEVIAGTVVREFENLGGLVECMDPATSTCPVRGGC
FT                   GLQGALGGALAAFLAHLDRYTLADLLPQPARFRALLGAE"
FT   gene            complement(551353..552942)
FT                   /locus_tag="Sala_0537"
FT   CDS_pept        complement(551353..552942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0537"
FT                   /product="AbgT putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52258"
FT                   /db_xref="GOA:Q1GVR4"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR4"
FT                   /protein_id="ABF52258.1"
FT                   /translation="MTDSSAAATPPQKGVLGWIERVGNRLPDPVVLFLWLVGILVVISV
FT                   IASAAGWSALHPTEVDPETGRQKVIAATSLLSADNIARLWVEMPATFTHFHPLGYVLVV
FT                   MLGAGVAERSGLFGTAMHASVRGAPQWLLTPLVAFVAMMGNLAADAAYVVLIPLAAVIY
FT                   HAAGRHPVAGIAAAFAGVSGGFSANLLPGQLDALLFGITEAAVETVFGDWQANIAGNWY
FT                   FIAVMLFLFLPVIWYVTDRIIEPRLGSYVPAGLAAKGDIGEQDRPLNDGERKGLRHAGL
FT                   AILFVIGLWLLFTLGPGTPLVAEDGPPEGRFTPFYQSLVAGFFLLFLLAGWAYGRATGV
FT                   VGNHRDLVKMMSESMGDMAYYLVLAFAAAHFVAMFAWSNLGLILAVHGADGLKAMDLPA
FT                   PVLLAAIVLLTAALNLFVGSASAKWALLAPVLVPMLMLLGISAEMTTAAYRVGDGSTNI
FT                   ITPLMVYFPLILIFCQRWQPSFGLGSLAATMLPYSIGLLVTGTALVIGWVALDLPLGPG
FT                   ASVHIPVPTTAP"
FT   gene            553000..553593
FT                   /locus_tag="Sala_0538"
FT   CDS_pept        553000..553593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0538"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52259"
FT                   /db_xref="GOA:Q1GVR3"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR3"
FT                   /protein_id="ABF52259.1"
FT                   /translation="MAKLYFYYASMNAGKSTTLLQADFNYRERGMETMLWTAALDDRYG
FT                   TGQVTSRIGLMAAAHKFDPESDLFAAVSAENAERPLACVLVDEAQFLSREQVLQLARLA
FT                   DEVNIPVLCYGLRTDFAANLFPGSAALLGLADALVELKAVCECGRKATMNLRVDENGRA
FT                   VVEGAQTEIGGNDRYVAMCRRHFMEKRREAAADA"
FT   gene            553586..554122
FT                   /locus_tag="Sala_0539"
FT   CDS_pept        553586..554122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0539"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52260"
FT                   /db_xref="GOA:Q1GVR2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR2"
FT                   /protein_id="ABF52260.1"
FT                   /translation="MLDRLYVELTEGDLRLVKLAEAHREALRAACAADGDVWPIYSSSY
FT                   DPDHFDASFTALIGHESRMPYAVIEGEALVGMTAWLRPDVSAQTVELGNSYIHPGARGT
FT                   GLNGRVKRLMLDHAFSVGFRRVEFRIDERNGRSQAAVAKLGCTKEGVLRAERITWTGHV
FT                   RDTGLWSILAEEWTG"
FT   gene            554154..554615
FT                   /locus_tag="Sala_0540"
FT   CDS_pept        554154..554615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52261"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR1"
FT                   /protein_id="ABF52261.1"
FT                   /translation="MTNGRGSALVQTHPAMEGAMKNLALSLAAALLPLSVAAADEPVRE
FT                   ARALGVESSIVFPSDSSIRNWRADDGRGVWIQDRRGDWYYGAFAGYCRDIDFAHTIGVE
FT                   TRGAARLDRFSAIIVRGERCPLASFVTSAPPPSKRDKSEDIMGENPAAN"
FT   sig_peptide     554154..554270
FT                   /locus_tag="Sala_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.904 at
FT                   residue 39"
FT   gene            554649..555605
FT                   /locus_tag="Sala_0541"
FT   CDS_pept        554649..555605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0541"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52262"
FT                   /db_xref="GOA:Q1GVR0"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVR0"
FT                   /protein_id="ABF52262.1"
FT                   /translation="MNGWIILDKPVGLGSTQAVGAVKRVCREAGLGKAKVGHGGTLDPL
FT                   ASGVLPIALGEATKLCGRMLDASKTYDFTVRFGMETAGLDAEGEVVATSDVRPTLAEID
FT                   AVLPRFTGPIEQVPPAYSAIKIDGERAYDRARKGEAVEMKARGVTVYSLRHAGLDPASI
FT                   AAGAEWTPDQVRGDEGGEDRLESITLTAHVSKGTYIRSLARDIARAVGSVGHVTMLRRT
FT                   KAGPFTLERAISLDKLNAFGQGAAQSEIILPLEAGLVDIPALDLSPEAAGAIRQGRVWT
FT                   GVSTHDGLYWGRDAENRPVALIEALAGTLKVVRGFNL"
FT   gene            555631..555900
FT                   /locus_tag="Sala_0542"
FT   CDS_pept        555631..555900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0542"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52263"
FT                   /db_xref="GOA:Q1GVQ9"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVQ9"
FT                   /protein_id="ABF52263.1"
FT                   /translation="MSITAERKAEVIKDNARDKGDTGSPEVQVAILTDRINTLTEHFKT
FT                   HRKDNHSRRGLLMMVNKRRSLLDYLRKKDEGRYQALIAKLGLRK"
FT   gene            556093..558408
FT                   /locus_tag="Sala_0543"
FT   CDS_pept        556093..558408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0543"
FT                   /product="3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52264"
FT                   /db_xref="GOA:Q1GVQ8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVQ8"
FT                   /protein_id="ABF52264.1"
FT                   /translation="MFDVKKVSIEWGGETLTLETGKVARQADGAVIATLGETVVLCAVT
FT                   AAKSVKDGQDFFPLTVHYQEKYSAAGRIPGGFFKRERGATEKETLVSRLIDRPIRPLFP
FT                   EGFYNEINAIAQVLSYDGHNEPDILAMVAASAALTISGVPFMGPIGAARVGYLNGEYIL
FT                   NPTDEQVAEGDLDLVVAATHDAVMMVESEANELSEEVMLGAVLFAHDACKEVVKAIIKL
FT                   AEQAAKEPWEIASSDDDAALKDKLRKLIGKDIAAAYKLTDKSARSNALNEARAKAKESF
FT                   IADGLDPQAVMAGIKIVKKLEAEIVRTAILKEGKRIDGRTTTQIRPIVAETHFLPRAHG
FT                   SALFTRGETQTIATCTLGTKDAEQMIDGLNGLSYQHFMLHYNFPPYSVGEVGRFGAPGR
FT                   REVGHGKLAWRALHPVLPSKDEFPYTIRLTSDITESNGSSSMASVCGGSLAMMDAGVPI
FT                   KRPVSGIAMGLILEGKDYAILSDILGDEDHLGDMDFKVAGTSEGITTMQMDIKIAGITR
FT                   EIFEAALAQAKEGRAHILGEMNKALGEVRTELSAHAPRIETMQIDKAKIRDVIGTGGKV
FT                   IREIVATTGAKVDIDDEGLIKISSSDLDQIEAARKWIAGIVEEAEVGKIYDGKVVNLVD
FT                   FGAFVNFMGGKDGLVHVSEIRNERVEKVADVLSEGQDVKVKVLEIDPRGKVRLSMRVVD
FT                   QETGAELEDTRPAREPRERGDRGDRGDRGPRRDGGDRNRGGRERGPRRDGGGDRGPRRE
FT                   RSEDGPEDQGHVPDFLKD"
FT   gene            558688..559392
FT                   /locus_tag="Sala_0544"
FT   CDS_pept        558688..559392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0544"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52265"
FT                   /db_xref="GOA:Q1GVQ7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ7"
FT                   /protein_id="ABF52265.1"
FT                   /translation="MVGTMLTLAAALILAIQPAAVPPQATQLPPPVPPVPAPVTPVVEA
FT                   DTRPFVALTTDLGTITVRIEDKRAPVTAANFLRYVDTKRMDGFQFYRSTRSWGPANQLI
FT                   QAGNRGDARRNYPPIAHEPTTATGLTHCKGALSMARLSPGDATTDFFLLLSDIKGFDAD
FT                   APGGDGVGFAVFGEVVAGADVAAAIFNAPISPTAGEGVMVGQILDPQVTIRTARRVPAP
FT                   ADAPKGCVVKAQ"
FT   sig_peptide     558688..558765
FT                   /locus_tag="Sala_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.595 at
FT                   residue 26"
FT   gene            559479..560273
FT                   /locus_tag="Sala_0545"
FT   CDS_pept        559479..560273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0545"
FT                   /product="DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52266"
FT                   /db_xref="GOA:Q1GVQ6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ6"
FT                   /protein_id="ABF52266.1"
FT                   /translation="MTRFAPSRAAVRLLAAAFVITPMLAACAGGGGVKQDTRYVARDVN
FT                   TLYRAAQERLDRGQYGIAAALFDEVERQHPYSPWARRAQLMSSFSYYMDREYTPAIEAA
FT                   QRFLAIHPGNKDAPYAYYLIALSYYEQISDVTRDQRITQQAQAALGEIVRRYPDSRYAA
FT                   DARLKLDLVQDHLAGKEMEIGRFYQRSSNWLAASIRFREVVDKYQTTSHAPEALYRLTE
FT                   SYLALGIPEEAKKSAAVLGANYPGNEWYERAYKLMQKHAPSA"
FT   sig_peptide     559479..559565
FT                   /locus_tag="Sala_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.926 at
FT                   residue 29"
FT   gene            560306..561976
FT                   /locus_tag="Sala_0546"
FT   CDS_pept        560306..561976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0546"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52267"
FT                   /db_xref="GOA:Q1GVQ5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ5"
FT                   /protein_id="ABF52267.1"
FT                   /translation="MLTALSIANIVLIERLDLDFEAGLGVLTGETGAGKSILLDALGLA
FT                   LGARADSALVRQGTDRAQVTASFAPPAAGSPLATLLADNDITQGVGEPLIIRRTLKADG
FT                   GSRAFLNDQPCSAALLREVGGHLVEIHGQHDDRGLLAPAGHRALLDAYARADTAAVAAA
FT                   HAAWRAAEAKLAAARAAIAEAERDREWLEHCVAELQALAPQPGEEAELAEARAAMQKGE
FT                   RLAGDLGAILEVFDGSDGGPALLRGAARRLDRLAGDHALLAEALAALDRAIIEADEAET
FT                   KLHEAARAMEYDPERLDATETRLFELRAMARKHACQPDELADLTGTLAARLDAIEGGSA
FT                   GLARLEAAVAESAAAYTRAATVLSDQRAKAAARLDAAVADELAPLKLDAARFRTLVERL
FT                   PADRWGPGGIDRVEFLIATNPGAPFAPLAKIASGGELSRFILALKVALAEEGGADTIIF
FT                   DEIDRGVGGAVASAIGERLARLAGAGKQLLAVTHSPQVAAKGAFHFVIAKSSEGTVTRT
FT                   SVHTLDDAGRREEIARMLSGAEVTEEARAQAERLLEVAA"
FT   gene            561973..562659
FT                   /locus_tag="Sala_0547"
FT   CDS_pept        561973..562659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0547"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52268"
FT                   /db_xref="GOA:Q1GVQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ4"
FT                   /protein_id="ABF52268.1"
FT                   /translation="MTVLHPLDRPIWSMLTGRQAHLAEGDARALRIDRGYGVFGVAADT
FT                   GAAAQAALAALVPDDGELWIVEGDPWPVPPGVREVRRAVLAQMVADGPPPAPRDGEPPI
FT                   VALHDSDAPEMAALADHAKPGPWGPATHRYGPFFGVREDGRLLAMAGQRMLMPGMAEVS
FT                   GVATWADCRGRGLARALIGHVMRAMVARGETPFLHSYADNAGAIALYESLGFRIRREVH
FT                   VLVIAR"
FT   gene            562791..563105
FT                   /locus_tag="Sala_0548"
FT   CDS_pept        562791..563105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52269"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ3"
FT                   /protein_id="ABF52269.1"
FT                   /translation="MAPSFDARLGGHKFRRQAILGPCIADFCCPQKGLAVEVDGDTHIL
FT                   ETDATRDEALRNQGIEVVGIRNEDVLTNMDGVLRYLLIELDRRADRWPHPNRSPEGEGL
FT                   "
FT   gene            563107..565251
FT                   /locus_tag="Sala_0549"
FT   CDS_pept        563107..565251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0549"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52270"
FT                   /db_xref="GOA:Q1GVQ2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVQ2"
FT                   /protein_id="ABF52270.1"
FT                   /translation="MKDVGSLTEAEAANELMRLAKQIAHHNKLYHAEDSPEISDADYDA
FT                   LVRRNTAIEEAFPHLIRADSPNRLVGAAVEASPLAKVTHAQRMMSLDNAFAAEDVEEFA
FT                   ARVRRFLNLDEGEPLAFTAEDKIDGLSCSLRYEKGVLVQAATRGDGTVGEDVTPNVRTI
FT                   ADIPQNLKGDIPDIFEIRGEVYMAKADFAALNARLLAEADDPDKARQFANPRNAAAGSL
FT                   RQKDASVTASRPLRFLAHGWGEVSALPADTQYAVMKAIESWGVPVSPLLKRCDGVADLL
FT                   DHYRMIEAERAELPYDIDGVVYKVDRLDWQARLGFVARAPRWAIAHKFPAERAQTTLEA
FT                   IDIQVGRTGKLTPVGRLTPVTVGGVVVSNVTLHNRDEIARLGVRPGDRIIVQRAGDVIP
FT                   QVVENLTRDEPREPYVFPDHCPVCGSEAVAEDGEVDVRCTGGLICNAQKFERLRHFVSR
FT                   GALDIEGLGEKSIAEFLELGWLEKGPADIFRLKSHREELLAREGWKERSVDNLLAAIEA
FT                   KRQPDAARLLFGLGIRHVGAVTARDLLKGIGDIARLPGKAAELRAWVEANPRIEGESEG
FT                   KYAARRLEAIKAILDVRADGIGPAVAEALGDFFHEPHNRVLWDDLLSEVSPPPYVVETR
FT                   DSEVSGKTVVFTGKLETMSRDEAKAQAEALGAKAAGSVSAKTDLVVAGPGAGSKLKQAA
FT                   SLGIRVIDEAEWAAIVAAAG"
FT   gene            565595..566359
FT                   /locus_tag="Sala_0550"
FT   CDS_pept        565595..566359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0550"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52271"
FT                   /db_xref="GOA:Q1GVQ1"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ1"
FT                   /protein_id="ABF52271.1"
FT                   /translation="MAFVLRLLLALAGLLLTPAGAAAARGPVVLAAASLQESLTEAANV
FT                   WAARGHPKPLLSFAASSALARQVIAGAPADIFLSADEPWMDAVAKAGRLRAGTRVRLVG
FT                   NRLVLIAPAASKVRLTPAHGFPLARALGSGRLAIADPDAVPAGRYARAALAHLGVWGSV
FT                   AGRLAPAENVRATLALVERGAAPLGIVYATDAHASKAVRIVGSFPAASHPPIRYPLAVL
FT                   KTSRHRDAAAFRAFLLSSQGRAIFARHGFSAP"
FT   sig_peptide     565595..565666
FT                   /locus_tag="Sala_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.548 at
FT                   residue 24"
FT   gene            566359..567054
FT                   /locus_tag="Sala_0551"
FT   CDS_pept        566359..567054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0551"
FT                   /product="Molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52272"
FT                   /db_xref="GOA:Q1GVQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVQ0"
FT                   /protein_id="ABF52272.1"
FT                   /translation="MLTAEEWGIVALSLKVGGLAVLATLPLAFVVAWTLARYRFPGRML
FT                   VDALVHLPLVLPPVVTGWLLLIAFGPLGPVGGWLERWFGLALMFRWTGAALAAAIMALP
FT                   LMVRAMRLSIEGIDRRLEGAARTLGAGRWHAFRTISLPLALPGILAALVLGFARSIGEF
FT                   GATITFVSNIPGETRTLPLAIYSALQVPDGEATVTRLALLSVALSLGALLASEWLVRRS
FT                   HVGRRAHDD"
FT   gene            567044..567664
FT                   /locus_tag="Sala_0552"
FT   CDS_pept        567044..567664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0552"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52273"
FT                   /db_xref="GOA:Q1GVP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP9"
FT                   /protein_id="ABF52273.1"
FT                   /translation="MTIEIDVEKRRGDRVIAARFSAGPGLTALFGPSGVGKTSIFDMVA
FT                   GLLRPDRGHIRIGDRILFDAETDLPPEARRIGYVFQDGRLFPHRRVRANLLYGHALAPQ
FT                   ANRWMTLEEAAGFLGIGHLFDRWPQSLSGGEAQRVAIGRALLAGPDILLMDEPLSSLDA
FT                   ARRGDIMAVIERIRDELRLPILYVSHDHAEVDRLATSVVAIGE"
FT   gene            567703..568572
FT                   /locus_tag="Sala_0553"
FT   CDS_pept        567703..568572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0553"
FT                   /product="Phenylalanine 4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52274"
FT                   /db_xref="GOA:Q1GVP8"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP8"
FT                   /protein_id="ABF52274.1"
FT                   /translation="MESRFTHVHETPPPGAAADWTISQNWDAFTADEHAMWDRLFARQS
FT                   AMLPGRAADAFMRGIDVLKLEKPGIPDYRELNARLMAATGWQVVAVPGLVPDDVFFDHL
FT                   ANRRFPAGNFIRTPDQLDYLQEPDVFHDVFGHVPMLADPVFADYMVAYGEGGLRSLKFD
FT                   ALKQLARLYWYTVEFGLIREAGGLRIYGAGIVSSYAESVFALDSESPNRLGFDLARVMR
FT                   TDYRIDDFQQNYFVIDSLEQLLDITVNTDFAPLYAANAALPPIPIADILPDDKVITRGT
FT                   QEYAAAKA"
FT   gene            complement(568678..569649)
FT                   /locus_tag="Sala_0554"
FT   CDS_pept        complement(568678..569649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0554"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52275"
FT                   /db_xref="GOA:Q1GVP7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP7"
FT                   /protein_id="ABF52275.1"
FT                   /translation="MSWIVSFPCTRAEAEALSGEIPALDALDAPPVVVTREIDEDTGLW
