(data stored in ACNUC7421 zone)

EMBL: CP000360

ID   CP000360; SV 1; circular; genomic DNA; STD; PRO; 5650368 BP.
XX
AC   CP000360;
XX
PR   Project:PRJNA15771;
XX
DT   08-MAY-2006 (Rel. 87, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Candidatus Koribacter versatilis Ellin345, complete genome.
XX
KW   .
XX
OS   Candidatus Koribacter versatilis Ellin345
OC   Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae;
OC   Candidatus Koribacter.
XX
RN   [1]
RP   1-5650368
RX   DOI; 10.1128/AEM.02294-08.
RX   PUBMED; 19201974.
RA   Ward N.L., Challacombe J.F., Janssen P.H., Henrissat B., Coutinho P.M.,
RA   Wu M., Xie G., Haft D.H., Sait M., Badger J., Barabote R.D., Bradley B.,
RA   Brettin T.S., Brinkac L.M., Bruce D., Creasy T., Daugherty S.C.,
RA   Davidsen T.M., DeBoy R.T., Detter J.C., Dodson R.J., Durkin A.S.,
RA   Ganapathy A., Gwinn-Giglio M., Han C.S., Khouri H., Kiss H., Kothari S.P.,
RA   Madupu R., Nelson K.E., Nelson W.C., Paulsen I., Penn K., Ren Q.,
RA   Rosovitz M.J., Selengut J.D., Shrivastava S., Sullivan S.A., Tapia R.,
RA   Thompson L.S., Watkins K.L., Yang Q., Yu C., Zafar N., Zhou L., Kuske C.R.;
RT   "Three genomes from the phylum Acidobacteria provide insight into the
RT   lifestyles of these microorganisms in soils";
RL   Appl. Environ. Microbiol. 75(7):2046-2056(2009).
XX
RN   [2]
RP   1-5650368
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Kiss H., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Kuske C.,
RA   Janssen P.H., Richardson P.;
RT   "Complete sequence of Candidatus Koribacter versatilis Ellin345";
RL   Unpublished.
XX
RN   [3]
RP   1-5650368
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Kiss H., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Kuske C.,
RA   Janssen P.H., Richardson P.;
RT   ;
RL   Submitted (25-APR-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9b639de10d66b58e2de19b17d02215ce.
DR   BioSample; SAMN02598354.
DR   EnsemblGenomes-Gn; Acid345_R0001.
DR   EnsemblGenomes-Gn; Acid345_R0002.
DR   EnsemblGenomes-Gn; Acid345_R0003.
DR   EnsemblGenomes-Gn; Acid345_R0005.
DR   EnsemblGenomes-Gn; Acid345_R0006.
DR   EnsemblGenomes-Gn; Acid345_R0007.
DR   EnsemblGenomes-Gn; Acid345_R0008.
DR   EnsemblGenomes-Gn; Acid345_R0009.
DR   EnsemblGenomes-Gn; Acid345_R0010.
DR   EnsemblGenomes-Gn; Acid345_R0011.
DR   EnsemblGenomes-Gn; Acid345_R0012.
DR   EnsemblGenomes-Gn; Acid345_R0013.
DR   EnsemblGenomes-Gn; Acid345_R0015.
DR   EnsemblGenomes-Gn; Acid345_R0016.
DR   EnsemblGenomes-Gn; Acid345_R0017.
DR   EnsemblGenomes-Gn; Acid345_R0018.
DR   EnsemblGenomes-Gn; Acid345_R0019.
DR   EnsemblGenomes-Gn; Acid345_R0020.
DR   EnsemblGenomes-Gn; Acid345_R0022.
DR   EnsemblGenomes-Gn; Acid345_R0023.
DR   EnsemblGenomes-Gn; Acid345_R0024.
DR   EnsemblGenomes-Gn; Acid345_R0025.
DR   EnsemblGenomes-Gn; Acid345_R0026.
DR   EnsemblGenomes-Gn; Acid345_R0027.
DR   EnsemblGenomes-Gn; Acid345_R0028.
DR   EnsemblGenomes-Gn; Acid345_R0029.
DR   EnsemblGenomes-Gn; Acid345_R0030.
DR   EnsemblGenomes-Gn; Acid345_R0032.
DR   EnsemblGenomes-Gn; Acid345_R0033.