FT                   QLDAYLDDKPDAALLDLLRSLVPSARDEMPIVERLPDEDWVTLSQQGLEPVRAGRFFVH
FT                   TSSYSGRLPPGTTPFLIDASQAFGTGGHDTTAGCLAMLDRLARRGGTPRNIADIGTGTG
FT                   LLAFAAMALWPRARVIASDIDPASIFVTRDNAAVNGVPLGRGGGRLALAVAPGTDHPAI
FT                   RRRAPYDLVIANILAGPLITLAPDIAAATAPGGHAILAGLIARQMEPVLAAYRAQGFRL
FT                   AGRGGSADWPCLLLVKRRRYGWRRKERAFHRSDPADASFGNW"
FT   gene            complement(569650..570342)
FT                   /locus_tag="Sala_0555"
FT   CDS_pept        complement(569650..570342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0555"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52276"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP6"
FT                   /protein_id="ABF52276.1"
FT                   /translation="MPTHILITGASRGIGAAIAEALTSTATKIVALSSADGDLGDPATP
FT                   DRLWHTSLDQLDGRIDILVNNAGVFEANPLDATDAEWLANWNRTMQINLTASAQLCRRA
FT                   VLHWQARQSGGRIVNIASRAAYRGDSPVHWHYAASKAGMVAMTKTIARAYARDGILAFA
FT                   ICPGFTMTGMADEYLESRGGEKLLADIPLGRVAMPDEVGEMARWCAMQAPASMTGAILD
FT                   INGASYVR"
FT   sig_peptide     complement(570283..570342)
FT                   /locus_tag="Sala_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.615) with cleavage site probability 0.434 at
FT                   residue 20"
FT   gene            complement(570490..571842)
FT                   /locus_tag="Sala_0556"
FT   CDS_pept        complement(570490..571842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0556"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52277"
FT                   /db_xref="GOA:Q1GVP5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP5"
FT                   /protein_id="ABF52277.1"
FT                   /translation="MVKDNPIHKQQIDPILMSERFPYYDLDGRLAANAAEIHAIIAGRE
FT                   EAVARAYWDAFNALPNMDRRVEGELYDSYVRGSARHASVKYADAAGQEAATIACQNTHM
FT                   ARRVKMPLASVMSCIAESQRLTIEYVVEACIGDAERLARLTSAINRLALLEFDIMQRYA
FT                   SKLDRAVISSERQTLARDFDRSIASLVQDTEGVRERLARQAASADQAAKGMIAKTSEVA
FT                   AASEQSAMAMREAASTAAGLIRAIEDARSEVEASASVATRASEQAGEAVAMSEALSHHA
FT                   ESIESILGLIREIAGQTNLLALNATIEAARAGESGRGFAVVAQEVKSLANETARATDDI
FT                   AGKIAAIQQATRGSVSANQSIQQTIVDVQRSAQRIREAMDAQAQTVTSITAAVDETALA
FT                   ADSMSSTIASIRNDSGMVATEISVLSQEFAKMGGRLQQLEQAASEFSSRVA"
FT   gene            complement(571943..572410)
FT                   /locus_tag="Sala_0557"
FT   CDS_pept        complement(571943..572410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0557"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52278"
FT                   /db_xref="GOA:Q1GVP4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP4"
FT                   /protein_id="ABF52278.1"
FT                   /translation="MIDRIDAKLLHLLQREGPKPAAELGEIVGLSPSACHRRIRALEAQ
FT                   GIITGYAARLSPERIGLGLDVFVDISLTSQSEEALTAFESAVKSFDEILECQLLSGASD
FT                   YRLRVAARSVADFDRLHRHCLSRLPGVAAMHSAFALRTIKAFEGYPVSAAG"
FT   gene            572566..573681
FT                   /locus_tag="Sala_0558"
FT   CDS_pept        572566..573681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0558"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52279"
FT                   /db_xref="GOA:Q1GVP3"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP3"
FT                   /protein_id="ABF52279.1"
FT                   /translation="MIIGTPKEIKNHEYRVGLTPESARELVVHGHRVLVETGAGEGIGA
FT                   HDRYYVEAGAEIVQSADDIFAGADMVVKVKEPQPVERAMLREGQILYTYLHLAPDPDQT
FT                   RDLMKSGAVCIAYETVTSPHGGLPLLKPMSQVAGRMSIQAGATALEKAHGGRGVLLGGV
FT                   PGVAPGKVCVIGGGVVGFNAAQMAAGLGADVTILDRDPEVLERVGTFFEARAKTRFSNR
FT                   ANLAECVAEADLVIGAVLIPGAEAPKLVNREMLGTMRPGSVLVDVAIDQGGCFETSHAT
FT                   THADPTYVIDGIVHYAVANMPGAVARTSTYALNNVTLPHALRIADLGWKEALRRDPHLL
FT                   QGLNVWNGKVTFEAVAEAIGTDYVPVEQALD"
FT   gene            573703..573936
FT                   /locus_tag="Sala_0559"
FT   CDS_pept        573703..573936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52280"
FT                   /db_xref="GOA:Q1GVP2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP2"
FT                   /protein_id="ABF52280.1"
FT                   /translation="MTDQAPPPADDEAQENEVLRAARELQQQREAAEAAEAADKEAGKS
FT                   RRGWKTAAAAGLGIGSAAVIAALLYANRGKIK"
FT   gene            complement(574015..574614)
FT                   /locus_tag="Sala_0560"
FT   CDS_pept        complement(574015..574614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0560"
FT                   /product="(Acyl-carrier protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52281"
FT                   /db_xref="GOA:Q1GVP1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP1"
FT                   /protein_id="ABF52281.1"
FT                   /translation="MMSNILRIDASARTSGSTTRQLTDQLVARLVEQGYGAAVTTRDLA
FT                   LTPPALLTESWVGANFTDEAERNDEQKAALASSDELIAELEAADTIVIGVPVYNFAIPA
FT                   ALKAWVDLIARARRTFRYTEAGPEGLLKGKKAWLVVASGGVPVGSDHDFATGYLRHVLG
FT                   FVGITDVTIIAADQQMMDGGAIARATSAIEALQQAA"
FT   gene            complement(574726..575424)
FT                   /locus_tag="Sala_0561"
FT   CDS_pept        complement(574726..575424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0561"
FT                   /product="Pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52282"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVP0"
FT                   /protein_id="ABF52282.1"
FT                   /translation="MIDIRKFDTLGHADHGWLDARHHFSFANYHDPDRMGWGALRVWND
FT                   DRIAAQAGFPPHPHRDMEIITYVRTGAISHRDSMGNVGRTAAGDVQVMSAGTGVTHSEF
FT                   NLEDEETTLFQIWIIPDQAGGNPCWGARQFPKADRSGQFVTLASGIEGDGDALPIRANA
FT                   RVAAAAVNAGESVSYDLEAGRHAYLVAAKGRIRVNGHDADPRDGIALRDVGMIEVEAID
FT                   DAELVLVDSL"
FT   gene            575672..576607
FT                   /locus_tag="Sala_0562"
FT   CDS_pept        575672..576607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0562"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52283"
FT                   /db_xref="GOA:Q1GVN9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVN9"
FT                   /protein_id="ABF52283.1"
FT                   /translation="MALPDYEGWACFVAVADGGSFTAAAAALGLSKATVSKAVTRLETS
FT                   LGITLLHRSSRVVAVSTAGAGLLDEARAMVAAATAATEAARGDRLDLAGPIRLAAPMSF
FT                   GIKVLGPVLAAFLDRHPAVEIDLLLSDARNDPIAEGIDLTLRIAPLADSSLLARTIAPV
FT                   AASLIASPAYLEKHGTPRHPLDLARHRLIGYGHRQRAMPLHFSREGEEATVLPTGPLFA
FT                   NNGDVMVPMIVAGSGIAVLPDFIAAEELAAGTVVPILTDWSLPQSYLHLLSPPSRLRPA
FT                   RVRAFSDHLVDTLKGSCRGANERYAALRKG"
FT   gene            576804..577511
FT                   /locus_tag="Sala_0563"
FT   CDS_pept        576804..577511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0563"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52284"
FT                   /db_xref="GOA:Q1GVN8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVN8"
FT                   /protein_id="ABF52284.1"
FT                   /translation="MRVLLIEDEPTTAKAIDTMLTTEGFNVYTTDLGEEGLDLGKLYDY
FT                   DIILLDLNLPDMHGYDVLKKLRTAKVQTPVLILSGISEMDSKVRSFGFGADDYVTKPFH
FT                   RDELVARIHAVVRRSKGHSQSVIKTGKLAVNLDTKTVEVDSIRVHLTGKEYQMLELLSL
FT                   RKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLALACGGDNYIETVWGRGYVLR
FT                   DIDDEGNEVRRVA"
FT   gene            complement(577905..578324)
FT                   /locus_tag="Sala_0564"
FT   CDS_pept        complement(577905..578324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0564"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52285"
FT                   /db_xref="GOA:Q1GVN7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVN7"
FT                   /protein_id="ABF52285.1"
FT                   /translation="MRHKSGGRKLQRTSAHRTAMFRNMSASLIKHEQITTTVAKAKELR
FT                   PYVEKLVTLAKRGGLANRRLAMSRLMDEAQLAKLFDVLAARYKDRNGGYTRIIKAGIRA
FT                   SDAAPIAIIEFVDRDMGAKGQDSGPVTTDEELEDA"
FT   gene            complement(578579..579637)
FT                   /locus_tag="Sala_0565"
FT   CDS_pept        complement(578579..579637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0565"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52286"
FT                   /db_xref="GOA:Q1GVN6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVN6"
FT                   /protein_id="ABF52286.1"
FT                   /translation="MTVNIRNWQELKKPSNLEIKTGGDGKRKATFVAEPLERGFGLTLG
FT                   NALRRVLLSSLQGAAITSIKIENVLHEFSSLAGVREDVTDIVLNVKQIALKMEGEGPKR
FT                   LQLSATGPATVKAGDIMVSGDIKVMNPNHVICHLDEGATLNMELVADTGKGYVPATANR
FT                   PADAPIGLIPVDSLYSPVRQVAYKVDNARIGQELDYDKLNLTVETDGTVTPEDAVAYAA
FT                   RILQDQLQVFVHFEEAMSDSGLIGMAAPSAASDESDVNQLNRFLLKKVDELELSVRSAN
FT                   CLKNDNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLSSMGLRLGMDIPGWPPENIE
FT                   EMAKKLEQELLG"
FT   gene            complement(579742..580131)
FT                   /locus_tag="Sala_0566"
FT   CDS_pept        complement(579742..580131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0566"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52287"
FT                   /db_xref="GOA:Q1GVN5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVN5"
FT                   /protein_id="ABF52287.1"
FT                   /translation="MAREPQRLRRRERKNISSGVAHVNATFNNTMITITDAQGNAIAWS
FT                   SAGMMGFKGSRKSTPYAAQVCAEDAGKKAAEHGVRTLEVEVKGPGAGRESALRALQAVG
FT                   FHITSIRDVTPIPHNGVRPAKRRRV"
FT   gene            complement(580209..580577)
FT                   /locus_tag="Sala_0567"
FT   CDS_pept        complement(580209..580577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0567"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52288"
FT                   /db_xref="GOA:Q1GVN4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVN4"
FT                   /protein_id="ABF52288.1"
FT                   /translation="MARIAGVNLPTNKRVIIALTYIHGIGRKTAVDIADKLGIDHGRRV
FT                   QDLSDAEVLQIRETIDADHTVEGDLRRNTAMNIKRLMDLACYRGLRHRKGLPVRGQRTH
FT                   TNARTRKGKAKPIAGKKK"
FT   gene            complement(580804..581595)
FT                   /locus_tag="Sala_0568"
FT   CDS_pept        complement(580804..581595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0568"
FT                   /product="inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52289"
FT                   /db_xref="GOA:Q1GVN3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVN3"
FT                   /protein_id="ABF52289.1"
FT                   /translation="MPGRNLEAVIAATREVGDMAMARWRGEGKAVDVWHKSHDNPVSDV
FT                   DLAVDARLKAVLGAMVPEAGWLSEETADNEDRLACRAMWCVDPIDGTRDFIRGRPGWCV
FT                   SVALIVDGQPELGVLYAPALDELWVAQSGKGATLNGETLRASRRMIFDGARVPADSLPR
FT                   IDRDLIMVTKPNSIALRMALVADDRADLVATLRWGFEWDVAAAALIATEAGAAVSDAFG
FT                   KPLVFNTPRAQAFGVIACAPGIHRAVVARLHDRAVALTAEG"
FT   gene            complement(581603..582946)
FT                   /locus_tag="Sala_0569"
FT   CDS_pept        complement(581603..582946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0569"
FT                   /product="microcin-processing peptidase 1. Unknown type
FT                   peptidase. MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52290"
FT                   /db_xref="GOA:Q1GVN2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVN2"
FT                   /protein_id="ABF52290.1"
FT                   /translation="MLSVSQALDRAQMLCDAATKAGADAADALYYCNAATSVTMRLGAL
FT                   EDVERSEGQDISLRVFVGQRSASVSTADMDAGELARLVERCVAMAREAPEDPYAGLAPA
FT                   DLLFRGAVPDLDLDDGSEADPAALREAALAVEDAARAVAGVTNSEGGSASHSRTRFALA
FT                   TSHGFAGGYGSSGHSLSASVIAGEGAAMQRDYAWHSAHHLTDLESAADIGARAGARAVA
FT                   RLEPGKAPNGKLPVFFDPRVSGGIVGHLLAAIAGPAIARGTSFLIGKEKDMLFDSSIII
FT                   RDEPRRPRGLRSRPFDGEGLPTAARDIVADGRITGWLLDSASARQLGLTPTGHASRGGG
FT                   ASGVAASNLHLAAGAQSPAELMAGVAEGIYVTELIGHGVNPVTGDYSRGASGFMIRGGA
FT                   IAEPIAEFTVAGNLVDMFAALIPADDLIFRHATNAPTLRIDGMTVASS"
FT   gene            complement(582997..583395)
FT                   /locus_tag="Sala_0570"
FT   CDS_pept        complement(582997..583395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52291"
FT                   /db_xref="GOA:Q1GVN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVN1"
FT                   /protein_id="ABF52291.1"
FT                   /translation="MASTFGPRLWRRSTASVPPARSLGRRMTWHAAAALLAFAALQIWL
FT                   VTSAIAAGAPSAYIVVALVILLALALPVARSTERRWYHLSRQALASWGLHARFRRDVRR
FT                   LWIAALTLPFLWISGAMAATEAIAAIAG"
FT   sig_peptide     complement(583240..583395)
FT                   /locus_tag="Sala_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.920 at
FT                   residue 52"
FT   gene            complement(583613..584221)
FT                   /locus_tag="Sala_0571"
FT   CDS_pept        complement(583613..584221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52292"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVN0"
FT                   /protein_id="ABF52292.1"
FT                   /translation="MTRLPLFALILAGSAAALPAAAQESAVEGEKINQVIVYGEDKCEA
FT                   SSADEIVVCNRLPESERYRVPPILRGNPLDPRNEAWANKVVALERVGRFGTDSCSPTGL
FT                   GGFTGCTQALVAGARAERRAADKTDWQAMIADERARRLAGIDAAAAEVEAAVVAEERAL
FT                   EERQKAAAELERQASGEAPAPASPDSEADASELPVPPQP"
FT   sig_peptide     complement(584153..584221)
FT                   /locus_tag="Sala_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(584318..584833)
FT                   /locus_tag="Sala_0572"
FT   CDS_pept        complement(584318..584833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0572"
FT                   /product="Ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52293"
FT                   /db_xref="GOA:Q1GVM9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM9"
FT                   /protein_id="ABF52293.1"
FT                   /translation="MTDKRTASMIRVDQAGEFGATRIYAGQLAVMGDRHPMAREIAHMA
FT                   EQEERHRTFFDAMIARRGVRPTALQPFWNVAGFALGAATAAMGPRAAMACTAAVETEID
FT                   RHYRQQLDELGDSDPELSAAVADFRAEELEHRDAALKAGAERAPGYPLLSLAIRAGCRA
FT                   AIALSKRI"
FT   gene            complement(584830..585312)
FT                   /locus_tag="Sala_0573"
FT   CDS_pept        complement(584830..585312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0573"
FT                   /product="disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52294"
FT                   /db_xref="GOA:Q1GVM8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM8"
FT                   /protein_id="ABF52294.1"
FT                   /translation="MLTSRLAAPLVALAAPLFLYGGALVSQFGFGLHPCEMCYWQRWPH
FT                   QAAILLALLALLLHRNAGAMRALTLLAAAAIAVSGTIGVFHAGVEYGFWEGITTCATGT
FT                   GGPVTLESIMDAPLVRCDAVQWSLFGISLAGFNAIFSFGAATLVLTLLRAGRTSAA"
FT   sig_peptide     complement(585247..585312)
FT                   /locus_tag="Sala_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.757 at
FT                   residue 22"
FT   gene            complement(585400..586788)
FT                   /locus_tag="Sala_0574"
FT   CDS_pept        complement(585400..586788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0574"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52295"
FT                   /db_xref="GOA:Q1GVM7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM7"
FT                   /protein_id="ABF52295.1"
FT                   /translation="MTDTTKTTASPKRRFALWQGAAALSTLALVPLATGAMATVDSKTQ
FT                   EEIARFMDVYLEVKSNYVEPVEDAKLIEGAINGMLASLDPHSGYLDARGFSNLRTQTDG
FT                   EYGGLGLSVTMEDGVVKVIAPTADTPAARAGIKAGDFITHINDELIFGLTLDEAVEQMR
FT                   GRPGTPIDITIVREGQDKPIEMTLTREIIDLKPVKWEVRGDVGVLTVTSFSADATTDLK
FT                   AAMMAVEKSLGKKPRGWVLDLRSNPGGLLDEAVGISDLFLERGEIVSQRGRRKGDIERY
FT                   FAEPGDLAAGAPVIVLIDAGSASASEIVAGALQDQHRAVVMGERSFGKGSVQTVLPLSD
FT                   TTALRLTTARYYTPSGRSVQEGGIEPDIKVPQLSDPDYASRPKFRESDLRRHLINEKKV
FT                   DNGLIEKDETPDPRFTATADELKAKGIEDFQLHYALQTIGRIGPGTPRMAAAAKPAAKP
FT                   ARRN"
FT   sig_peptide     complement(586672..586788)
FT                   /locus_tag="Sala_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.927 at
FT                   residue 39"
FT   gene            complement(587033..588250)
FT                   /locus_tag="Sala_0575"
FT   CDS_pept        complement(587033..588250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0575"
FT                   /product="peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52296"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM6"
FT                   /protein_id="ABF52296.1"
FT                   /translation="MRRGPAALAIVAAFAGGTFALAQGDFFDPQAIATRERMQLVDARQ
FT                   QSAAAMARSAALEKQAAAANSEADRLKKRSAALAARIQAAEADISAGEARVALVARRLS
FT                   AQRARLAEQQQPLLELAASLQQLSRQPPVSVLAQPGSLREMVHARAVIDAAMPVIARRT
FT                   AGVRRELTLLDTARRQQAIALDALAASRARLAARRAALTRLENEGRLRSRDLMSSARLE
FT                   ADRALGLGEKARDIVELMDALEADGLVRAELAALAGPLPRPRDPEAGSVDPLAPPATRE
FT                   VGLTATAYRLPVVGRIVTGLGEVNESGVRSRGITVAARPGGQVVAPAPGRVSFAGDYRG
FT                   YGKIVIIDHGGGWISLLAGMIALSVGVGDTVEAGAPVGRAGSDDSRITVELRRAGRPVD
FT                   IVAMIG"
FT   sig_peptide     complement(588182..588250)
FT                   /locus_tag="Sala_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.863 at
FT                   residue 23"
FT   gene            complement(588247..588675)
FT                   /locus_tag="Sala_0576"
FT   CDS_pept        complement(588247..588675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0576"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52297"
FT                   /db_xref="GOA:Q1GVM5"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVM5"
FT                   /protein_id="ABF52297.1"
FT                   /translation="MLLHIIARGRIGRGPEAELVERYMKRVTWAQKISELPDTGGRVPA
FT                   AAAGSRTILLDEGGEQMSSLEFANLLENWRDGGVREARFCIGAADGFTPDERKGADKVI
FT                   AFGRATWPHLMARAMLAEQLWRATSIIAGHPYHREGRQ"
FT   gene            complement(588818..589216)
FT                   /locus_tag="Sala_0577"
FT   CDS_pept        complement(588818..589216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0577"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52298"
FT                   /db_xref="GOA:Q1GVM4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM4"
FT                   /protein_id="ABF52298.1"
FT                   /translation="MISATQGAAPGAAPANDSVDALHALILHQLDEDQAQETISIPLAG
FT                   KSSIADHMVIASGRSTRHVSAIAEKLAQRIKQEAGRPVRVEGLPNADWVLLDAGDVIVH
FT                   LFRPEVRSFYNLERMWSFGDAPPVAAAN"
FT   gene            complement(589213..589866)
FT                   /locus_tag="Sala_0578"
FT   CDS_pept        complement(589213..589866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0578"
FT                   /product="Nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52299"
FT                   /db_xref="GOA:Q1GVM3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM3"
FT                   /protein_id="ABF52299.1"
FT                   /translation="MIPTGLLGGSFNPAHGGHRAISLNAIDSLHLDELWWLVSPGNPLK
FT                   PKAGMAPLPARLASARRMARRAPIRATGIEAELGTRYTIDTLKKLVRRYPDRQFIWIMG
FT                   ADNLVQLPRWRDWRGIARLMPIAVIARPGYNDRAHARRAMGWLRRFVRPADQKSHWTDW
FT                   RPPALVFLRFSPDVRSATAMRQANPRWFERYEGRALRDPVTRSRLVEPTKKGRI"
FT   gene            complement(589863..590150)
FT                   /locus_tag="Sala_0579"
FT   CDS_pept        complement(589863..590150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52300"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM2"
FT                   /protein_id="ABF52300.1"
FT                   /translation="MINVQWSQAATEDLLNNADGLYLVDFDLADALLSEAERASDFLAL
FT                   TPRAGSLVDAHGLRKWRLGQLPFALLYDVNAERLLVLRVVHLRSDWQTLL"
FT   gene            complement(590147..590419)
FT                   /locus_tag="Sala_0580"
FT   CDS_pept        complement(590147..590419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0580"
FT                   /product="transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52301"
FT                   /db_xref="GOA:Q1GVM1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVM1"
FT                   /protein_id="ABF52301.1"
FT                   /translation="MDATTPITTRLDAVTLETLDRLAERYDRSRSWLVAQAVRQFVERE
FT                   AEMLAIIEEGERSAREEPLISHEEMKKLIAAKRAELRSKHDKATA"
FT   gene            complement(590451..591740)
FT                   /locus_tag="Sala_0581"
FT   CDS_pept        complement(590451..591740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0581"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52302"
FT                   /db_xref="GOA:Q1GVM0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVM0"
FT                   /protein_id="ABF52302.1"
FT                   /translation="MITETLTASSARPGEAAALIAEMGARARTAAKRLAQTPTAEKAAA
FT                   LKAAAGAIRARSAAILAANAEDMAAGQTNGLSGAMLDRLRLDEGRLAAIADAIEAVAAL
FT                   PDPVGREIDRFTRPNGLELSRVRVPLGVIGIIYESRPNVTADAAALGLMAGNAVILRGG
FT                   SEAVHSNRALHAAFAAGLVEAGLPADAVQLVPTQDRAAVGAMLRAQGLIDIIIPRGGKG
FT                   LVARVQDEARVPVLAHLDGINHLYIDGAANPAKAVELAVNAKMRRTGICGATETILIDR
FT                   AYPAPLGIVDALIAAGCEVRGDRDVAALSPHVESASAGDWDTEYLDAIVSIAMVDGLDG
FT                   ALAHIDAHSSRHTDAIVTEDAATAERFLTGVDSAIVMHNASTQFADGGEFGLGAEIGIA
FT                   TGRLHARGPVALEGLTTYKWLVRGSGQLRP"
FT   gene            591820..592956
FT                   /locus_tag="Sala_0582"
FT   CDS_pept        591820..592956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52303"
FT                   /db_xref="GOA:Q1GVL9"
FT                   /db_xref="InterPro:IPR022134"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL9"
FT                   /protein_id="ABF52303.1"
FT                   /translation="MNGDIEGIGAAVTAGLAARAVESAHGGAERANAPLRCLNCGTSLA
FT                   GSHCHRCGQRAEVHRSFGAIGHDLVHAIFHFEGKIWNTLPLLAWRPGDLTRRYIHGERA
FT                   RFISPLALFLFAVFLTYAVLAMIGSGGEFGAALSKAADEQTRTTAVKDSIQMEVDRIDG
FT                   ELAKAGLADDRRRALEAERNILQQSATYLGVARARSQSERRADRAAGPPVLDDPRDQVA
FT                   TSADFISRNKIDTGVPFIDNGLKKAFANPALVLYKLQANAYKFAWALIPLSLPFLWLLY
FT                   PFSRRFHAYDHFVFVTYSISFMLLLFVVVRLLNVTIFGEVATFLAMLYVPFHMYRQLRG
FT                   AYRSSRFGAFVRANLLLFFSLFTLIWFMLLLLALGISG"
FT   gene            complement(593134..594057)
FT                   /locus_tag="Sala_0583"
FT   CDS_pept        complement(593134..594057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0583"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52304"
FT                   /db_xref="GOA:Q1GVL8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL8"
FT                   /protein_id="ABF52304.1"
FT                   /translation="MSFDQIRLDRHEGIALLTLHRPDRMNAFTTQMMLEIVAALDECDA
FT                   DDGVRAVIFTGSGEKAYCAGADLGQGAATFDYDKRTDKAAILPDGFPASPVAEDGTIDW
FT                   SHPLIRDSGGRVSMRIFDAKKPVLGAINGAAVGIGATMTLSMDARLASDTARYGFVFAR
FT                   RGIVPEAASSWFLPRLVGIQTAVDWCFSGRLIPAAEAREKGLVQSIHAPGELVDAAIAR
FT                   ARELTEHSAPVSVALTRHMLWRMLGAPHPMSAHRWDSRAIFARGRSPDAAEGVSSFLEK
FT                   RPANFTASVANDYPWFAEFEEAPPYS"
FT   gene            594302..595078
FT                   /locus_tag="Sala_0584"
FT   CDS_pept        594302..595078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0584"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52305"
FT                   /db_xref="GOA:Q1GVL7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVL7"
FT                   /protein_id="ABF52305.1"
FT                   /translation="MARRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKRGTING
FT                   KGVLNNRISEHVFTLLGNIGVPTHFIRRLNMREQLIRQVEIVPIEVIVRNVAAGTLSKR
FT                   LGIEEGTQLPRTLIEYCYKDDALGDPLVAEEHIACFNWCSQDELHDIQDMAIRINDFMS
FT                   GMFAAVGIRLVDFKLEFGRLYEGDFSRIILADEISPDGCRLWDMTTNEKLDKDRFRRDL
FT                   GGEVEAYQEVARRLGLLPEGGDNAVLDLESHRKKKG"
FT   gene            595191..598082
FT                   /locus_tag="Sala_0585"
FT   CDS_pept        595191..598082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0585"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52306"
FT                   /db_xref="GOA:Q1GVL6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL6"
FT                   /protein_id="ABF52306.1"
FT                   /translation="MTSLILRRAATALLPFALLAVCSPPLLAKEVERPAATAAVNPQGD
FT                   AARAWNFAASDVPVDPGTIFGVLPNGMKYALLKNSTPRDSVVIRMRLDVGSFAEADDQR
FT                   GLAHFLEHMAFNGSTNVPEGEMIKLLERKGLAFGADTNASTGFDETIYKLDLPNASDDL
FT                   IDTGLMLMRETASELTLDSAAIDRERGIILSERRARDTYQLRNIVDQLDFQMQGMIVAD
FT                   RLPIGTEAVIRTAPASRLRDLYERYYRPERATLVMVGDFDPAAVEAKIKARFADWTGKG
FT                   PAGVDPDIGAIDYARPAAADDFVDPAIQDSVTLAAFRPWVDEPDTRAKRARLIAENIGE
FT                   AIVSRRLAKIALDEDSPILAGSLSDANGWKVFDQVTIGAVAREGAWREALAIVEQERRR
FT                   ALEHGFTEAEVAEQIANQRTALRNAVAGAATRRSEALADALVVAARGEAVFTRPETALA
FT                   LFESVAPSLDAAAITTAFRKRTEGLSAPLVRVTAKAPIDGGVDAILASLRASTQVAVAP
FT                   PAEAASAAFAYDNFGTPGTIVADDRIEDLGIRRIRFANNVMLNVKTTDFQKDRVLLSLR
FT                   VDGGTLLATRDDPTRVSLASSFMLGGLEAHSVDDLRTIFAGRTVSPAFGAAIDAFGGTA
FT                   TTSPEDFALQAKLLAAYLTHPGYRADGLALIRRVLPQQYAANDATPAAVIARDVGGILA
FT                   NDDPRAQTPPLEKVMALDWAQLKPVIADSLAHGAIEIGVVGDISEQAAIDTIAATFGAL
FT                   PPRRAAFDPRSEARVRDYAADRSERTLIHKGPAEQAELRVYWPARDDSDLAEAMRLNLL
FT                   ARVMQLKLTEELRERLGESYSPGAAASLSDEFPGYGHLFAASNVDYKDLATTRAAIFAI
FT                   AKELRDAPADPDLVDRARRPLVEAMTKARRENAYWLNYVAEATSQADRLDRSRNGIAEV
FT                   EAATPEELQALAQRYLTDDKALVIKAVSDKVGK"
FT   sig_peptide     595191..595277
FT                   /locus_tag="Sala_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            598112..598471
FT                   /locus_tag="Sala_0586"
FT   CDS_pept        598112..598471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0586"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52307"
FT                   /db_xref="GOA:Q1GVL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL5"
FT                   /protein_id="ABF52307.1"
FT                   /translation="MVSIVRLGSMRIGSLLLVTSLAISACARPEAGAMSSHFESSASID
FT                   ALATCISQNHEAAFPRFFSHEEDSARRVFKTYNGIAVAIDDDVARRRVTVSSPQALTTN
FT                   QANYIRQCISMSEAA"
FT   sig_peptide     598112..598195
FT                   /locus_tag="Sala_0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.823 at
FT                   residue 28"
FT   gene            complement(598468..598887)
FT                   /locus_tag="Sala_0587"
FT   CDS_pept        complement(598468..598887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52308"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL4"
FT                   /protein_id="ABF52308.1"
FT                   /translation="MQSRTLIRQLTEQPLVRDLSVDAAQAVLALRYSILCRRSGRDPMP
FT                   ELERRWGNMLAARRFRLVVEAIAHIWPDPFAVAPPCCPRLSFDEALLAAMVGAAARCDR
FT                   VDFDWRTAEMLGSDAREMLFAALENFIRAKAPGRV"
FT   gene            complement(599209..599691)
FT                   /locus_tag="Sala_0588"
FT   CDS_pept        complement(599209..599691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0588"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52309"
FT                   /db_xref="GOA:Q1GVL3"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL3"
FT                   /protein_id="ABF52309.1"
FT                   /translation="MKGDEKVIDFLNEALKNELTAINQYWLHYRMLDNWGVARLAHFER
FT                   EESIDEMKHADKLADRILFLGGLPNFQLLGRLRVGETVEEILKADLALEEEAIPLLKDA
FT                   IAHSESVRDYVSRDLFADILESEEHHVDELEKQFEMIERMGIENYIQLQSKPAGDD"
FT   gene            599843..600091
FT                   /locus_tag="Sala_0589"
FT   CDS_pept        599843..600091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52310"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL2"
FT                   /protein_id="ABF52310.1"
FT                   /translation="MAALGFATQLRIGRLGAPQLAAPRNIAQLALPYCVADTDDHVRIL
FT                   LNNPDVEIVRQIRNKKDATGSQSEEAYFSQVRPLPER"
FT   gene            600146..600376
FT                   /locus_tag="Sala_0590"
FT   CDS_pept        600146..600376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0590"
FT                   /product="phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52311"
FT                   /db_xref="GOA:Q1GVL1"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVL1"
FT                   /protein_id="ABF52311.1"
FT                   /translation="MKVNVYVTLKPGVLDPQGKAIHHALEGLGFTGVADVRAGRFIELD
FT                   VADDTSDVDLDAMCARLLANTVIENYRIERA"
FT   gene            600414..601079
FT                   /locus_tag="Sala_0591"
FT   CDS_pept        600414..601079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0591"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52312"
FT                   /db_xref="GOA:Q1GVL0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVL0"
FT                   /protein_id="ABF52312.1"
FT                   /translation="MKTAVIVFPGSNCDRDMAVALETVTGKAPAMVWHRETGLPEGTDF
FT                   IALPGGFSYGDYLRSGAMAARSPILRAVAEAAGRGVPVLGVCNGFQVLTEAGLLPGALM
FT                   RNAGLNFVCRTVPLKVENSQSLFTAAYGAGEEIAIPVAHHDGNYFADADTLDRIEGEGR
FT                   VAFRYLDGVNGSARDIAGVLNDAGNVLGMMPHPERAIDRAHGGTDGLRLFEAALGVLA"
FT   gene            complement(601041..601412)
FT                   /locus_tag="Sala_0592"
FT   CDS_pept        complement(601041..601412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52313"
FT                   /db_xref="GOA:Q1GVK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK9"
FT                   /protein_id="ABF52313.1"
FT                   /translation="MTLIEIAALFVERKSWIVAASDLSKDALHIYFGLALFLVVRLAWR
FT                   GRGGWIAAWLAVLAMAGGGEALDLIVEYGGSTVQPDTAHWHDIWNTMFWPTVLALVGRW
FT                   LPGTDAASGEDAERRLEQA"
FT   gene            complement(601416..602165)
FT                   /locus_tag="Sala_0593"
FT   CDS_pept        complement(601416..602165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0593"
FT                   /product="protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52314"
FT                   /db_xref="GOA:Q1GVK8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK8"
FT                   /protein_id="ABF52314.1"
FT                   /translation="MTDTPASPTPPVHVNAASVRHFRYYDLLMAAFVAILLLSNIIGAS
FT                   KPSYVVLPDGSEWAFGAGVLFFPISYIIGDVLTEVYGYARARRVIWTGFAALAFMAFMA
FT                   WAVVSLPPADGWPGQAAYEFVFGNSWRIVLASMTAFWVGEFANSYVLARMKLWTRGRFL
FT                   WMRTIGSTVVGQGLDSLIFYPLAFYGLAGWPPEQLYQVVLSQWLIKTLWEAALTPVTYV