DR   EnsemblGenomes-Gn; Acid345_R0034.
DR   EnsemblGenomes-Gn; Acid345_R0035.
DR   EnsemblGenomes-Gn; Acid345_R0036.
DR   EnsemblGenomes-Gn; Acid345_R0037.
DR   EnsemblGenomes-Gn; Acid345_R0038.
DR   EnsemblGenomes-Gn; Acid345_R0039.
DR   EnsemblGenomes-Gn; Acid345_R0040.
DR   EnsemblGenomes-Gn; Acid345_R0041.
DR   EnsemblGenomes-Gn; Acid345_R0042.
DR   EnsemblGenomes-Gn; Acid345_R0043.
DR   EnsemblGenomes-Gn; Acid345_R0044.
DR   EnsemblGenomes-Gn; Acid345_R0045.
DR   EnsemblGenomes-Gn; Acid345_R0046.
DR   EnsemblGenomes-Gn; Acid345_R0047.
DR   EnsemblGenomes-Gn; Acid345_R0048.
DR   EnsemblGenomes-Gn; Acid345_R0050.
DR   EnsemblGenomes-Gn; Acid345_R0051.
DR   EnsemblGenomes-Gn; Acid345_R0052.
DR   EnsemblGenomes-Gn; Acid345_R0053.
DR   EnsemblGenomes-Gn; Acid345_R0054.
DR   EnsemblGenomes-Gn; Acid345_R0055.
DR   EnsemblGenomes-Gn; EBG00001178580.
DR   EnsemblGenomes-Gn; EBG00001178581.
DR   EnsemblGenomes-Gn; EBG00001178582.
DR   EnsemblGenomes-Gn; EBG00001178583.
DR   EnsemblGenomes-Gn; EBG00001178584.
DR   EnsemblGenomes-Gn; EBG00001178585.
DR   EnsemblGenomes-Gn; EBG00001178586.
DR   EnsemblGenomes-Gn; EBG00001178587.
DR   EnsemblGenomes-Gn; EBG00001178588.
DR   EnsemblGenomes-Gn; EBG00001178589.
DR   EnsemblGenomes-Gn; EBG00001178590.
DR   EnsemblGenomes-Gn; EBG00001178591.
DR   EnsemblGenomes-Gn; EBG00001178592.
DR   EnsemblGenomes-Gn; EBG00001178593.
DR   EnsemblGenomes-Gn; EBG00001178594.
DR   EnsemblGenomes-Gn; EBG00001178595.
DR   EnsemblGenomes-Gn; EBG00001178596.
DR   EnsemblGenomes-Gn; EBG00001178597.
DR   EnsemblGenomes-Gn; EBG00001178598.
DR   EnsemblGenomes-Gn; EBG00001178599.
DR   EnsemblGenomes-Gn; EBG00001178600.
DR   EnsemblGenomes-Gn; EBG00001178601.
DR   EnsemblGenomes-Gn; EBG00001178602.
DR   EnsemblGenomes-Gn; EBG00001178603.
DR   EnsemblGenomes-Gn; EBG00001178604.
DR   EnsemblGenomes-Gn; EBG00001178605.
DR   EnsemblGenomes-Gn; EBG00001178606.
DR   EnsemblGenomes-Gn; EBG00001178607.
DR   EnsemblGenomes-Gn; EBG00001178608.
DR   EnsemblGenomes-Gn; EBG00001178609.
DR   EnsemblGenomes-Gn; EBG00001178610.
DR   EnsemblGenomes-Gn; EBG00001178611.
DR   EnsemblGenomes-Gn; EBG00001178612.
DR   EnsemblGenomes-Gn; EBG00001178613.
DR   EnsemblGenomes-Gn; EBG00001178614.
DR   EnsemblGenomes-Gn; EBG00001178615.
DR   EnsemblGenomes-Gn; EBG00001178616.
DR   EnsemblGenomes-Gn; EBG00001178617.
DR   EnsemblGenomes-Gn; EBG00001178618.
DR   EnsemblGenomes-Gn; EBG00001178619.
DR   EnsemblGenomes-Gn; EBG00001178620.
DR   EnsemblGenomes-Gn; EBG00001178621.
DR   EnsemblGenomes-Gn; EBG00001178622.
DR   EnsemblGenomes-Gn; EBG00001178623.