FT                   VVGALKRREGVDVFDEGTDFTPFAAKV"
FT   gene            602240..602316
FT                   /locus_tag="Sala_R0004"
FT                   /note="tRNA-Arg1"
FT   tRNA            602240..602316
FT                   /locus_tag="Sala_R0004"
FT                   /product="tRNA-Arg"
FT   gene            complement(602400..603122)
FT                   /locus_tag="Sala_0594"
FT   CDS_pept        complement(602400..603122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52315"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK7"
FT                   /protein_id="ABF52315.1"
FT                   /translation="MSAQTTEIADGIFRLSVFVPDIEPPAGFTFNSFLILDDEPLLFHA
FT                   GQRSMFPLFSAAVEALMPLDRLRWLSFGHVEADECGAMNLWLQAAPHAQVVHGETACSI
FT                   SLNDLADRAPRVVQDGELITAGRRRIRYFDTPHVPHAWESGVIFEETSATLFCGDLFTQ
FT                   FGSREMTRDDIVAAAIAAEDAFHATSLGLATAPTIRRLADLQPRTLALMHGPTFQGDGA
FT                   HALRRLADYFEEMLRQPA"
FT   gene            603178..603777
FT                   /locus_tag="Sala_0595"
FT   CDS_pept        603178..603777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0595"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52316"
FT                   /db_xref="GOA:Q1GVK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK6"
FT                   /protein_id="ABF52316.1"
FT                   /translation="MSNPPEQNDRPKRSYRLGRRAKSRDLTRQRIVDAAIELHSSVGPA
FT                   RTTVAQIAERAGVQRHTYYAHFPDEWDLLLACSGTALGRDPLPDPARLGALPKGPTRLR
FT                   EGLSQFYDWFARNEGQAGCVLRDAEYHDPTRHIVALRMAPVFAAAASVMGEDLGRRATA
FT                   LLGVALDFSCWRALAGSCSPDEAAALMADAIMLIDG"
FT   gene            complement(603804..605306)
FT                   /locus_tag="Sala_0596"
FT   CDS_pept        complement(603804..605306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0596"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52317"
FT                   /db_xref="GOA:Q1GVK5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK5"
FT                   /protein_id="ABF52317.1"
FT                   /translation="MDKPRQGFAGLWNISFGFFGIQIGFALQNANMSRIFQSLGEDIER
FT                   LPGLWVAAPLTGLLVQPIVGHLSDRTWLGRLGRRRPYFLAGAILAAIALFAMPESPAIW
FT                   FAAAMLWLLDASLNISMEPFRAFVGDMLRKDQHSAGYAVQTAFIGAGAVVGSLFPAAME
FT                   AMGVANVAPPGQIPDTVKYAFWFGGAALFLSVLWTIVTTHEYDPATMAAFAASSPVAAA
FT                   LPAQDLAARSYGTGLVWIAAGIAVAAIQQHFALLREVLLLGALLIAYGLASIAAIAMAR
FT                   RGHSTNMLASIIGDFAGMPLLMKRLALVQFFSWSALFIMWINTTPIVAQYHYGALDAAS
FT                   ADYQAAANWVGQLFAIYNGVAAVAALTLLPWLSRRLGQAPTHMIGLGCGAIGFASFFML
FT                   RDPALLIVSEIFIGIFWASVLAMPYAILASSLPQAKLGIYMGLFNVFIVIPQLLVAALM
FT                   GSVMKAFFPGEPIHTMAFAAITLLVAIAAMARIVPMLARQRG"
FT   gene            complement(605507..606541)
FT                   /locus_tag="Sala_0597"
FT   CDS_pept        complement(605507..606541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0597"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52318"
FT                   /db_xref="GOA:Q1GVK4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK4"
FT                   /protein_id="ABF52318.1"
FT                   /translation="MGRPPSGKPTSFDIAYLAGVSQPTVSRALRGSKSVSAATRANIER
FT                   IARELNYTVDKNASSLRSQRTHTLALLFFEDPTPDDSMINPFFLSMLGSITRQCALRGY
FT                   DLLISFQQMHNDWHVDYQDSHRSDGIILLGYGDYQLYREKLEHLVAMDTKFVRWGSVSE
FT                   DDIGLTVGSDNIGAGEQAGAHLIEIGRRRIAFLGDASDHAPEFHDRYRGLCRAMRAAGI
FT                   EPDPALQRNAVSSEASGHAAAKTLLDSGACFDAIFAASDLIAIGAMRALTEAGLTMPQD
FT                   VAIIGFDDIPAANLTSPTLTTVMQDMKGAGELLVDALLRRIDGAEAERRVLPTRLVKRQ
FT                   STAV"
FT   gene            complement(606733..607476)
FT                   /locus_tag="Sala_0598"
FT   CDS_pept        complement(606733..607476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52319"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK3"
FT                   /protein_id="ABF52319.1"
FT                   /translation="MIRSLTLALLLAAGPLAAAQTAAPDYAAALADPARPAADRARDAE
FT                   RKPAELLAFAEIAPGEKVGDFVMGSGYVTRLLAAAVGPAGKVYAFQPAEFIAFRKQYGD
FT                   DQAAVDAAYDNVDAVGGPFAAPAFPEPLDTIVTVQNFHDLYLKPFPEGTGARGSAALFA
FT                   ALKPGGTLVVVDHSAPGGSGTALSDSLHRIDKAAVVAALTGAGFTLEAESDLYARVDDP
FT                   RTANVFDAAIRGKTDQFTLRFRKPG"
FT   sig_peptide     complement(607417..607476)
FT                   /locus_tag="Sala_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.553 at
FT                   residue 20"
FT   gene            complement(607540..608892)
FT                   /locus_tag="Sala_0599"
FT   CDS_pept        complement(607540..608892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52320"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK2"
FT                   /protein_id="ABF52320.1"
FT                   /translation="MTKLLPLSLVAATILAGCAAGPAKAPSGEPGVAALDVRRTAADAA
FT                   ALDAIAATYLRLSLEIGTHEPGYIDAYYGPAELKAAAEANPREKAALLAATRALLAETD
FT                   RTARRLSNPLARRRAAFLSAQLRAAETRLMMMDGTRFAFVDEAERLFGVRPQLKPLASY
FT                   DTELAKIEALVPGKGPLADRVEAYLDAFTIPKDRLRPTFEAAIAHCRRRSLAHIPMPAE
FT                   ESFRLEFVTDKSWSGYNYYQGGYHSLIQVNTDLPIRLSRALDLGCHEGYPGHHLLNMKL
FT                   EEKLVKERGWAEFSVYPLYSPQSLIAEGSANYGIDLSFPGEAKAATERDILMPIAGIAV
FT                   PADDRYWQLLAAIKRASGARLTIAQQYLDGEIDRSTAVALTQKYLLVSQPRAEQSVRFT
FT                   EQYRSYVINYGLGEAMVRAYVERGRPSRDEMWRRMERIVSEPTLPSDLMER"
FT   sig_peptide     complement(608833..608892)
FT                   /locus_tag="Sala_0599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.632 at
FT                   residue 20"
FT   gene            complement(608902..610176)
FT                   /locus_tag="Sala_0600"
FT   CDS_pept        complement(608902..610176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0600"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52321"
FT                   /db_xref="GOA:Q1GVK1"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVK1"
FT                   /protein_id="ABF52321.1"
FT                   /translation="MARSFPPPSALRDFLESESAGGILLIFAAILAMIVANSPLATLYH
FT                   DLIHAVTGPVLTDKLGPMTVHLWINDGLMAVFFLLVGLEIKREFVDGRLASWDRRRLPF
FT                   IAAAAGMAVPAALYMFFVGDEPGLAQGWAIPAATDIAFAMGVLALLGRRAPTSLKLFLV
FT                   TVAIVDDMGAVAIIALFYTAKINLLALGAAAAILGIMFACNRGGVKNLLVYMALFLLLW
FT                   YAMLLSGVHATIAGVLAAMAIPFERTPGAPDSQTSPLHRLEHALHPTVAFAIVPLFGFA
FT                   NAGVDVRALGLDQLFAPLPLGIAAGLFLGKQIGIFGSVWLAVKLGIAGRLRGATWLQVY
FT                   AVSMLCGIGFTMSLFIGSLAFPGNALLIEEAKIGILMGSLASALVGFAVLRLAPLHPEH
FT                   NAVESASKGEIAVDGDVRDTSEAAR"
FT   gene            610286..611737
FT                   /locus_tag="Sala_0601"
FT   CDS_pept        610286..611737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0601"
FT                   /product="bacteriophage N4 adsorption protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52322"
FT                   /db_xref="GOA:Q1GVK0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVK0"
FT                   /protein_id="ABF52322.1"
FT                   /translation="MPSVGRGWQVELSTGWLEWLVLGAGRELMLFASVGILLIGLDDLL
FT                   LDALWLATRGQRRGETARAPPIEGRIAIFVPAWDEAAALPAMLCRTLAAWDGEDFRLYV
FT                   GCYPNDTATIYAVSQLVARDARLRLVIGESEGPTTKGDNLNRLWAALCADERVEARRFA
FT                   AIVLHDAEDHVHRHELALYRQHLAHNAMVQIPVVPIIDRRARWIGGHYADEFAEAHGKD
FT                   MPVRSRLGLPLPSAGVGCALTRSALALLAMERGGCPFSSDSLTEDYEIGMVIGAYGLGA
FT                   RFVDAADPAGDRIVSRGAFPGRIDAAVRQKSRWIAGIAMAGWDHLGWPGCRLGHKQRST
FT                   GRDLLARWMLWRDRRAPLAALILLAAYAGLILVAAGVAGQLLLGWNAIEPGPTLQWLLV
FT                   VNALLLGWRMALRIHFTARLHGWREASFAVPRAFVANIIAMLAARRSVLLYWRILRSGE
FT                   VVWDKTDHSETGLAVADAPVRVAMR"
FT   gene            612046..612852
FT                   /locus_tag="Sala_0602"
FT   CDS_pept        612046..612852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52323"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ9"
FT                   /protein_id="ABF52323.1"
FT                   /translation="MPHRRDGAAAGPAVSLVPAPGSNVMTTGRDEPRRPVAARHTAAAQ
FT                   AEPVWTGRQMAGWSASTWLYFRDGSDEAPRRIGVSSSLGGSQGGVRLAYGFGPTGRLRA
FT                   YARATMAFERPGQREGAFGLAFAPIADMPVDVAIEQRVAAGRDGRTALAAMASGGVSEV
FT                   GLPAGFRLDVYGQAGIVGARRRDGFADGAVVIDRGLGRGDASLRLGVLAAGAVQPGAAR
FT                   VDVGPRLTLRLPEAGQGSRIALDWRQRIAGDARPASGLALTLAADF"
FT   gene            612922..613869
FT                   /locus_tag="Sala_0603"
FT   CDS_pept        612922..613869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0603"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52324"
FT                   /db_xref="GOA:Q1GVJ8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ8"
FT                   /protein_id="ABF52324.1"
FT                   /translation="MQFCAADACFGAFVDLYLPVANLSVNALVIILLGGGVGFLSGMFG
FT                   VGGGFLTTPLLIFYGIPPTVAAASAATQVTGASVSGALAHLERGGVDLRMGAVLVVGGL
FT                   LGSLIGAGLFELLTAWGQIDTVINMLYVALLGSVGSIMAREAWAALQNMRAGLPAPARK
FT                   RRHHPMVANLPLRWRFYRSGLYISPLAPLILGMVVGILTMLLGVGGGFIMVPAMLFLLG
FT                   MGTQVVVGTSLFQILFVTIATTMVHALTTGAVDIVLAGLLLLGSVTGAQIGARFAQSVK
FT                   PEYLRMALAVIVLLVAARMAVDLFIRPDEIYTVQ"
FT   gene            613866..614639
FT                   /locus_tag="Sala_0604"
FT   CDS_pept        613866..614639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52325"
FT                   /db_xref="GOA:Q1GVJ7"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ7"
FT                   /protein_id="ABF52325.1"
FT                   /translation="MTGVRALILWLALTLLPLTAARATDPRLVPDVSSRAIDIQYSFTG
FT                   EELLLFGAILYPDQRLPDDRADIVVVLKGPVRPIVLREKRRVAGIWVNARSIRLRTAPS
FT                   FYAIGSSRPIDRLVDERTAAIFELGLANLSMSPTGFSEAKTLERFEAGLIDLYRRAGLF
FT                   VENPSAVEITEGVLYRARIPVPARVPVGTYRAETYLISRGRVLAVASRDVQIRKTGFER
FT                   FVARAAEEHGFLYGLSAVLMSLGLGYAASAVFRRR"
FT   sig_peptide     613866..613937
FT                   /locus_tag="Sala_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.925 at
FT                   residue 24"
FT   gene            614727..616436
FT                   /locus_tag="Sala_0605"
FT   CDS_pept        614727..616436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0605"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52326"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ6"
FT                   /protein_id="ABF52326.1"
FT                   /translation="MDMQGGFGAGDSTAVQHVRLAGGGVAAPVTPGTAHHRDELLIGEV
FT                   VDVSGSASRILLDAATIARLSSSGDATVAMAGQVGAQVKVRVGNIWLVASIRDQQLHER
FT                   GEGLILATIDLLGEGEEEKITGRIHNFRRGVTRYPVPGSPVFAATSADLKQIYAADERA
FT                   HVEIGTVHPTKDVRGSLYVDAMLGKHFALLGSTGTGKSTSAALILHKICELAPQGHIVM
FT                   IDPHGEYSAAFKGTGALFDVDNLAMPYWLMNFEEHCEVFVTAEGRDRQADCDVLARCLL
FT                   QARIKNRLAEGMTKITVDSPIPYLLSDLLSILTNEMGKLDKATSSAPFMRIKGKIEEMR
FT                   ADPRYNFMFSGMLVADTMANFLSKIFRLPSDGRPISIIDVSGVPSDITGVVVAVLSRLT
FT                   FDYAIWSRGEPQRPILLVCEEAHRYIPSKDIGQGQAVRKILERIAKEGRKYGVSLGLIT
FT                   QRPSDLAEGVLSQCGTIIAMRLNNERDQHFVKAAMPEGARGFIDSIPALRNRECIVCGE
FT                   GVSIPIRVYLDTLEEEKRPASSDPLFSKLWRETGGEAEIVERVVKRWRSQGR"
FT   gene            complement(616832..617224)
FT                   /locus_tag="Sala_0606"
FT   CDS_pept        complement(616832..617224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0606"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52327"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ5"
FT                   /protein_id="ABF52327.1"
FT                   /translation="MAVGHVKGIGGLFFRARNPEALNAWYRERLGVGAGCNADDSGPVD
FT                   EWSWTTAGGPLVFSAFKADTDYFAADRQFMINLRVDDLDAVLQPFREAGEEIITKDEWD
FT                   DPAVGRFARVHDPEGNPIELWEPPRS"
FT   gene            complement(617263..618393)
FT                   /locus_tag="Sala_0607"
FT   CDS_pept        complement(617263..618393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0607"
FT                   /product="cell wall hydrolase, SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52328"
FT                   /db_xref="GOA:Q1GVJ4"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ4"
FT                   /protein_id="ABF52328.1"
FT                   /translation="MKPELTLTARSTWRDPPPERSAGPGRAFWAAIGGVSVVACFAFLL
FT                   SSGQFRAPSIFAPYSVSVPVDFRPYDPERWAIMTAGDYEAALKIDPTLPDPRSIDFSDA
FT                   TALPPADPAALREEAFAGPPARPYVFRGLTALDRERAHYCLTAAIYYEAASESDDGMRG
FT                   VAQTIINRVRHPSFPGTVCGVVFQGSQRAGVCQFTFACDGAMARAPERRNWLRASRVAS
FT                   AALGGQVYAKVGLATHYHTQAIWPRWGKSLVMTNIVGAHIFHRWRGRWGMPDAFRAPYL
FT                   GREPVPGPYLPVAQQLAILKGQGIAPGAGPLPALTGAAAPLPDAAPAPLLPGALAPAPP
FT                   GAPAAAAPAAPSYTDPRLNQSGQVREEFSKSGEWKR"
FT   gene            complement(618574..619089)
FT                   /locus_tag="Sala_0608"
FT   CDS_pept        complement(618574..619089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52329"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ3"
FT                   /protein_id="ABF52329.1"
FT                   /translation="MRRILSCSIALASSATVLSSCAALPEPPESLAAYWHARTDPHGYV
FT                   ASIGYFTPAQMRDADWEFRRIQNAAGSLCTGYRYAVRRDVQWFKTRPGSHGRCARVIYS
FT                   FRCMAEADIGKPIPPDALEATRAHIMSQPVEKPLEPDCGEKDSTKIHRPRPQPDAPAHP
FT                   AGAMPHQQ"
FT   sig_peptide     complement(619021..619089)
FT                   /locus_tag="Sala_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.914 at
FT                   residue 23"
FT   gene            619301..619846
FT                   /locus_tag="Sala_0609"
FT   CDS_pept        619301..619846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0609"
FT                   /product="protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52330"
FT                   /db_xref="GOA:Q1GVJ2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVJ2"
FT                   /protein_id="ABF52330.1"
FT                   /translation="MVDFDALHAIIAPEAEAMGLALVRVAFFGGDSDPTLQVMAERPDT
FT                   RQLTIDDCADLSRRISDRLDALEEAGQDPIDVAYRLEVSSPGIDRPLTRPADFADWAGH
FT                   EAKIALKEKLDGRQRFNGTLVGIDGDVVTISDKEGVEHKLPFGAIDTAKLVLTDKLIAA
FT                   TVPLSAEGADEMEEEGQD"
FT   gene            619846..621492
FT                   /locus_tag="Sala_0610"
FT   CDS_pept        619846..621492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0610"
FT                   /product="NusA antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52331"
FT                   /db_xref="GOA:Q1GVJ1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ1"
FT                   /protein_id="ABF52331.1"
FT                   /translation="MATAISANKAELLAIANSVASEKMIDKAIVIEAIEEAIQRAARAR
FT                   YGAENDIRAKLDPQTGDLRLWRVVEVVETVEDYFKQVDLAAGQKLQKDARIGDFIVDPL
FT                   PAVDLGRIDAQSAKQVIFQKVREADRERQYQEFKDRAGEIITGVVKSVEFGHIVVNLGR
FT                   AEGVIRRDQQIPRELMRVGDRVRALILSVRSETRGPQIFLSRAHPDFMKKLFAQEVPEI
FT                   YDGIIEIKAAARDPGSRAKIGVISYDSSIDPVGACVGMKGSRVQAVVQELQGEKIDIIP
FT                   WSEDTATFVVNALQPATVQRVVIDEDDGRIEVVVPDDQLSLAIGRRGQNVRLASQLTGK
FT                   QIDIMTEADASEKRQREFVERSTMFQEELDVDETLAQLLVAEGFSELEEVAYVPLDELA
FT                   SIEGFDEELAQELQSRAAEGLERREEAARAERRELGVEDALADIPHLTEAMLVTLGKAG
FT                   IRTLDDLADLATDELIAKKRTDNRRGPARSERAEDKGGVLGEYGLSEEQGNEIIMAARA
FT                   HWFDDEESSEPATAPAAEPQNGEAADADPAQ"
FT   gene            621473..622231
FT                   /locus_tag="Sala_0611"
FT   CDS_pept        621473..622231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0611"
FT                   /product="protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52332"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVJ0"
FT                   /protein_id="ABF52332.1"
FT                   /translation="MRTPRNDQLSQTDRAKGRGHHVPERRCVVTGEVSPVERLVRLALG
FT                   PDGGIAPDVHGKAPGRGAWIGVDRVTLEAAQAKGKLKAGLARALHEGGFTIPDDLGARI
FT                   EAQLARATLDRLGLESRAGMLISGNDKIEQAARRGQVRLLLHASDAGDDGRKKLAQAWR
FT                   VGEDDEGSGREGLVLPVDRGTLSMALGRENAVHLAIVDARAADRVLAHLSRWQFFTGWS
FT                   RDAANRVSDTDSREPGTGDTSAASAVSGAF"
FT   gene            622249..624786
FT                   /locus_tag="Sala_0612"
FT   CDS_pept        622249..624786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0612"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52333"
FT                   /db_xref="GOA:Q1GVI9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVI9"
FT                   /protein_id="ABF52333.1"
FT                   /translation="MSDEQDKPTLSRKPLGLKRTVEAGQVQQQFSHGRRNTVVVEVKRR
FT                   RVLGRPGEAAPTPEVEEAKAAPAPAPAPAAPRPAAPKPAAVDSLMTRQERQAQLLREAE
FT                   EARMAALEENRRREEAERARAAEEERARAEKREEQAATKAPEPAPTPAASAPDATAADA
FT                   PPAAEGPVETAARPATASAAPAPRRFTPVEALKRPEPKRPEPKASRGGENRRQSGKLTV
FT                   TRALNEDEGARARSLAALKRAREKEKRSHMTSSGPREKQVREVVVPDTITVQELANRMA
FT                   EKGADLVKALFKMGMPVTVNQTIDQDTAELLVTEFGHEIKRVSEADIDIRHDEDVDDAA
FT                   QLKPRAPVVTIMGHVDHGKTSLLDALRGANVQAGEAGGITQHIGAYQVKAKDGSVITFL
FT                   DTPGHEAFTEMRQRGANVTDIVILVVAADDGLKPQSIEAINHAKAAGVPIIVAINKVDK
FT                   EGANPQRVRERLLEHELVVEEMGGDVQNVEVSALKKTGLDKLLDAIALQAEIMELKANP
FT                   DRAAEGTVIEAKLDKGRGPVATILVRRGTLKVGDIFVCGAESGRVRALVDDHGKQVKQA
FT                   TPSMPVEVLGLGGVPMAGDTLIVVENEARAREVAAYRQEQALKKRTAQAPVSLEGMFSA
FT                   LADKANVIEYPVVIKGDVQGSVEAIVNALNKLSTDEIRVRVLHAGAGAITESDVTLAAS
FT                   TRAPIIGFNVRPNAKAREIANREKVRFLYYDVIYHLTADVAKEMAGELGPERIENVVGR
FT                   AEVKDVFPAGKRDKAAGLLVLEGSIRKGLHARLTRDDVIVSATTIASLRRFKDDVAEVR
FT                   AGLECGVVLADTNDIKPGDHLEVFEVELRERTL"
FT   gene            624839..625249
FT                   /locus_tag="Sala_0613"
FT   CDS_pept        624839..625249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0613"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52334"
FT                   /db_xref="GOA:Q1GVI8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVI8"
FT                   /protein_id="ABF52334.1"
FT                   /translation="MRHKEQSEGPSVRVLRVGEQVRHVLSEILARGDVHDDVLATHPVS
FT                   VTEVRMSPDLRHATVFVKPLLGKDEEAVLKAMRTNTAYLQREVAHRIRMKYAAKLKFLA
FT                   DDSFDEASHIDRLLRDPKVARDLEGGDEGDQG"
FT   gene            625278..625709
FT                   /locus_tag="Sala_0614"
FT   CDS_pept        625278..625709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0614"
FT                   /product="Aromatic ring-cleaving dioxygenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52335"
FT                   /db_xref="GOA:Q1GVI7"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI7"
FT                   /protein_id="ABF52335.1"
FT                   /translation="MDPKAACMTDPDAPYHAHVYYDPAERSAAAALRDDFGRNSAILFV
FT                   GAMADGAAGPHPIAQYEVHFLARSRDAVVAAIAATGLRALVHPLTDDDVADHTSLAQWI
FT                   GEPVDLDLTVLDPPGGNQGIPRFGLSDFQASTGPSAPST"
FT   gene            complement(625673..626785)
FT                   /locus_tag="Sala_0615"
FT   CDS_pept        complement(625673..626785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0615"
FT                   /product="tRNA synthetase, class II (G, H, P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52336"
FT                   /db_xref="GOA:Q1GVI6"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI6"
FT                   /protein_id="ABF52336.1"
FT                   /translation="MTKAPALLPEGLRDRLPRQAEAASRVTRALVDAMRAHGYGRVSPP
FT                   LAEFRETLGSDDDRSGRDLLRFTDPVSQRTLALRPDITRQVGRIATSLLAASPRPLRLC
FT                   YAGQVVKLRASQLRPAREMLQVGAELIGSDSVAAAREIVTVAIDALEAAGIGPVTIDFT
FT                   LPDVVDLLAFGPLPVTADLQQLRDELDAKDAGALARIGAGAYLPLLRATGPFDRAITDL
FT                   RAFDTSGVLGGRIDALEAIAAPIRDRVTLTLDPTERHGFAYQSWFGFQIFVPGQGDAVG
FT                   RGGAYAIPVGEAEEAAVGFSLYPDPLIDAGLGAEDMAERRIFLPLGHDAAVAASLRADG
FT                   WRTVAALTDADDATRLGCAYVLGADGPVEA"
FT   gene            complement(626996..628582)
FT                   /locus_tag="Sala_0616"
FT   CDS_pept        complement(626996..628582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0616"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52337"
FT                   /db_xref="GOA:Q1GVI5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI5"
FT                   /protein_id="ABF52337.1"
FT                   /translation="MTQPKVLISDKMDPKAAAIFKERGIRVDEITGKTRDELIAMIGDY
FT                   DGLAIRSATKVTADVLAAATKLKVVGRAGIGVDNIDIPEASKKGVVVMNTPFGNSITTA
FT                   EHAIAMMFALARQIPEANALTQAGKWPKNDFMGVELTSKTLGLIGCGNIGSIVAERALG
FT                   LKMKVVAFDPFLTPERAIELGVEKVDLDTLLARADFITLHTPLTDQTRNVLSKENLAKT
FT                   RKGVRIINCARGGLIDEAALKDALDSGHVAGAALDVFAVEPPPADHPLFNTPNFICTPH
FT                   LGASTDEAQVNVAIQVAEQISDYLLTGGITNALNVPSLSAEEAPKLRPYMSLAEKLGSL
FT                   VGQLAHDNLTHISVEVEGAAAELNLKPIVAAVLTGLMRRYSDSVNMVNAPHLARERGLD
FT                   VREVRHDREGDYHTLVRVTVATEAGDRSVAGTLFGNNEPRLVEMFGIKVEADLDGDMLY
FT                   IVNEDAPGFIGRIGSTLGDAGLNIGTFHLGRRAAGGEAVLLLSLDSPMPEPLLWQVCQL
FT                   PGVKMVKGLKF"
FT   gene            complement(628726..629856)
FT                   /locus_tag="Sala_0617"
FT   CDS_pept        complement(628726..629856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0617"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52338"
FT                   /db_xref="GOA:Q1GVI4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI4"
FT                   /protein_id="ABF52338.1"
FT                   /translation="MMSEVTTPEVRPQRPYFSSGPCAKPPVWSPDKLATESLGRSHRAK
FT                   IGKTRLAYCIDLMREMLQLPDTHRIGIVPGSDTGAFEMAMWTMLGARPVTALAWESFGE
FT                   GWVTDAAKQLRLDPTIIRADYGQLPDLTQVDWSNDVLFTWNGTTSGVRVPNGDWIADDR
FT                   AGLSFADATSAVFAYDLPWDKIDVATFSWQKVLGGEGGHGVLILGPRAVERLETHTPAW
FT                   PLPKVFRLMSKGALAEGVFKGETINTPSMLAVEDAIFALEWAKSLGGLDGLKARSDANA
FT                   AALDKIVEERDWLSHLAADPASRSKTSVCLSVAGADADFIKTFAGLLEKEGAAYDIAGY
FT                   RDAPPGLRIWCGATVDTADIEALGPWLDWAYVSLKS"
FT   gene            630026..630727
FT                   /locus_tag="Sala_0618"
FT   CDS_pept        630026..630727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0618"
FT                   /product="Extensin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52339"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI3"
FT                   /protein_id="ABF52339.1"
FT                   /translation="MLFAPILKPRTLLAVTAALALSACFGAPDVMKKDSGNRPAASKPT
FT                   RPQPVGTPSFTSAEAQQCAFDLQQAGVRFTPLPNQDHGGGCTSIDSVKLLDVGVPVSGL
FT                   GPMTCPLARNFSAWAQFAVKPAARRYFGTEVVKIETFGTYSCRNIYGGRSGRLSQHAYS
FT                   NAIDVSGFVLADGRRILLDGGWKGDLASQDFLRALHKSACRRFGTVLGPDYNAAHHDHF
FT                   HFDMSGNGYCR"
FT   sig_peptide     630026..630106
FT                   /locus_tag="Sala_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.883 at
FT                   residue 27"
FT   gene            630889..631764
FT                   /locus_tag="Sala_0619"
FT   CDS_pept        630889..631764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0619"
FT                   /product="conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52340"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI2"
FT                   /protein_id="ABF52340.1"
FT                   /translation="MAEDKQPHRSRFHKAKDDAQFAQQATTTPQTAHPAYRLAFQDNDF
FT                   LLREDLRPVRFQLELLKPELLLDEAGIESTLVVYGSARIPEPGEADALEAAATDDATRN
FT                   IARRLKAKAKYYDEARALARLASQYPCDDKGCRHFVVCSGGGPSIMEAANRGAADEGRE
FT                   SIGLNIVLPHEQAPNRFVTPSLSFQFHYFALRKMHFLLRARAVCVFPGGFGTFDEMFEL
FT                   LTLIQTGKIKPIPIVLFGKEFWQRVVNFEALVEEGVVSARDLGLFQFVETADEAWKIIQ
FT                   DFYANIEEQH"
FT   gene            complement(631946..632389)
FT                   /locus_tag="Sala_0620"
FT   CDS_pept        complement(631946..632389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0620"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52341"
FT                   /db_xref="GOA:Q1GVI1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI1"
FT                   /protein_id="ABF52341.1"
FT                   /translation="MRTAPVLLAGALLLAGCGKSDAPPTDDPVADSPATGESATDAPAV
FT                   EPTAAMGEQIFRRCVACHTVDKGGRHGIGPNLHGIVGAPVAAKAGFSYSGAMKAKGGVW
FT                   DEAALDAYLKAPMKDVPGTRMAFAGVVDATDRKALILYLQAQK"
FT   sig_peptide     complement(632327..632389)
FT                   /locus_tag="Sala_0620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.878) with cleavage site probability 0.839 at
FT                   residue 21"
FT   gene            complement(632389..633027)
FT                   /locus_tag="Sala_0621"
FT   CDS_pept        complement(632389..633027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0621"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52342"
FT                   /db_xref="GOA:Q1GVI0"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVI0"
FT                   /protein_id="ABF52342.1"
FT                   /translation="MDNRNNTIAGWVLFAGICALGLTIGSSMLFATHAPEKPGYPIEDA
FT                   EAGAGGGESAVPLANLLAAADPAKGEAVFAKCAACHTINAGGANGIGPNLYGALGKAHG
FT                   HVPGFAYSEALKSVPGNWDFASMDEWLKSPRKYAPGTKMSFAGLSSPEDRANLIVYMNT
FT                   QGSNLPLPPVEEVATADAAAGAAEGAAPAAEGAAAPAAEGAAAPAEATK"
FT   sig_peptide     complement(632932..633027)
FT                   /locus_tag="Sala_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.958 at
FT                   residue 32"
FT   gene            633209..634102
FT                   /locus_tag="Sala_0622"
FT   CDS_pept        633209..634102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0622"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52343"
FT                   /db_xref="GOA:Q1GVH9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH9"
FT                   /protein_id="ABF52343.1"
FT                   /translation="MGSYSASAQHLVDKMRALALAEPARGLAFQGAPGANSDLAAREYD
FT                   PNSLPLPCYAFEDAIDAVREGLVDRAIIPIENSLHGRVADIHFLLPESGLSIVGEHFLP
FT                   IRYGLMSRNLGPVTRAMSHEQALGQCRKWLRANNIAPVAHSDTAGAAAWVADSDEVGLA
FT                   ALAPPHAADLYGLTLHGTGMEDADHNMTRFVVLAREPLRDLSAVEGPVMTTFMFEVKNI
FT                   PAALYKALGGFATNGVNMTKLESYQTGGSFAATKFYADIVGAPGDERVDRALEELDFQT
FT                   KSLRLLGTYPQARPRP"
FT   gene            complement(634108..634782)
FT                   /locus_tag="Sala_0623"
FT   CDS_pept        complement(634108..634782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0623"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52344"
FT                   /db_xref="GOA:Q1GVH8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH8"
FT                   /protein_id="ABF52344.1"
FT                   /translation="MSKYEPVAKAPVRIQQNILARGERRLLNWLCARLPAWVTPDQLTA
FT                   LGFAGAVLVAAGYLLSWFDSEWLGLCLVGYIVNWFGDSLDGSLARWRGIERPNYGYFVD
FT                   HSVDAIATFLMISAIGMSPYMRLDVALMGVIGYFLLSIHTFISAKILGEFRLSYMAGGP
FT                   TELRLMLMAMTALMPVVGGADVAGTNFSAFDLFALVVASILVTLFVVQTSMTARMLRRR
FT                   GN"
FT   gene            complement(634902..635393)
FT                   /locus_tag="Sala_0624"
FT   CDS_pept        complement(634902..635393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52345"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH7"
FT                   /protein_id="ABF52345.1"
FT                   /translation="MIAALLFAAALTADPAATPSEAPVAHPAPVADTDLREFAAIAGRK
FT                   VAGRPVGGPWPTADKVLLIARDDKGYPVVAASLGFPVRQSLPAPPDGTLAVVRLHQRSE
FT                   TIVPGPTADDLAFVAANKLPLFVIGEWARPAPMWEVAWVDGAVRFRTIGEVGEIGPWRD
FT                   "
FT   gene            complement(635390..638203)
FT                   /locus_tag="Sala_0625"
FT   CDS_pept        complement(635390..638203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0625"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52346"
FT                   /db_xref="GOA:Q1GVH6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH6"
FT                   /protein_id="ABF52346.1"
FT                   /translation="MSEKNHLYLVDGSSYIFRAYHRLPPLTNPRGVPVGAVYGYTTMLW
FT                   KLAKDLHDADGPTHLAVILDHSSESFRNEIYDQYKANRPDPPEDLVPQFPLIRDATRAF
FT                   SLPCIEMEGFEADDLIASYTEAAVREGWDVTIVSSDKDLMQLIREPAGGPHVDMLDTMK
FT                   NVRLGIDAVNEKFGVTPDLVGDVLALMGDSVDNVPGVRGVGPKTATKLIQEYGSLTAAL
FT                   DGAETMKPGKLRENLIEHRAMAELSRILVDLKRDCPLPDPLDALKLGAIPPEPLKLFLD
FT                   EHGFRSLSAKLDLGTAPAGPPTLPRAGAAPVTPAADAPSTPTLPSMPPIDRARYETVTT
FT                   IEALDRWIADARAAHVVAVDTETASLDSVTGRLVGVSLSTGAGKACYIPLGHGGTDMFA
FT                   EKPEQIAMGDALERLGALFADDAVLKVGHNLKYDIGVLAQHGVTVAPYDDTLLMSFALD
FT                   AGKHQHGLDELAKLHLDHVCLSFKDVCGTGKSQISFAEVQLDRATEYAAEDAEVAWRLW
FT                   KLLKLRLPLEGGTRVYEMVDRPLAAVVEGMERAGIMVDRDYLAKLSGEFANEMLRIEGE
FT                   IHALAGQPFAIGSPRQLGEILFDKMGLKGGRKGKSGDWSTDQNELERLERDGVPIARKI
FT                   LEWRQLAKLKSTYTDALQEQVNATTGRVHTSYSLVGAQTGRLSSTDPNLQNIPIRTEVG
FT                   RQIRDAFIAAPGHVLIAADYSQIELRLAAHMADVPELKEAFARGDDIHAATAIELFGEV
FT                   NRDTRGKAKTVNFSILYGISRWGLAGRLEITPDEAQALISRYFERFPGISDYISDTLET
FT                   ARARGYTETLFGRKTWFPRIKAANQNERAGSERAAINAPIQGTSADLIKRAMARMPGAL
FT                   ADAGLADVKMLLQVHDELVFEAPEDKAAAAGEVIRAVMMGAAEPALKLSVPLEVEIGTG
FT                   KSWGDAH"
FT   gene            complement(638262..638720)
FT                   /locus_tag="Sala_0626"
FT   CDS_pept        complement(638262..638720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0626"
FT                   /product="Gentamicin 3'-N-acetyltransferase"
FT                   /EC_number="2.3.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52347"
FT                   /db_xref="GOA:Q1GVH5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH5"
FT                   /protein_id="ABF52347.1"
FT                   /translation="MIVRRLGPGDIAAVRALNAVYGAAFDDPETYRADRPDDAWLARQL
FT                   GREGVIVLVAELDGNIVGGLTAYELPKLEAARSEIYLYDLAVDAAHRRCGIATALIGEL
FT                   QHIAAETGAWAVFVQADHGDDPAVALYTGLGAREDVMHFDLPPRPRGA"
FT   gene            complement(638827..639090)
FT                   /locus_tag="Sala_0627"
FT   CDS_pept        complement(638827..639090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52348"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH4"
FT                   /protein_id="ABF52348.1"
FT                   /translation="MLRARRKGAGIWIYFKTFRRCHGQNRSNPEGTPKWLQSRTFAALR
FT                   VAMLPAAPAKARYLRHFDASNGELMGPDPRGRRCSDGQRSAA"
FT   gene            639242..639535
FT                   /locus_tag="Sala_0628"
FT   CDS_pept        639242..639535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH3"
FT                   /protein_id="ABF52349.1"
FT                   /translation="MMDDWRVDDLALCISRHERYPPEVRPGAVLTVRAVLVDMPDLAGG