DR   EnsemblGenomes-Gn; EBG00001178624.
DR   EnsemblGenomes-Gn; EBG00001178625.
DR   EnsemblGenomes-Gn; EBG00001178626.
DR   EnsemblGenomes-Gn; EBG00001178627.
DR   EnsemblGenomes-Gn; EBG00001178628.
DR   EnsemblGenomes-Gn; EBG00001178629.
DR   EnsemblGenomes-Gn; EBG00001178630.
DR   EnsemblGenomes-Gn; EBG00001178631.
DR   EnsemblGenomes-Gn; EBG00001178632.
DR   EnsemblGenomes-Gn; EBG00001178633.
DR   EnsemblGenomes-Gn; EBG00001178634.
DR   EnsemblGenomes-Gn; EBG00001178635.
DR   EnsemblGenomes-Gn; EBG00001178636.
DR   EnsemblGenomes-Gn; EBG00001178637.
DR   EnsemblGenomes-Gn; EBG00001178638.
DR   EnsemblGenomes-Gn; EBG00001178639.
DR   EnsemblGenomes-Gn; EBG00001178640.
DR   EnsemblGenomes-Gn; EBG00001178641.
DR   EnsemblGenomes-Gn; EBG00001178642.
DR   EnsemblGenomes-Gn; EBG00001178643.
DR   EnsemblGenomes-Gn; EBG00001178644.
DR   EnsemblGenomes-Gn; EBG00001178645.
DR   EnsemblGenomes-Gn; EBG00001178646.
DR   EnsemblGenomes-Gn; EBG00001178647.
DR   EnsemblGenomes-Gn; EBG00001178648.
DR   EnsemblGenomes-Tr; Acid345_R0001-1.
DR   EnsemblGenomes-Tr; Acid345_R0002-1.
DR   EnsemblGenomes-Tr; Acid345_R0003-1.
DR   EnsemblGenomes-Tr; Acid345_R0005-1.
DR   EnsemblGenomes-Tr; Acid345_R0006-1.
DR   EnsemblGenomes-Tr; Acid345_R0007-1.
DR   EnsemblGenomes-Tr; Acid345_R0008-1.
DR   EnsemblGenomes-Tr; Acid345_R0009-1.
DR   EnsemblGenomes-Tr; Acid345_R0010-1.
DR   EnsemblGenomes-Tr; Acid345_R0011-1.
DR   EnsemblGenomes-Tr; Acid345_R0012-1.
DR   EnsemblGenomes-Tr; Acid345_R0013-1.
DR   EnsemblGenomes-Tr; Acid345_R0015-1.
DR   EnsemblGenomes-Tr; Acid345_R0016-1.
DR   EnsemblGenomes-Tr; Acid345_R0017-1.
DR   EnsemblGenomes-Tr; Acid345_R0018-1.
DR   EnsemblGenomes-Tr; Acid345_R0019-1.
DR   EnsemblGenomes-Tr; Acid345_R0020-1.
DR   EnsemblGenomes-Tr; Acid345_R0022-1.
DR   EnsemblGenomes-Tr; Acid345_R0023-1.
DR   EnsemblGenomes-Tr; Acid345_R0024-1.
DR   EnsemblGenomes-Tr; Acid345_R0025-1.
DR   EnsemblGenomes-Tr; Acid345_R0026-1.
DR   EnsemblGenomes-Tr; Acid345_R0027-1.
DR   EnsemblGenomes-Tr; Acid345_R0028-1.
DR   EnsemblGenomes-Tr; Acid345_R0029-1.
DR   EnsemblGenomes-Tr; Acid345_R0030-1.
DR   EnsemblGenomes-Tr; Acid345_R0032-1.
DR   EnsemblGenomes-Tr; Acid345_R0033-1.
DR   EnsemblGenomes-Tr; Acid345_R0034-1.
DR   EnsemblGenomes-Tr; Acid345_R0035-1.
DR   EnsemblGenomes-Tr; Acid345_R0036-1.
DR   EnsemblGenomes-Tr; Acid345_R0037-1.
DR   EnsemblGenomes-Tr; Acid345_R0038-1.
DR   EnsemblGenomes-Tr; Acid345_R0039-1.
DR   EnsemblGenomes-Tr; Acid345_R0040-1.