FT                   QAGTALNFRDVPDLGPRAAYCARRFRKITPGAPDSFDAEVIDLMADATRVGR"
FT   gene            639690..640253
FT                   /locus_tag="Sala_0629"
FT   CDS_pept        639690..640253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0629"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52350"
FT                   /db_xref="GOA:Q1GVH2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH2"
FT                   /protein_id="ABF52350.1"
FT                   /translation="MGIIGSSIKPFSATSYHQGKFVPVTDADVKGKWAVFFFYPADFTF
FT                   VCPTELEDLADQYETLQSLGVEVYAVSTDTHFSHKAWHDSSPAIGKIAYHMLGDQNHVL
FT                   ANNFGVLREDSGLADRATFVVDPDGVIQVMEITCEGVGRNAGELVRKIKAAIHVRANPG
FT                   QVCPAKWEEGAETLAPSIELVGKI"
FT   gene            640393..641955
FT                   /locus_tag="Sala_0630"
FT   CDS_pept        640393..641955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0630"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52351"
FT                   /db_xref="GOA:Q1GVH1"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH1"
FT                   /protein_id="ABF52351.1"
FT                   /translation="MPMLDPNTTAQLKTYLGNLRHPIELVASLDASPKSVEMRALVEEV
FT                   AAQSDRITARFDGDDVRRPSFAIRGDEGKAEAVFAGLPMGHEFTSLILALLHVGGHPPK
FT                   EDAELLDAVRALEGDFTFETFFSLSCQNCPDVVQALNIMAALNPNIRHTAIDGALFQDE
FT                   VERRQVMAVPAVFLNGEPFGQGRMDLAQIVAKLDAGAVARAAGKIAAKEPFDVLVVGGG
FT                   PGGAAAAIYAARKGIRTGIVAERFGGQLLDTLGIDNFVSVQHTEGPKLAAQLEAHVKDY
FT                   DVDVMNAQEAAALIPGGANGLHEVKLKSGASVKGKTVILSTGARWRQMGVPGEAEYRGR
FT                   GVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVAHVTLIEFDSQLRADAVLQTK
FT                   LGSLPNVTVITSALTTEVLGNGEKVVGLRYRDRGTDEEHLIELEGIFVQIGLVPNTEWL
FT                   GDAVALSGRGEIEVDARGATSQPGIFAAGDVTTVPYKQIVIAMGEGSKASLSAFDHLIR
FT                   AGA"
FT   gene            complement(641971..642459)
FT                   /locus_tag="Sala_0631"
FT   CDS_pept        complement(641971..642459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0631"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52352"
FT                   /db_xref="GOA:Q1GVH0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVH0"
FT                   /protein_id="ABF52352.1"
FT                   /translation="MERIETEASGGCQCGAVRYHVSAVLDTSHICHCRMCQKAAGNFFI
FT                   ALIGVPRDAIRWTRGSPATFNSSDKAARGFCRDCGTPLSYDYFDSKHINLTTGSFDDPS
FT                   QFPPRFQFGLEGQMPWFAELSIPAEGTTEETMAAYVGAIKASNHQHPDHDTDVWPEGR"
FT   gene            complement(642513..643217)
FT                   /locus_tag="Sala_0632"
FT   CDS_pept        complement(642513..643217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0632"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52353"
FT                   /db_xref="GOA:Q1GVG9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG9"
FT                   /protein_id="ABF52353.1"
FT                   /translation="MEPILIYGFPLGSSMGLVAALEWLGKPYRLCRVDMLGEMREPAYA
FT                   RINARHETPALITDQGRVLTETMAIASWLAVRDDERRISPDPLSPEADRMRQIMAFINT
FT                   GFTGAFSPLWAAMEMDPPRPALQASLREFGREAVIERHDKLEAMAGDGPYLVGDRPTLA
FT                   DALFVGVARWLDFHEVAPPTRWPKLAALRARLEADPAVVHATALESGESAAGGGLCRGH
FT                   LPLAEVIARFGT"
FT   gene            643328..643672
FT                   /locus_tag="Sala_0633"
FT   CDS_pept        643328..643672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0633"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52354"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG8"
FT                   /protein_id="ABF52354.1"
FT                   /translation="MKELVSRCPIEEVMQLLGGRWPSLLIYYLSDGTKRFSDLQRDNPT
FT                   ISHKMLTLELRKLEDAGIVRRTDFDGYPRRVEYGLTEDGERLVPLIDALGDWWGSMVAA
FT                   PADATVVAAD"
FT   gene            complement(643677..645290)
FT                   /locus_tag="Sala_0634"
FT   CDS_pept        complement(643677..645290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0634"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52355"
FT                   /db_xref="GOA:Q1GVG7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG7"
FT                   /protein_id="ABF52355.1"
FT                   /translation="MARLPYRPAMPTPDPSAAPESILIIDFGSQVTQLIARRVREAGVY
FT                   SEIVPFSAAEAALARMRPKGVILSGSPASVPAEGSPRAPRSIFDSGLPILGICYGQQVM
FT                   SQQLGGKVEPGGIDGERDGEFGRAFLTVTEPCVLFDGLWQVGERHQVWMSHGDRVTRFA
FT                   PGFRIVAVSDGAPFAVIANDERRYYGTQFHPEVVHTPDGAKLIANFVRHVCGCSGDWTM
FT                   AEFRTTKIAEIRAQVGDQRVLCGLSGGVDSAVAAVLIHEAIGEQLTCVFVDHGLLRMNE
FT                   REQVERLFRDHYNIPLVVVDAEERFMAGLAGITDPEQKRKFIGAEFINVFEEEARKIGG
FT                   ADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRLL
FT                   GKELGLPDIFVGRHPFPGPGLAIRIPGEVSKERCDILRKADAVYLEEIRNAGLYDAIWQ
FT                   AFAVLLPVKTVGVMGDGRTYDHVCALRAVTSTDGMTADIYPFDASFLSRCATRIINEVQ
FT                   GINRVVYDYTSKPPGTIEWE"
FT   gene            645456..647861
FT                   /locus_tag="Sala_0635"
FT   CDS_pept        645456..647861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0635"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52356"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG6"
FT                   /protein_id="ABF52356.1"
FT                   /translation="MNDNRSFLSARTVLLAASAGVALPVAAAAQVGPQAVAALVDQPAD
FT                   QAPPASEAVENAYDDYADGAIVVTAPRLSGQLDTDIKAEAELDEAAIASYGVSNVSELL
FT                   EALAPQTRSGRGRGSGRPIILINGRRIGGFGEVRNLPPEAIAKVEVFPEEVALQYGYSA
FT                   DERVVNLVLKPDFRQVSIEAEGGIPTQGGRFQSEVEPSFLAITERGRININAGWESKSM
FT                   LRESERDLVYDDPAQAAEAPARSLLGASDEYRIDATVQRSLNKVTDASINLRLDQTDTL
FT                   SLLGPGPGGVGDPLTRDSRARNLTSTASVNGMLGDWRWSVTGNYADADQRTFTDRIDGS
FT                   VDRFDSSQQTFGGNANLSGTVTEGWAGPIRLSMTGSYSGLRFDSRSQRADGVTTTDLSR
FT                   DLPGVFGSLTVPLLDPDYAVGKIGTLSLTLSGQVQNPSDFAALKSWGANLNWGVTDSLS
FT                   LIASFNSDEAAPGIQQLGAAPLVTPAVTYYDFATGQTVQITTTTGGNPLLLAEQRRDLK
FT                   LGLNWSPPMIDGLNLSVNYNRNKSHDTANSFPLLTPEIEAAFPDRVTRDANGVLVALDQ
FT                   RPVNFDRAENSQIRWGLNFGKSFGQEEQRAGPRREGGAPGAGAPRGGPRAGGGGRGGLG
FT                   RMFGGGPQGGRWQVSLYHTIKLTDTVLIRPGVPELDLLDGSATGSGGGSNRHLVELDGG
FT                   VFYKGMGVRLSAKYDSGSTVTGGSAGDLDFGDLATFDLRFFVNLDQQPRLTGALPFLKG
FT                   SRLRLAIDNVFDAQRKITDANGVVPLNYQPGYIDPLGRYIELEWRKTF"
FT   sig_peptide     645456..645545
FT                   /locus_tag="Sala_0635"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.641 at
FT                   residue 30"
FT   gene            complement(647858..648910)
FT                   /locus_tag="Sala_0636"
FT   CDS_pept        complement(647858..648910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0636"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52357"
FT                   /db_xref="GOA:Q1GVG5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG5"
FT                   /protein_id="ABF52357.1"
FT                   /translation="MRILIVTDAWEPQVNGVVRTLQATIAELRAAGHEVGVISPDLFRS
FT                   IPCPSYGEIRLAFAGRRAVGRRIRAFAPQAIHISTEGPLGLAARRWCLDKGFPFTTAYH
FT                   TRFPEYVAARLPVSPALVWRFIRWFHRPARHIMVATRSLARELADRGLAQTMMWERGVD
FT                   HALFRPDRAAHPAFDGLARPIQLYVGRVAVEKNIGAFLDCDRPGTKVVVGDGPALADLK
FT                   ARHPDALFLGKLGGETLASAYAGADVFVFPSRTDTFGLVVIEALSCGTPVAAYPVPGPG
FT                   DIVTDGAGALDEDLGRAIDRALACDRSDAAALGARYSWAGCTAQFARALSFVPADSVSE
FT                   TAIGTAGVAA"
FT   gene            complement(648907..649779)
FT                   /locus_tag="Sala_0637"
FT   CDS_pept        complement(648907..649779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0637"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52358"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG4"
FT                   /protein_id="ABF52358.1"
FT                   /translation="MASISTLPIPARFADPFTTDPHIPERVIGERRSYRTVWVSDIHLG
FT                   TRGCNAAMLIDFFDHVDCETLYLVGDIIDGWRLKKRHFWPPEHNDVVWRVLKRAKRGTR
FT                   VVYVPGNHDEMVRPFDGFDFGGVEIRREAIHETADGRKLLIVHGDEFDAVMLAHRWLAF
FT                   VGDAAYTALMKCNIVVNWVRHKLGLPYWSLSMVAKHKVKNAVQFIGRYEEVVAHAARAR
FT                   GVDGVVCGHIHSAEMREIEGTGYYNDGDWVEGCTALVEHHDGTMEILHWAKEVAARNAP
FT                   TQLMLPAAA"
FT   gene            complement(649954..651387)
FT                   /locus_tag="Sala_0638"
FT   CDS_pept        complement(649954..651387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0638"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52359"
FT                   /db_xref="GOA:Q1GVG3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG3"
FT                   /protein_id="ABF52359.1"
FT                   /translation="MKLKDVYPLYLNNKAAQPNSDLVVTDKYTGEIAFRTALATPDVID
FT                   EAIAGAVRAAEPMARLAGYEKRDVLSHCVARFQERFDELAYALCVEAGKPIADSEGEVT
FT                   RLIDTFRIAAEEATRNYGEVQPLDISPRARGYMGMWKRVPIGPCSFISPFNFPLNLAAH
FT                   KIAPAIAMGCPFVMKPASLTPLGAIIMGEVLAECDVLPEGAFSILPASRDGADLFTTDE
FT                   RLKLLSFTGSPGVGWDLKAKAGKKKVVLELGGNAAVVVDRDADLDHALERIIFGGYYQS
FT                   GQSCIHVQRAIIHADVYDRFRDMLTARVRTLKSGDPKQRDTFIGPMISAREAQRLKGWI
FT                   DDAVAAGATLLAGGGCDGNMLEATLLENVPGDNDVVREEAFGPVVILSKFTDWDAALAE
FT                   VNDSKFGLQAGLFTRDLHKVLTAWDHLDVGGIVVNDVSSYRVDNMPYGGVKDSGLGREG
FT                   VRFAMEDMSEIRNLVIRRT"
FT   gene            complement(651499..653145)
FT                   /locus_tag="Sala_0639"
FT   CDS_pept        complement(651499..653145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0639"
FT                   /product="thiamine pyrophosphate enzyme-like TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52360"
FT                   /db_xref="GOA:Q1GVG2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG2"
FT                   /protein_id="ABF52360.1"
FT                   /translation="MKKASDLFIECLEEEGVEYIFGVPGEENLDFLDSLSRSKKIRLIL
FT                   TRHEQGAGFMAATYGRHTGKTGVCLATLGPGATNFVTAAAYAQLGGMPMMMITGQKPIK
FT                   KSKQGRFQILDVVAMMGPITKYTHQMASSDNIPSRVREAFRLAEEEKPGAVHIELPEDI
FT                   ADEHTDSTPLKRSHSRRPNADSKSIREAVKALEKAKSPVLVIGAGANRTMTSRMLRQFI
FT                   EKTGIPFLTTQLGKGVIDERHPSFLGCAALSAGDFVHRAVEASDCIVNLGHDVIEKPPF
FT                   FMQRDGPTVIHVSTKTAEVDPVYFPDIEVIGDIANAVWQMKEDIVVSGGWKFDHLLAYR
FT                   KAEVAHTAPLAKDERFPIFPPYLVQQIRDAMPDDGIICLDNGVYKIWFARGYTACKPNT
FT                   VLLDNALATMGAGLPSAMMSAMLYPDRKVMAICGDGGFMMNSQEMETAVRLGLNLTVLI
FT                   LNDNSYGMIRWKQANMGFKDWGLTYGNPDFVRYAESYGASGHRVESAAHLKALLAHCLD
FT                   TPGVHLIDCPVDYSENDQILNNDIKRLSKEL"
FT   gene            complement(653681..654184)
FT                   /locus_tag="Sala_0640"
FT   CDS_pept        complement(653681..654184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52361"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG1"
FT                   /protein_id="ABF52361.1"
FT                   /translation="MASDGDWFWPLAGAAVLAWLAYDKWWKEEEPPSPPPPIFAPVSIR
FT                   PSGLVYVTELDSGAVWRVNADSVKGVRSDRTFWIDQDHSKNKSERARSIMTLYRVDCDS
FT                   TATARLSLVAYDGDGNVLIKQDSPHAEETFTPPGSVLGSVFDEVCKSVYDPPPVAPPPP
FT                   SPSR"
FT   gene            complement(654193..654492)
FT                   /locus_tag="Sala_0641"
FT   CDS_pept        complement(654193..654492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52362"
FT                   /db_xref="GOA:Q1GVG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVG0"
FT                   /protein_id="ABF52362.1"
FT                   /translation="MGEPKEGVMGGLIVVLAVAWTISLFAFRRMPPHRRAIFTAGSAWL
FT                   VCAAIWGFFLPSGFYGGLIGFSIGAAVVGVERYIHYSKHWTDEPGTGDEAEIFR"
FT   gene            complement(654582..656405)
FT                   /locus_tag="Sala_0642"
FT   CDS_pept        complement(654582..656405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0642"
FT                   /product="Cobalt chelatase, CobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52363"
FT                   /db_xref="GOA:Q1GVF9"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF9"
FT                   /protein_id="ABF52363.1"
FT                   /translation="MSAQSPLDDFKAALSSVARAVTRDAEVEVGFTADAPAQVGKAIKV
FT                   PTPSRTLPADQVAEARGFADSYALRMKHHSEKLHAAARPADPVAAAAFDAMERARIEAL
FT                   GARHMAGMRGNLAASLAMRMRSDPISRAQDRGDVPMSSALELMLREALTGERAPQGTET
FT                   GLSLVREWISKEAGGDLTALSMLLDDQAAFAETAKIALRHLDLIQSDEPLEQGAEDGGE
FT                   EDQTEAEESQEEQESEDGGAGESQVDARAEMAGDQADDGDSDPDAQEMEADGEPEMGGE
FT                   GDEGMLPVRPNRLPGDIPDFNYLRFTEKHDEIIAATELCDADELARLRAYLDQQMTHLQ
FT                   GAVTKLANRLQRRLMAQQNRAWDFDQEEGQLDAARLARVIVSPGQSLSYKIERDTDFRD
FT                   TVVSLLIDNSGSMRGRPISIAAISADILARTLERCGVKTEILGFTTRTWKGGQSREDWL
FT                   AAGRPAHPGRLNDLRHIIYKPADEPYRRARKSLGLMMREGLLKENIDGEALMWAHSRII
FT                   ARPEERRILMVISDGAPVDDSTLSVNHGAYLDQHLRQVIDWIENRSPVELCAIGIGHDV
FT                   TRYYSRAVTIMDAEQLGGTMVEQLAGLFDVD"
FT   gene            complement(656711..657910)
FT                   /locus_tag="Sala_0643"
FT   CDS_pept        complement(656711..657910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0643"
FT                   /product="protein of unknown function DUF900,
FT                   hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52364"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF8"
FT                   /protein_id="ABF52364.1"
FT                   /translation="MMRARQLAAACGAALALSGCSIAAVDYGKIRHAEYVADQRCDAQP
FT                   GAVVDGAALPHFFVTSRLPDCRASEIELLHHRGDHVRYGRFDAPRDVVVAKKKRFLPPL
FT                   AFQAAPDWWRALQAETDRKQGRVLLYVHGYRESFATTSKDAAQIARMTGFDGPIIEYSW
FT                   PSQGKLFSYVVDETNMYHDVRNFRDFLKTLAEQGWVREIVIVSHSLGARLVIPAVAYVD
FT                   RASSNADSSNISNIILASPDFDRETFERDIEEEVLSARRVANDRRITIYASRADRALAA
FT                   SRAIHGYPRLGSPYCFNPFEAAELKARGLPERCYPAPRAGLTVIDTTDVSRGSTGHSNI
FT                   LLSAPACRDFIDVVAGKRTRPERVATPWTHVFRLEPDPALTKAEHDAICRRTAEAGDDR
FT                   "
FT   sig_peptide     complement(657839..657910)
FT                   /locus_tag="Sala_0643"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 24"
FT   gene            complement(657907..658896)
FT                   /locus_tag="Sala_0644"
FT   CDS_pept        complement(657907..658896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0644"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52365"
FT                   /db_xref="GOA:Q1GVF7"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF7"
FT                   /protein_id="ABF52365.1"
FT                   /translation="MTDIPNSLPDHHGSTLLAAPDTEVDAREVFGVDIDMKVPAFSEAD
FT                   ARVPDLDPAYVFDGDTTLAILAGFKYNRRVMVQGYHGTGKSTHIEQVAARLKWPCIRVN
FT                   LDAHISRIDLVGRDAIVLKDGQQVTEFREGLLPWALQTPTALVFDEYDAGRPDVMFVIQ
FT                   RVLETEGKLTLLDQNRVIRPNPWFRLFSTANTVGLGDTSGLYHGTQQINQGQMDRWNIV
FT                   VTLNYLPAATESAIVLAKVPDTDDTTVANMVKVADLTRQGFINGDISTVMSPRTVISWA
FT                   QNTAIFHNIGFAFRLSFLNKCDEAERMIVAEYYQRVFGEDLPESVIAK"
FT   gene            complement(659153..659590)
FT                   /locus_tag="Sala_0645"
FT   CDS_pept        complement(659153..659590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0645"
FT                   /product="protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52366"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF6"
FT                   /protein_id="ABF52366.1"