DR   EnsemblGenomes-Tr; Acid345_R0041-1.
DR   EnsemblGenomes-Tr; Acid345_R0042-1.
DR   EnsemblGenomes-Tr; Acid345_R0043-1.
DR   EnsemblGenomes-Tr; Acid345_R0044-1.
DR   EnsemblGenomes-Tr; Acid345_R0045-1.
DR   EnsemblGenomes-Tr; Acid345_R0046-1.
DR   EnsemblGenomes-Tr; Acid345_R0047-1.
DR   EnsemblGenomes-Tr; Acid345_R0048-1.
DR   EnsemblGenomes-Tr; Acid345_R0050-1.
DR   EnsemblGenomes-Tr; Acid345_R0051-1.
DR   EnsemblGenomes-Tr; Acid345_R0052-1.
DR   EnsemblGenomes-Tr; Acid345_R0053-1.
DR   EnsemblGenomes-Tr; Acid345_R0054-1.
DR   EnsemblGenomes-Tr; Acid345_R0055-1.
DR   EnsemblGenomes-Tr; EBT00001756762.
DR   EnsemblGenomes-Tr; EBT00001756763.
DR   EnsemblGenomes-Tr; EBT00001756764.
DR   EnsemblGenomes-Tr; EBT00001756765.
DR   EnsemblGenomes-Tr; EBT00001756766.
DR   EnsemblGenomes-Tr; EBT00001756767.
DR   EnsemblGenomes-Tr; EBT00001756768.
DR   EnsemblGenomes-Tr; EBT00001756769.
DR   EnsemblGenomes-Tr; EBT00001756770.
DR   EnsemblGenomes-Tr; EBT00001756771.
DR   EnsemblGenomes-Tr; EBT00001756772.
DR   EnsemblGenomes-Tr; EBT00001756773.
DR   EnsemblGenomes-Tr; EBT00001756774.
DR   EnsemblGenomes-Tr; EBT00001756775.
DR   EnsemblGenomes-Tr; EBT00001756776.
DR   EnsemblGenomes-Tr; EBT00001756777.
DR   EnsemblGenomes-Tr; EBT00001756778.
DR   EnsemblGenomes-Tr; EBT00001756779.
DR   EnsemblGenomes-Tr; EBT00001756780.
DR   EnsemblGenomes-Tr; EBT00001756781.
DR   EnsemblGenomes-Tr; EBT00001756782.
DR   EnsemblGenomes-Tr; EBT00001756783.
DR   EnsemblGenomes-Tr; EBT00001756784.
DR   EnsemblGenomes-Tr; EBT00001756785.
DR   EnsemblGenomes-Tr; EBT00001756786.
DR   EnsemblGenomes-Tr; EBT00001756787.
DR   EnsemblGenomes-Tr; EBT00001756788.
DR   EnsemblGenomes-Tr; EBT00001756789.
DR   EnsemblGenomes-Tr; EBT00001756790.
DR   EnsemblGenomes-Tr; EBT00001756791.
DR   EnsemblGenomes-Tr; EBT00001756792.
DR   EnsemblGenomes-Tr; EBT00001756793.
DR   EnsemblGenomes-Tr; EBT00001756794.
DR   EnsemblGenomes-Tr; EBT00001756795.
DR   EnsemblGenomes-Tr; EBT00001756796.
DR   EnsemblGenomes-Tr; EBT00001756797.
DR   EnsemblGenomes-Tr; EBT00001756798.
DR   EnsemblGenomes-Tr; EBT00001756799.
DR   EnsemblGenomes-Tr; EBT00001756800.
DR   EnsemblGenomes-Tr; EBT00001756801.
DR   EnsemblGenomes-Tr; EBT00001756802.
DR   EnsemblGenomes-Tr; EBT00001756803.
DR   EnsemblGenomes-Tr; EBT00001756804.
DR   EnsemblGenomes-Tr; EBT00001756805.
DR   EnsemblGenomes-Tr; EBT00001756806.
DR   EnsemblGenomes-Tr; EBT00001756807.
DR   EnsemblGenomes-Tr; EBT00001756808.
DR   EnsemblGenomes-Tr; EBT00001756809.
DR   EnsemblGenomes-Tr; EBT00001756810.
DR   EnsemblGenomes-Tr; EBT00001756811.
DR   EnsemblGenomes-Tr; EBT00001756812.
DR   EnsemblGenomes-Tr; EBT00001756813.
DR   EnsemblGenomes-Tr; EBT00001756814.
DR   EnsemblGenomes-Tr; EBT00001756815.
DR   EnsemblGenomes-Tr; EBT00001756816.
DR   EnsemblGenomes-Tr; EBT00001756817.
DR   EnsemblGenomes-Tr; EBT00001756818.
DR   EnsemblGenomes-Tr; EBT00001756819.
DR   EnsemblGenomes-Tr; EBT00001756820.
DR   EnsemblGenomes-Tr; EBT00001756821.
DR   EnsemblGenomes-Tr; EBT00001756822.
DR   EnsemblGenomes-Tr; EBT00001756823.
DR   EnsemblGenomes-Tr; EBT00001756824.
DR   EnsemblGenomes-Tr; EBT00001756825.
DR   EnsemblGenomes-Tr; EBT00001756826.
DR   EnsemblGenomes-Tr; EBT00001756827.
DR   EnsemblGenomes-Tr; EBT00001756828.
DR   EnsemblGenomes-Tr; EBT00001756829.
DR   EnsemblGenomes-Tr; EBT00001756830.
DR   EuropePMC; PMC2663196; 19201974.
DR   EuropePMC; PMC4644332; 26568784.
DR   EuropePMC; PMC6430987; 30799497.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01686; Acido-1.
DR   RFAM; RF01687; Acido-Lenti-1.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000360.
DR   SILVA-SSU; CP000360.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000157
CC   Source DNA and bacteria available from Cheryl Kuske
CC   (kuske@lanl.gov)
CC   Contacts: Cheryl Kuske (kuske@lanl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5650368
FT                   /organism="Candidatus Koribacter versatilis Ellin345"
FT                   /strain="Ellin345"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:204669"
FT   gene            33..1418
FT                   /locus_tag="Acid345_0001"
FT   CDS_pept        33..1418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39006"
FT                   /db_xref="GOA:Q1IVU4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVU4"
FT                   /protein_id="ABF39006.1"
FT                   /translation="MSLSTTTPPAPNPWLQVLDALEKKVNRLSYDTWLKPTRFSHSQGN
FT                   KIFVRVPTPEFRHIGEKYGDLIQEALDSLGLGFEDVEFVTDQAPAEAPMRHDGGFPPQS
FT                   AAAPAPARVQQARFDWDGAAQLNPKYIFDNFVTGPGNQFAHAASRAVADRPSKTYNPLF
FT                   LYGGVGMGKTHLMQAIGHTIKRNNPEHSICYVSSEKFTNDMINSVRYDKMTSFRERYRT
FT                   VDVLLIDDIQFIARKERTQEEFFHTFNALHEQQKQLVIASDRPPKELAEIEDRLRSRFE
FT                   WGLIADIQPPDLETKVAILQKKAESERTQLPTDVALFIASNIRSNVRELEGALIRLVAY
FT                   SSLTGGELNLMTAQQVLKNIIDQQTRKVTIESIQKACAEQFGLRIAEIKAKNNSRAIVY
FT                   PRQIAMYLAKHLTEASLPEIGRQFGGKHHTTVLHSVDKIDEARKSDKDLNRLLNKLTES
FT                   LSG"
FT   gene            1811..2926
FT                   /locus_tag="Acid345_0002"
FT   CDS_pept        1811..2926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39007"
FT                   /db_xref="GOA:Q1IVU3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVU3"
FT                   /protein_id="ABF39007.1"
FT                   /translation="MEITVSKFDLLKELTATQGVVERKTTIPILSNFLFEAVGDKLNIT
FT                   ATDLDLSLRTACVTKVKKEGSCTIPARKLYDYVKLLPDGDITIKLLENHWVNIRSGRSN
FT                   TKMVGMARSNFPSLPVFPTTGMVKIPAAALRTMIGKTIFAISNEESRYTLNGALMVLKP
FT                   ESLIMVSTDGHRLAHIERQGGKFEISGEMKTLVPKKAMSELYSLLQSTETEDIEFAKDE
FT                   STLFFRIGGRLLTSRQLTGQFPNYEAVLPKDNDKSVTIRTDEFMAAILRVAQFADERSQ