FT                   /translation="MTDLNAARIEVVRRHMALEIAHDWDGVIATFDHPRYELMGPGTVF
FT                   DGEAAVRSYFASSREPFPDQANEVIAIAADEHTSTVLVEFWLTGTHLGPLKLGLRTIEP
FT                   TGKAFRIRMAASFEFAPGSDKIVCERPYYDQSAVMKALGLL"
FT   gene            complement(659601..660131)
FT                   /locus_tag="Sala_0646"
FT   CDS_pept        complement(659601..660131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0646"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52367"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF5"
FT                   /protein_id="ABF52367.1"
FT                   /translation="MPGCREAGEFRAPASARRSSDGPPPWRWLCLEHVRAFNAGYNFFE
FT                   GMSADQIMAAQSPTAGWETESRAFRPAGSADLPPRWADFKDPMDALGARFRQRMDEARR
FT                   EVANPRFTREEHRAMQLMDLPPDADRAALRRRYSELVRKYHPDRNGGDRRFEARLGQVV
FT                   EAYQLLRKTAAFA"
FT   gene            660260..660550
FT                   /locus_tag="Sala_0647"
FT   CDS_pept        660260..660550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0647"
FT                   /product="transcriptional regulator BolA"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52368"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF4"
FT                   /protein_id="ABF52368.1"
FT                   /translation="MVKPMSSKGPVQQEMESLLAAAFPDASFTVSNDSAKHHGHVGDDG
FT                   SGESHFSLSIEWAGFAGMNRVMRQRMVNKALGDLPGQRVHALAIRATAPGE"
FT   gene            660559..660927
FT                   /locus_tag="Sala_0648"
FT   CDS_pept        660559..660927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52369"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF3"
FT                   /protein_id="ABF52369.1"
FT                   /translation="MAEHRIYGMSFASVYPHYVTKAERKGRTRAEVDEIIRWLTGYSQT
FT                   ELEGRIAGRVDFRAFFTGAPAMNPAREQIKGVVCGVRVENIEEPLMREIRYLDKLIDEL
FT                   AKGRAMEKILRPPSSGNG"
FT   gene            660947..661831
FT                   /locus_tag="Sala_0649"
FT   CDS_pept        660947..661831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0649"
FT                   /product="Pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52370"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF2"
FT                   /protein_id="ABF52370.1"
FT                   /translation="MFDVITPSTHDLGAFEVRRTLPNRARTMVGPFIFVDQFGPAHFDI
FT                   GKGMDVRPHPHINLATVTYLFEGAIDHRDSLGTYATIRPGACNLMTAGRGIVHSERTPQ
FT                   AERATGSAISGMQTWLALPDGKEEIDPAFEHVAKDDLPLVEDNGVSARVIMGSLWGAAS
FT                   PITQHSATIYADILMNAGATIPIDAEADERAVLVALGDASLDGEPLDRHSLYILKPGQA
FT                   MRLRATSDARVMLLGGEAFTTPRHVWWNFVSSSRDRINEAKHDWKAGRFPLVPGDSEEF
FT                   IPIPEVPKTVSYP"
FT   gene            662045..662968
FT                   /locus_tag="Sala_0650"
FT   CDS_pept        662045..662968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0650"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52371"
FT                   /db_xref="GOA:Q1GVF1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF1"
FT                   /protein_id="ABF52371.1"
FT                   /translation="MIGDFEQQRVTLSTGVELDVVDMGPKDAPVLIFLHGFPESHRTWR
FT                   HQLPHFSGRFRCIAPDQRGYRGSSKPQEVDAYTPDKLIADIFALADALGVDRFTIVGHD
FT                   WGGAIAWGVALGGQPGGLHPQWAGRVTRAVIANAPHPAIFQRLLATNAQQRAASQYIRT
FT                   FRDPASDSIIADHGIAGLLAHAFAGKVPSGGLQPADEIDRLLKDWEDRDACRAMVNWYR
FT                   ASPLAVPAMDEPYAEPPAASFPTLKIPTLVIWALDDVALPPCNLDGMAALVPDVTIVKV
FT                   PDCGHFVPWDAPDAVNAAMDAFLAQG"
FT   gene            complement(663054..663476)
FT                   /locus_tag="Sala_0651"
FT   CDS_pept        complement(663054..663476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52372"
FT                   /db_xref="GOA:Q1GVF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVF0"
FT                   /protein_id="ABF52372.1"
FT                   /translation="MDRVNNTNSTDPSTGATPTPAPPPPPAPVSTRKKPSRWGGCLPWM
FT                   AIAGVMLAGLAIWQFPAFKAQAELGAAYAARVGCSCRYVQGRSLESCQSDFEPGMEMVS
FT                   LSEDPETKTVIGSVPLLASRSARFAGASGCLLRPEN"
FT   gene            663481..664632
FT                   /locus_tag="Sala_0652"
FT   CDS_pept        663481..664632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0652"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52373"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE9"
FT                   /protein_id="ABF52373.1"
FT                   /translation="MKKWLLASAALAMLGAWSLTQAAGQGSLAPAAPAPRFGLSLDDVA
FT                   AADASSALPALPAALRARADALFADAEAVGQTRALLVLRDGEPIYERYAAGFGPDSKLI
FT                   SWSMAKSITAVLTGFLVADGQLSLDAPAPVAAWQRSGDPRGAITLRHLLHMSSGLEHVE
FT                   NGDPVWDGDTVAMLFGGGAADMAGFAEAKPAAAQPGEVFNYSSATSIILSDIIADTLTP
FT                   SESPDARRDAMRDFIAGRLIEPLGMTSLTPEFDAKGTMIGGSIMHATARDYARFGEFLR
FT                   NDGVVNGQRLLPESWIRFMLTPSTRDAGYGGHIWLNRRRPPGAQPALWPDRGPNDLFAA
FT                   IGHQGQYIIVSPSQRVTIVRLGVTRDDQFPALRRHLADLTAAL"
FT   sig_peptide     663481..663549
FT                   /locus_tag="Sala_0652"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.721 at
FT                   residue 23"
FT   gene            complement(664627..665448)
FT                   /locus_tag="Sala_0653"
FT   CDS_pept        complement(664627..665448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0653"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52374"
FT                   /db_xref="GOA:Q1GVE8"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE8"
FT                   /protein_id="ABF52374.1"
FT                   /translation="MSASRRLPISRVDAFADRPFTGNPAAVMPLEEWLDDATLRAIAAE
FT                   NNLSETAFLVPDESGDADYELRWFTPTVEVALCGHATLASGHVLLSAAQWRSDMRFRTR
FT                   KAGILRVARDGDEEGYRMTLPAFTPAPRAMPDIVRALGGQPVETLWHEGGYAVIVYPDA
FT                   ASVRALTPDFRALSKGGDILYIATAPGTGDASGADVVSRAFAPAAGIDEDPVTGSAHSA
FT                   LAPYWTTRLGRDAFAAYQASARGGHLGCRLDGDMVELTGRCVTTLVGDFLL"
FT   gene            complement(665445..666095)
FT                   /locus_tag="Sala_0654"
FT   CDS_pept        complement(665445..666095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0654"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52375"
FT                   /db_xref="GOA:Q1GVE7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVE7"
FT                   /protein_id="ABF52375.1"
FT                   /translation="MRAAAVKFRTCRSTTRVPRIMTARMSDDPLALFDSWFAEARASEP
FT                   NDSNAMALATATPDGRPSLRMVLLKGHGPDGFVFYTNLDSRKGGELAANPHVALLFHWK
FT                   SLRRQIRIEGSVAPVDNATADAYFATRSRDSQIGAWASDQSRPLDSRATFEARFAEMQA
FT                   RFAGQDVPRPPRWSGWRVTPERIEFWQDRAHRLHERTLFERTAIGWTKGYLYP"
FT   gene            666155..667072
FT                   /locus_tag="Sala_0655"
FT   CDS_pept        666155..667072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0655"
FT                   /product="chaperone DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52376"
FT                   /db_xref="GOA:Q1GVE6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE6"
FT                   /protein_id="ABF52376.1"
FT                   /translation="MADPYSTLGVAKTASEAEIKSAYRKLAKELHPDKNKDNPKASERF
FT                   SDVTKAYDLLSDKAKRAQFDRGEIDADGNPAMPFGYGGAGFRGDPRAQGGFSGFGNDGA
FT                   DFGDIFEGLFGGRGGGPFGGFGGRSAPPPRGANIPYRLSVSFIDAATQAPQRITLADGG
FT                   TIDLKLPAGVETGTQMRLAGKGQPGPGGHGDAIVTITVKDHPFFVRDGANIRLDLPVTL
FT                   AEAVKGAKVKVPTVDGPVMLSIPAGSSSGKVMRLKGKGFSQKSGGRGDQLVRIMVDLPA
FT                   DDAALVKLLGEWNDPRNVRADLGV"
FT   gene            667076..668143
FT                   /locus_tag="Sala_0656"
FT   CDS_pept        667076..668143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0656"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52377"
FT                   /db_xref="GOA:Q1GVE5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE5"
FT                   /protein_id="ABF52377.1"
FT                   /translation="MAEVRDNGRAAALEREVADEVGKEFLAEGHSPESPEARAEQAKRV
FT                   HLRARAQGVIERGREQLGPGTRAYRIVRRVVVGTYTDGFIHAGNLAYLALIALFPFFIL
FT                   LAAALSLVGGSVGGERAVEAVFSTMPPTVAKALSGPIREVMSARTGIFLWLGALVALWT
FT                   VGSLIETVRDILRRAYGTHFSKGFFHYRLLSIGIITGAVVLMLLSFSMQVLIVGVEQFV
FT                   TRVLPEQYQARGLVFISRAVSGFGLFVAIYLLFYSLTPSKYRRLKRCPKWPGALFTTLW
FT                   WIGVTLALPPLLASLLSYDATYGSLAGVMVALFFFYLVGLGMVMGAELNAALVEVEDLG
FT                   HDAMGRVDDVTVDDK"
FT   gene            668161..668988
FT                   /locus_tag="Sala_0657"
FT   CDS_pept        668161..668988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0657"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52378"
FT                   /db_xref="GOA:Q1GVE4"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE4"
FT                   /protein_id="ABF52378.1"
FT                   /translation="MTGLMKGKRGLIMGLANDKSLAWGIAKALHAHGAELALSYQGEVM
FT                   AKRVKPLADQLGCDFLIDCDVSDMDNLDAAFGSLAARWPTIDFVVHAIGYTNKEALRGH
FT                   YADVTLDDFLMTMNISVYSFTAVAKRAAAMMAPFDPETGAGGGSLLTLSYYGAEKVIPH
FT                   YNVMGVAKSALETSVKYLANDYGPQGVRVNAISAGPIKTLAASGIGDFRLILKWNEYNA
FT                   PLRRNVTIDDVGGSALYLLSDLASGVTGETHHVDAGYHTIGMKQEDAPDIALA"
FT   gene            668988..669362
FT                   /locus_tag="Sala_0658"
FT   CDS_pept        668988..669362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0658"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52379"
FT                   /db_xref="GOA:Q1GVE3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE3"
FT                   /protein_id="ABF52379.1"
FT                   /translation="MVDLTIDHVQLAIPIGGEDAARSFYGVLLGLSELPKPPEMVGRGG
FT                   CWFQLGAQQLHVGVEADFHAAKKAHIALATDELAALRHRIEAAGHATKDDSPVEGRYRF
FT                   FAEDPFGNRIEFMDRVARGI"
FT   gene            669359..670435
FT                   /locus_tag="Sala_0659"
FT   CDS_pept        669359..670435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0659"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52380"
FT                   /db_xref="GOA:Q1GVE2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVE2"
FT                   /protein_id="ABF52380.1"
FT                   /translation="MSFNSFGRVLRFTTWGESHGPALGAVVDGCPPRLSLSEADIQPFL
FT                   DKRRPGQSRHTTQRQEPDQVRILSGVFEGKTTGTPISLMIENVDQRSKDYGEIAQAWRP
FT                   GHADYAYDAKYGIRDYRGGGRSSARETAARVAAGAVARLVIPEVQIHAWVAEIGGDAID
FT                   PANFDLEEIDRNPFFCPDPAAAQRWEALMDSARKAGSSLGAVIECAASGVPAGWGAPVY
FT                   AKLDSDLAAAMMGINAVKGVEIGAGFGVARLRGEENADPMRPASDGSNRPDFLSNNAGG
FT                   IAGGISTGQPVVVRVAFKPTSSILTPVPTVNKAGEATDIVTRGRHDPCVGIRGAPVVEA
FT                   MMALTLADHKLLHRAQCG"
FT   gene            670443..672233
FT                   /locus_tag="Sala_0660"
FT   CDS_pept        670443..672233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0660"
FT                   /product="TrkA-C"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52381"
FT                   /db_xref="GOA:Q1GVE1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE1"
FT                   /protein_id="ABF52381.1"
FT                   /translation="MIDVARTFITNHQAIIGLVVLGLMFVGFVLERFPATVVAILGTCT
FT                   FLFLGILSGRDLFSVFSNPAPVTIGAMFILSGALLRTGTLDAIASRIIARAQRHPRLAL
FT                   AEMFLGVYVASALLNNTPVVVVMIPIMLRLAAALNLSAKRLLIPLSYVAILGGTTTLVG
FT                   TSTNLLVAAVAEENGLDGFGIFTITPVGLVAGVIGAFGLLAIARRFLPDDAPNQIALSQ
FT                   DHRSFLSEVRILKDGNLVGRRVGDVPFARRANVRLVGLKRGGTLRRTALADEILQADDR
FT                   LVLRLELAELLSLRANKNVAIGLTAGHDDVEQDEEEIVEAMIAPSHPAIGRRLIEIPFL
FT                   SALRVRILGIARFRKTPGPDLPNARIQAIDRVLVTGPTDQIEQMYANPHLYGVGSTTER
FT                   EFRRGKAPIAIGALLGVILLASFNVMDIGVAAIIGVGLILVTRCIDADEAWDSIDGNVL
FT                   VLIFAMLAVGLALENSGSVALVVGKLTPVLADVPPWGLVLATYAISVLLTEVVTNNAVA
FT                   ILVTPLTIAVARDLGVDPYPLVVAVMFAASASFATPIGYQTNTLVYAAGNYRFVDFVRA
FT                   GVPMTLFVGAATVAAISLLM"
FT   gene            672308..673633
FT                   /locus_tag="Sala_0661"
FT   CDS_pept        672308..673633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0661"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52382"
FT                   /db_xref="GOA:Q1GVE0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVE0"
FT                   /protein_id="ABF52382.1"
FT                   /translation="MAEASIVMPAQGHEEARARRLQWRMLVGFVVGLLAGLAAHYGAAG
FT                   QPWVDEVIFYLGKVGDIFLRLLFMLVIPLLVSALIVGVAEMGEMRALKTVGLRTLIYTI
FT                   VVSSIAVVISLLVVNLLQPGAGVDPEVARSLIADGAERAGSIIQTSREAKAGADAIVAI
FT                   VPNNFFLAMSQNDVLAVMFFALFFGIGLMMVQTPQTQALKTAIEGVFEVAMKLIGLVIR
FT                   LAPIAIFCFMFNLGAQFGVDLLVRLSAFVGVVLLALGLQMFVVFPILLKTLAGKSPIAF
FT                   FRETQEATVMAFSTASSNATLPTALRVARNQLHLPDRVARFVLTIGATANQNGTAMFEG
FT                   VTVIFLAQFFGVDLTLQQQIMVMAVCILGGIGTAGVPAGSLPVIALILAMVGVPPAGIG
FT                   LVLGVDRFLDMCRTTLNVIGDLVAATVVSAGIDDRPEGDSPG"
FT   gene            complement(673643..674458)
FT                   /locus_tag="Sala_0662"
FT   CDS_pept        complement(673643..674458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52383"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD9"
FT                   /protein_id="ABF52383.1"
FT                   /translation="MPLRFKRPLSIAFGAFATTMLSGCYYGDVHGASYASRGDCAARYG
FT                   DAYYDYDGYAYDDGYGYDCYDASDYGSGFVQIGFGGGWYDDYYYPGHGLWMFDRYRNRY
FT                   PLRDHYLNYWGGRRAWWKYHGKHGDWKPGRPGWHRDRDDDRERDDRRPGWNRGDRDGDG
FT                   PRGTRPRRSTEAMTGTPRAIRNLPATEPGEIYSRPRGRVETRATQRSHRQWPRSAVAPP
FT                   AAAPVTGSTPPVARPAVRPAPPPRADTPSAPPPPARANRVDRPNKVRDQ"
FT   sig_peptide     complement(674375..674458)
FT                   /locus_tag="Sala_0662"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.918) with cleavage site probability 0.400 at
FT                   residue 28"
FT   gene            674618..676027
FT                   /locus_tag="Sala_0663"
FT   CDS_pept        674618..676027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0663"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52384"
FT                   /db_xref="GOA:Q1GVD8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD8"
FT                   /protein_id="ABF52384.1"
FT                   /translation="MNAPTQIHPASSRWSAARFGPDTQHWLPRNPDSAIDHIPGEDGLP
FT                   IIGNTLEQLRDYPAFARRMVAKYGPVYRNNSFGGRSVALYGPEANELVMFDRDKIFSSE
FT                   QGWGPVLNLLFPRGLMLMDFEKHRADRKLLSVAFKPEPMRHYADALNDGIRGRVASWSG
FT                   RTFQFYPAIKELTLDLAATSFLGIPWGPEADKVNKAFVDMVQASIGIVRRPLPFTAMGR
FT                   GAKGRAFLVDYFSRMVPERREGAGEDMFSQICRTRDDNGDYMPVDAIVDHMNFLMMAAH
FT                   DTITSSITTLVWELARHPDWQDRLREEMLAVAPAGEGVGHNSLGELELTEWAFKEALRL
FT                   VPPVPSFPRRALKDFEFGGYRIPAGTSVGVSPAFTHMMEEHWPEPERFDPMRFSPEVAR
FT                   GRHKYAWVPFGGGAHMCLGLHFAYMQAKIFFHHVVTTHRISVAPGYAPEWQMLPIPRPK
FT                   DGLTVTFEPLK"
FT   gene            676143..676877
FT                   /locus_tag="Sala_0664"
FT   CDS_pept        676143..676877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0664"
FT                   /product="Extensin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52385"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD7"
FT                   /protein_id="ABF52385.1"
FT                   /translation="MRHLGRVTTLRPYLIWLAVALLFAFAAVRAMQWVREHPEHVPGAR
FT                   FELAHPQGWATRHKLVALAADDDACFAAFDRSGAGYLRRPVVGEGVCRASQRMILTGNR
FT                   LVPTMRPANAAPGCAVTAAMALWTRDVVQPAAERYFGQQVVELENLGSYNCRTIAGSAA
FT                   RSQHSTANAIDISAFILADGTRIALINDWEPGDRHGEFLHAVRDGSCGLFSTVLSPDHN
FT                   AAHADHFHFDMAARTAGWTVCR"
FT   sig_peptide     676143..676235
FT                   /locus_tag="Sala_0664"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.633 at
FT                   residue 31"
FT   gene            676868..677146
FT                   /locus_tag="Sala_0665"
FT   CDS_pept        676868..677146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52386"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD6"
FT                   /protein_id="ABF52386.1"
FT                   /translation="MPLERDDLILTHRDCPLKFVGKKRLAGRAGCPDQRRAAVRRASGG
FT                   NPSGAGRFWPIATLLVGRDIPHRAAPRPSHSAKIASVTVGQYHVIAL"
FT   gene            complement(677133..677579)
FT                   /locus_tag="Sala_0666"
FT   CDS_pept        complement(677133..677579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0666"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52387"
FT                   /db_xref="GOA:Q1GVD5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024170"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD5"
FT                   /protein_id="ABF52387.1"
FT                   /translation="MKVREAQSRDIAAWAAMRARLWPDADAAELADELPSMLTDTTLWN
FT                   FILTSTGDRAVGFAEVQLRTMFDGCVVAPYPHIEGLWVDAELWRMGGARALLAAIEERA
FT                   RRRGHDRIGSDVELDNETSQAWHEKCGFNEEVRTILYSKPLRAR"
FT   gene            complement(677582..677938)
FT                   /locus_tag="Sala_0667"
FT   CDS_pept        complement(677582..677938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0667"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52388"
FT                   /db_xref="GOA:Q1GVD4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD4"
FT                   /protein_id="ABF52388.1"
FT                   /translation="MTDTKTRTRPAAVTLTPNAEARIARLMAAAPDGAIGVKLSTPRRG
FT                   CSGLAYSVDYVTEEEKFDEKIETPGGVFYIDGASVLYLIGSTMDWVEDDFAAGFVFDNP
FT                   NAKGACGCGESFTV"
FT   gene            complement(678090..678560)
FT                   /locus_tag="Sala_0668"
FT   CDS_pept        complement(678090..678560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0668"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52389"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR014291"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD3"
FT                   /protein_id="ABF52389.1"
FT                   /translation="MSEERTIRIEEVAHVEAPPKARVADAETAPEKLERKRDYLEGFLA
FT                   ARPAAVDPAAVGGDLYEAVIAALKDIYDPEIPVNIYDLGLIYNVEIDEGHVMVTMTLTT
FT                   PHCPVAESMPGEVELRVGAVPGVGDAEVNLVWDPPWSPANMSDEARLELGML"
FT   gene            complement(678557..679801)
FT                   /locus_tag="Sala_0669"
FT   CDS_pept        complement(678557..679801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0669"
FT                   /product="cysteine desulfurases, SufS subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52390"
FT                   /db_xref="GOA:Q1GVD2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD2"
FT                   /protein_id="ABF52390.1"
FT                   /translation="MSNLPSPFASSEVGMPIGNARLQGVSTSLDTNGIRDQFPGLTPGW
FT                   HYLDTAATAQKPQAVIDATLAAMGRDYATVHRGVYARSADMTLAYEAARRRIAAFIGAK
FT                   DDQIAFVRGATEAINLVAYSHPKKGRVLLSTLEHHSNIVPWQLAGWQVDVCPLTADGCI
FT                   DLDAAEKLLTRGHNMVAFAHVSNVLGSPLDVARAAELAHKVGAELLIDGCQAVPRLPVD
FT                   VAALGCDYYVFSGHKLYGPTGIGVLWSDKLDALPPWQGGGSMIDRVTFERTTYAPAPTR
FT                   FEAGTPAIVEALGLAAAVDYVETIGIDAIHAHECALVTSLRDQLARRNSITLYGPENSA
FT                   GIVSFSMAGVHPHDIGTILDESGVAIRAGHHCAQPLMDHLGVPATARASFGLYSNDDDV
FT                   AALIDGLARVERIFG"
FT   gene            complement(679798..680526)
FT                   /locus_tag="Sala_0670"
FT   CDS_pept        complement(679798..680526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0670"
FT                   /product="SufBD"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52391"
FT                   /db_xref="GOA:Q1GVD1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD1"
FT                   /protein_id="ABF52391.1"
FT                   /translation="MVTTLPSRRDEAWRYADIDAVAAAWPLPAPESIIVPAGGQFARAI
FT                   VQDSGAIHQIEMSIGKDATAALHILNIGGAYGRIELAVTLHEGADFTLGAAQIGGGAQN
FT                   LEIVTTVIHAEPGATSRQVVRSVLGGTATGTYLGKVAVARDAQQTDSEQDVKAMLLNRS
FT                   ATANAKPELEIFADDVKCAHGCAIGELDAMALYYLESRGMPPAEAKKILLQAFVAGVFD
FT                   GAVDEARLQELALAKLGELV"
FT   gene            complement(680732..681475)
FT                   /locus_tag="Sala_0671"
FT   CDS_pept        complement(680732..681475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0671"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52392"
FT                   /db_xref="GOA:Q1GVD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVD0"
FT                   /protein_id="ABF52392.1"
FT                   /translation="MLKIENLHATVADKPILKGLSLAINAGEIHAIMGPNGAGKSTLSY
FT                   VLGGRPGYEVTEGSVTFEGQDLLDMEPHERAAAGLFLGFQYPVEIPGVSNVQFLRESLN
FT                   AQRKARGLEPLSGGEFLKLAREKAALLKMDMDMLKRPVNVGFSGGEKKRNEMVQMGILD
FT                   PRLAILDETDSGLDIDALRTVGDGINTIMRRPDKAVLLITHYQRLLDYVQPDFVHVLAD
FT                   GRIVKSGGPELARELEAHGYAEIAA"
FT   gene            complement(681462..681977)
FT                   /locus_tag="Sala_0672"
FT   CDS_pept        complement(681462..681977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0672"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52393"
FT                   /db_xref="GOA:Q1GVC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC9"
FT                   /protein_id="ABF52393.1"
FT                   /translation="MSIAVRPATSDDAPELAALINAIIARGGTTALETPFTPDQLDAAF
FT                   LTGPDVWCCFVAVGPEGCLEGFQTLLREDGYPADWGDIGTFTRIDGIQKGVGTALFAAT
FT                   RARASELGLAAINATIRADNKGGLTFYSKMGMEDYAVDRGQQLADGTAVDRIHKRYFLK
FT                   IDGHDAEN"
FT   gene            complement(681974..682495)
FT                   /locus_tag="Sala_0673"
FT   CDS_pept        complement(681974..682495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0673"
FT                   /product="protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52394"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC8"
FT                   /protein_id="ABF52394.1"
FT                   /translation="MTSLSPTDQAKRLSTPPLQGRGRGWGLSALDIAELQSRARQMRNN
FT                   PTEPEKRLWRQLSNGQLYGHKFRRQQVIGWFIADFVCASANLIVEVDGDTHEETADRAR
FT                   DKALAEQGYRTVRVSNHEVMTNMDGVLAFISEALRQADGPHPNPSPEGEGLKRVEAQKL
FT                   LGISLEGSVG"
FT   gene            complement(682492..683979)
FT                   /locus_tag="Sala_0674"
FT   CDS_pept        complement(682492..683979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0674"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52395"
FT                   /db_xref="GOA:Q1GVC7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC7"
FT                   /protein_id="ABF52395.1"
FT                   /translation="MIDNTETRIKDQAAHAAAARVADYEHGWSADIETDFAPKGLTEDT
FT                   VRFISAKKNEPEWMLDWRLKAFRHWQTMETPDWAKLNVPPIDYQDAYYYAAPKPKPKLS
FT                   SLDEVDPEILEVYRKLGIPIEEQKVLAGVEGARKVAVDAVFDSVSVATTFREELKRAGV
FT                   IFLSISEAIREYPELVKKWLGRVVPMHDNYFATLNCAVFSDGTFVYVPEGVRCPMELST
FT                   YFRINAENTGQFERTLIVADKGAYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYS
FT                   TVQNWYPGNAEGLGGIYNFVTKRALCQGKRSKVSWTQVETGSAITWKYPSCVLNGDDSV
FT                   GEFYSVAVTNNFQQADTGTKMIHNGKRTRSTIVSKGISAGKSNNTYRGLVRVAPNAEGV
FT                   RNFTQCDSLLLGDRCGAHTVPYIEVRNPTATVEHEATTSKISDDQLFYAMQRGLGQEEA
FT                   VALIVNGFAKEVLQQLPMEFAVEAQKLLGISLEGSVG"
FT   gene            complement(683984..684484)
FT                   /locus_tag="Sala_0675"
FT   CDS_pept        complement(683984..684484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0675"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52396"
FT                   /db_xref="GOA:Q1GVC6"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR014290"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC6"
FT                   /protein_id="ABF52396.1"
FT                   /translation="MRLSNFADYAVVLMSAAARQCGSVPIHAAMLAEQTGIPGPTAQKL
FT                   VSQLARAGLLVASRGSGGGVRLARPAAAISVADIIEAVEGPIALTSCVAEGRHDCSLEG
FT                   SCKVQPHWGVVNGAVRGALAEISLASLTVAPAKGAGSHVPPGTAAGGHAQTIAAPAFAG
FT                   ATS"
FT   sig_peptide     complement(684398..684484)
FT                   /locus_tag="Sala_0675"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.632) with cleavage site probability 0.588 at
FT                   residue 29"
FT   gene            complement(684556..684798)
FT                   /locus_tag="Sala_0676"
FT   CDS_pept        complement(684556..684798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC5"
FT                   /protein_id="ABF52397.1"
FT                   /translation="MIKLSLQPNHQKLRVASIWRFHTIANRPPRIIDACDPEELILFDE
FT                   DLRPSSRHSFGSGRMGAFFVPQLFYRRARPRLLAR"
FT   gene            complement(684795..685289)
FT                   /locus_tag="Sala_0677"
FT   CDS_pept        complement(684795..685289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0677"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52398"
FT                   /db_xref="GOA:Q1GVC4"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC4"
FT                   /protein_id="ABF52398.1"
FT                   /translation="MAGDRRHRNPCPSPGRRGQGKKGGVQAQALGRSRGGFGTKIHAVV
FT                   DALGLPVRFMLGPGQQNDMAPACDLIRGLKAEHVLADRAYDADSLCDLITEQGGEPVIP
FT                   PRRHRKVQRSYDRIAYKQRWGIEGFFAKLKQWRRIATRYDKLAANFLGFIKLASIMLWL
FT                   K"
FT   gene            complement(685639..686526)
FT                   /locus_tag="Sala_0678"
FT   CDS_pept        complement(685639..686526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0678"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52399"
FT                   /db_xref="GOA:Q1GVC3"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC3"
FT                   /protein_id="ABF52399.1"
FT                   /translation="MSHISSSPAGVGGSAPFELHYFPPDPDLAEMVSSFYVARINVPRF
FT                   DEYERADRPQFRFMTVADGEYVFADGHHSPACRANIVGPTSGRVRAIANGPTTMFGFGL
FT                   LPAGWAALMGDDADKLTDDAMDAADLFGPWIDEVATALEQAQTAEEKLVIGNNFAREVL
FT                   TRGETAPMWFIRTVDEWLTATPSPQVPALVEATGMSIRSVERMTKHYYGLPPRMLARKY
FT                   RAVRAASALARGEGLDAAQLGDAFYDQSHLIREIKRFAGATPGQLSNPTLYTQATTRGR
FT                   KQLAGKVGRIVSET"
FT   gene            complement(686628..688445)
FT                   /locus_tag="Sala_0679"
FT   CDS_pept        complement(686628..688445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0679"
FT                   /product="protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52400"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC2"
FT                   /protein_id="ABF52400.1"
FT                   /translation="MSHLRTLARLSTGLVLLATAGCASMTGQGGPVASTPPPAAAVPAG
FT                   ADLAQFFENYDAALLSLAPQSKAYRGIRDADYGRWDDVSDEAAVARHKLQQASAAAMRA
FT                   SFDPATLSAEEALSFELFNAAAARAERLFPYRNHDYIFDQMNGAQSQLPAFLINIHRVA
FT                   NVAEAEAYVSRIRGLGPLLDALSAQSAERAARGIQPPKWVYAYLISDIGNLLGPDNAVI
FT                   EDITAKVGKLGVSDAEKARLVAAAKAAWTESAGPAYARLLAEMKRQQAVAPTADGIWRL
FT                   PDGKAYYEALLANYTTTDMTASQIHELGLAEVARIHGEMRAIMTKVGFKGSLQEFFVHL
FT                   RTSPQFYHTTREAYLADVDKYVKAMEARLPAFFNTLPKAPLVVKPVEAFREKSAGKAFY
FT                   QSPSPDGSRPGTYYVNLYDLNDMSKTELEALAYHEGVPGHHLQRAVQTELTGLPPFRRF
FT                   GGVTAYTEGWGLYSEELAKDMGFYTDPYSDFGRLGMELWRACRLVVDTGIHDKRWSREQ
FT                   AIQYLKDNTPNPQGDIEKAIERYIVYPGQATAYLIGKLKIMELRGRAQAALGERFDFRR
FT                   FHDVVLESGPVPLDILERRVDAWIAAEKG"
FT   sig_peptide     complement(688320..688445)
FT                   /locus_tag="Sala_0679"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.328 at
FT                   residue 42"
FT   gene            688516..689586
FT                   /locus_tag="Sala_0680"
FT   CDS_pept        688516..689586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0680"
FT                   /product="dihydroorotate oxidase A"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52401"
FT                   /db_xref="GOA:Q1GVC1"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GVC1"
FT                   /protein_id="ABF52401.1"
FT                   /translation="MSLFASLTDAAYALARPLVHATDGEAAHNLTLAALQPLPRARHAL
FT                   TSPMLATELAGLRFPNPVGLAPGFDKDARVAHAMPHFGFGFVEVGTLTPLPQEGNPRPR
FT                   LFRLVEDRAIINRMGFNNGGQVAAAERIACLRRHGLPVPLGINIGANKDSADRIADYAK
FT                   GTAAMAPLADYLTVNISSPNTPGLRALQDRGALEALLDGVAAAQPAGAAKPVFLKVAPD
FT                   LEPADIDDIVAVALDRGLAAVIVSNTTVARPPLASRHAVEAGGLSGAPLAQLALQCVQD
FT                   FRAASGGRLPLIAAGGIASAEQAWERIRAGASLVQVYSAMVFEGPGLASRIARGLETLA
FT                   ARDGFARVSDAVGAGA"
FT   gene            689632..691359
FT                   /locus_tag="Sala_0681"
FT   CDS_pept        689632..691359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0681"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52402"
FT                   /db_xref="GOA:Q1GVC0"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVC0"
FT                   /protein_id="ABF52402.1"
FT                   /translation="MHSLCLRANVACMLNRLLALVAFVSLACPTLAAAQGVTSSADPRA
FT                   TEAGRVILHQGGSAADAAIAMVAVLTLVEPQSSGIGGGGFMLHHNAGDGGISTIDGRET
FT                   APAAATPDRFLGPDGKPRGFMDVVPGGLSVGVPGNIRLMEMAHKKWGKLEWKALFQPAI
FT                   DLAEGGFEVTPALHNWLVRFEPVWKDFPAARAIYHVDGKPAPVGTRLRNPAYAALLRDI
FT                   AARGPDAFYRGANARAIRDAVARAPRNPATLTLQDLASYRARERPAVCTSYRIYKVCGM
FT                   GPPSSGATTVFGILGMLEGWDMKAMGKDNPMSWHLLAEAMQLAYADRAAYLGDADFVDV
FT                   PVKGLLDKSYLAERRRLISPYGAAGRYEPGTPPGATPRAAAPPVDEQGTTHFVAADAAG
FT                   NVVSMTSTVESIFGSQLIANGYFLNNELTDFDFVPARDGVPTANRVQPGKRPLSSMSPT
FT                   IVYGPDGKVVLAVGSAGGKRIIMHVTKTLIGVLDWGLDAKEAIALPNLFFGRQGVLIED
FT                   SEAGQAIAAKMQPFGYSFTPTDLGSKLNAIERTAEGMRGAADPRGPGTSAVDGAPPQG"
FT   sig_peptide     689632..689736
FT                   /locus_tag="Sala_0681"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.784 at
FT                   residue 35"
FT   gene            691469..693274
FT                   /locus_tag="Sala_0682"
FT   CDS_pept        691469..693274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sala_0682"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sala_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABF52403"
FT                   /db_xref="GOA:Q1GVB9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GVB9"
FT                   /protein_id="ABF52403.1"
FT                   /translation="MKLENPHLDHFPSLVAMFFDRAARGGEDPFLWHKADRAWQALSWR
FT                   EVAEQVAALAHNLRKLGLKEGDRVVLVSENRPEWCIADLGIMAAGCITVPTYTTNTERD
FT                   HQHILDNSGARAVIVSTAKLARVLMPAVMRSDAHIVISMESLRVGQQGDVSVHDWAPLV
FT                   AGGAAWVEEAKARGLGVKREDTACLIYTSGTGGAPRGVMQHHGAILHNAAGAAEILVND
FT                   FGIGDEEVFLSFLPLSHAYEHSGGQFLPIMVGAQIYYSEGLEKLVSNIEETRPTIMVVV
FT                   PRLFEVIRARMIKAVEKQGKLANWMLAQALRVGEKDYARRMGVLDRPVDILLNRLFRPK
FT                   IRKRFGGRMKALVSGGAPLNPEIGVFFHSIGLTLLQGYGQTEAGPVISCNRPKTGLKMD
F