FT                   AIKVRLEKDELRISSSSTETGESEDSIVTAYTGEVVTIGFNSQYLIEFLKAAGADEVRL
FT                   EFKNAQSAGQLRPEATSDEFKYRYVVMPMRI"
FT   gene            2996..3931
FT                   /locus_tag="Acid345_0003"
FT   CDS_pept        2996..3931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0003"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39008"
FT                   /db_xref="GOA:Q1IVU2"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVU2"
FT                   /protein_id="ABF39008.1"
FT                   /translation="MIGAVDIGGTKIAVGVVDADGVVIASDECPTEAKRGYADALNRIS
FT                   AMLRACAEKSGEVITGVGIGSTGPVDPLTGEIGNAEFIKEWMGCNPVRDLAERFGVKVA
FT                   MENDADAAALGEAAWGAGRGRKHMIFVTVGTGIGGGIILGGRLYRGADGAHPEIGHYTM
FT                   DSSGPLCFCGIHGCWEVLCAGPAMGAWMTSQAPADWPPEDFSAKRICERAREGDPIAKR
FT                   GVEREAHYLGLGVANLITLFTPEVIVLGGNVMRSADLFMEQIHAEVRRCCTQVPYEKTD
FT                   IRLASLGPQTGLVGAARVWHHRFRQDGEVA"
FT   gene            3928..4977
FT                   /locus_tag="Acid345_0004"
FT   CDS_pept        3928..4977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0004"
FT                   /product="Glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39009"
FT                   /db_xref="GOA:Q1IVU1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVU1"
FT                   /protein_id="ABF39009.1"
FT                   /translation="MKSDSSVIRGRYLEDILDQPRALRATWDVLSDSSAFERIRTLLGS
FT                   RKFERLVLTGMGSSYFASHPLAIECAEHGWTPILLETSELLHYYPHLLKPSTLVIAVSQ
FT                   SGRSAETVRLLEGNAGGHAVVAVTNTPDSPLATKADVAVLTKAGEEFSVSCKTYVSSLM
FT                   ALEVVSAALCGKSTDDRLQELQVAADAVEQYLREWEKHVADLCEALQPIKDIFLVGRGS
FT                   SLAAVYTGALTIKESDHFHAEGMSSAAFRHGPFEMLRPELFVAVIAGEQRTRALNERMA
FT                   AEIREAGAHGVLISTDSNDAACRIPTVPECVRPIVEILPAEMMTIALAALAGREAGKFE
FT                   RATKITAVE"
FT   gene            4984..6249
FT                   /locus_tag="Acid345_0005"
FT   CDS_pept        4984..6249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0005"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39010"
FT                   /db_xref="GOA:Q1IVU0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVU0"
FT                   /protein_id="ABF39010.1"
FT                   /translation="MRRSYAIVALLMLVYFVLSFLTNILGPIIPDIITSFHVSLTAAAI
FT                   LPFAFFIAYGVMSIPGGFLVERFSEKPVMVASFFAATIGALVFAVHPSYLVAIVSLFVM
FT                   GGGMAVLQVALNPLLRVAGGEENFAFNSALAQLVFGLASFLSPLVFSYLVENLPKLSGH
FT                   NWFVHLLAAVTPAQWPWLSMYWIFAASTALMVILLLVVRFPAVQRTSDEAAGSREMYSA
FT                   LMKRPMVWLYFGCIFAYVGCEQGVAVWMSKFLEQYHGFDPHTTGASAVSWFWGLMTAGC
FT                   LLGLVLLKLFDSRRVLLAFSFGAVGCLTVALFGPAKAALYAFPAIGLFASIMWPTLMSL
FT                   ALNSVSEHHGSFAGILCTGIMGGAVVPLIIGRLGDMFGLRYGMMVLYLTFGCVLSVGLW
FT                   AKPIISNATFSSNPGTPLPDAK"
FT   gene            6357..6773
FT                   /locus_tag="Acid345_0006"
FT   CDS_pept        6357..6773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0006"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39011"
FT                   /db_xref="GOA:Q1IVT9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT9"
FT                   /protein_id="ABF39011.1"
FT                   /translation="MLKGFKEFVLRGNVVDLAVGVVMGAAFGTVVTSIVKDLLTPFIAA
FT                   IVGKPDFSAIALEIRGSKLMFGNFVNAAISFLLIAASVYFFVVMPMNAIIKRARKEPPV
FT                   DPTTKKCPECLSEIPLDARRCAHCTSQLTVPAKA"
FT   gene            complement(7066..7464)
FT                   /locus_tag="Acid345_0007"
FT   CDS_pept        complement(7066..7464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39012"
FT                   /db_xref="GOA:Q1IVT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT8"
FT                   /protein_id="ABF39012.1"
FT                   /translation="MVLPGAQALLGFQFINVWLGGFDTISQHAKLTHLASLCSVAIATI
FT                   LLVLPAAYHRIAEAGEDTANFVRFAGRMLLTAMVFLALGICGDFFVIAEKLQFSIIAST
FT                   AMSGGMLALFLGLWFGYTSWKRMQIAHS"
FT   gene            8277..10916
FT                   /locus_tag="Acid345_0008"
FT   CDS_pept        8277..10916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0008"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39013"
FT                   /db_xref="GOA:Q1IVT7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT7"
FT                   /protein_id="ABF39013.1"
FT                   /translation="MASKETAAAAAAEKKLNGATEPKKNGNGNGSSDYNEDSIKVLGGM
FT                   EAVRKRPAMYIGSTGEMGLHHLVYEVVDNSVDEALAGHADRIDVTIHIDNSITVIDNGR
FT                   GIPTGDMDIDGEMIPAAQVVMTVLHAGGKFDSSNYKVSGGLHGVGVSCVNALSSLLELE
FT                   IWRDGHVWQQEYSEGVPTTKLKKSGKTTKLGTKIHFIPDAKIFTVSEYNYDTLANRLRE
FT                   LAFLNKGLLITLTDERTTDPKTGESKHQEFKYTGGIAEFIKHLNRGKSVLHEKPIYMEA
FT                   ERDGVAMEIALQYNDAYSETVFSFANNINTVDGGTHLQGFRSSLTRTINYAGQQLGLFK
FT                   DVKENLSGDDVREGLVAVISVKLSQPQFEGQTKGKLNSDIAGIVQAFVNERLGAFFEQN
FT                   PPVARKIINKAIEASRAREAARKARDLTRRKGALDGGGLPGKLADCSERQPERCEVYLV
FT                   EGESAGGTAKQGRDRRFQAILPLKGKILNVEKARYDKMLGHEEIRAMITALGTGIGKDD
FT                   FDYAKLRYGKIILMTDADVDGSHIRTLLLTFFFRHMQELIKRGNVFIAQPPLYRIKKGK
FT                   FEQYIKNEAEFVKVMVKRAADGMVIRYGEGAAKLEGAQLTRFMTSLNEYIGFFEKVSKR
FT                   VRDERVVELMEKLELSKKVDFEGEAKKSPAKVAALEKEIKAIAKDRKLRDIEARFDDEH
FT                   NLWFVRFVNDQGAEHLLNWELATSPEYRQMMSKYAQIKDFMEPPFVIETASKKSSSAAE
FT                   AAEDLSDAERADLEKAEQKSAKVAVRRTRAGEPEIVEKTNVRELFDYVLSEGKKEYSVQ
FT                   RYKGLGEMTAEQLWMTTMDPERRTLLEVKLEDMTETETIFSTLMGEDVEARRKFIEENA
FT                   LDVKNLDI"
FT   gene            11118..13151
FT                   /locus_tag="Acid345_0009"
FT   CDS_pept        11118..13151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0009"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39014"
FT                   /db_xref="GOA:Q1IVT6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT6"
FT                   /protein_id="ABF39014.1"
FT                   /translation="MKAIQVVLGTALLLAGIPWVHGAPEENDTGFSIDALDRTADPCTD
FT                   FYQFACGNWVKNHPLPAERTRFATFDQLEEHNTATLRTILDKASEQAKAGSADATTTKI
FT                   GDYYAACMDESAIDAKGTAAIAPVLEKIRGMQSRADLPQTLAALHLISVDAFFGFFSIT
FT                   DPKDARQVIAATDQGGIGLPERDYYLTTDEKSVKLRAEYVAHIAKMLELAGTSQAAAAK
FT                   SAEKVMALETQLAKISMDVVSRRDPEKLYNPSTREKLVAGSKDFNWNHYLAAVNPPQFE
FT                   KINHVSPPFLNGLGAVLQKTDLAVIKDYLTWQTLHAASQELPTGFQTEEFHFYRQVLGG
FT                   AKEQRPRWKRCANYTDNHLGEALGQVYVKSAFGAQAKERMETMVKNLEAALHEDISNLD
FT                   WMSQDTKKQAMAKLDAMVDKIGYPDKWRDYSNYRVERGDALGNLWRGNEFEIRRQLNKI
FT                   GKPVDKTEWGMTPPTVNAEYHPERNDITFPAGILQPPFFDNRLDDAINYGAIGAVIGHE
FT                   MTHGFDDEGRQYDRDGNLHDWWTATDGKAFTDRAECIVNEYSGFEATEGVKLNGKLTLG
FT                   ENTADNGGVRVALMALLASYGNNPPADVDGFSPEQRFFLGYGHAWCANQTPESLRLQAT
FT                   TDPHSPGKWRVNGTVQNMPEFRKAFGCKAGMAMAPSNACRVW"
FT   sig_peptide     11118..11186
FT                   /locus_tag="Acid345_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.904) with cleavage site probability 0.721 at
FT                   residue 23"
FT   gene            13474..13911
FT                   /locus_tag="Acid345_0010"
FT   CDS_pept        13474..13911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39015"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT5"
FT                   /protein_id="ABF39015.1"
FT                   /translation="MARYLATSVLALTLAVSGAAFAQDAQTAAPAQGNTAAATAQNGQR
FT                   GERMFDNLSQKLNLSDEQKTQLKPIFAERRQKMEALRSSTDDKATKRKEARQIMKDSDA
FT                   KVKGVLSADQYTQYKQLKHQMREQRKQGRDNQQQAQPQPQQ"
FT   sig_peptide     13474..13542
FT                   /locus_tag="Acid345_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            14112..15593
FT                   /locus_tag="Acid345_0011"
FT   CDS_pept        14112..15593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39016"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT4"
FT                   /protein_id="ABF39016.1"
FT                   /translation="MRKFVGGFLTTVWLMFLLSVAAVAEDGTSLTIYNGGFAAVREHLP
FT                   LDLKSGINPFTFAGATTTLEPESVILRDPLGQHSVQILEQSYRSDPVSQGLLLSMYEGK
FT                   TIDFLVRRGQFGEREEIVKGKVIRSGYVHPNAQNPYGGAQQPVIEVDGKLRFSLPGEPI
FT                   FPDLGQDTVLKPTLNWLLQSDKPGAFNAELAYITNGMSWNADYNLVVPETGNVADVVGW
FT                   ITMHNNTGKTFENSRIRLMAGDVNKIQNTGGLRRDYAAKAAMSMNEAASAPVVTEKAFD
FT                   EFHLYTLEHPTTLHEEETKQVEFVHAMGVTSQRIYVYDGMDGYYYYGSYVGDQPSYGTQ
FT                   TNKKVWVMQEFKNSKENGLGIALPKGRVRFYRRDSDGSLQFIGENQIDHTPKDETVRLY
FT                   TGNTFDVVGERKQTDYHVDHNGHWADESFEIHVRNHKKEAVTVRVVEHLYRWVNWKITT
FT                   ETDQHKKTDSQTMEYHVTVAPDQEKVVRYTVHYSW"
FT   sig_peptide     14112..14186
FT                   /locus_tag="Acid345_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            15673..16821
FT                   /locus_tag="Acid345_0012"
FT   CDS_pept        15673..16821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39017"
FT                   /db_xref="GOA:Q1IVT3"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT3"
FT                   /protein_id="ABF39017.1"
FT                   /translation="MPKLFGERIRLPQVFAALLLCVFLAQCLWFVARVPLVENEGLVLQ
FT                   SGAQQLRGMFIAGTQQNSPLISLLAAIPVIGKDSSNAYLMIRNRWAIRAPFLLMGVLLG
FT                   GSLWYVARRLYGNAGGYIALTLYIFSPFLIIRSALLQPDVPAAWGAFGLIFTGIAVAHT
FT                   LYAPREVVLWNWKRIVLLGISICIAVGAQYSVVWLLLPALAFMLWLAPVRRGAAMTIFV
FT                   AACVVGLVALSFTFVPNPAEMLAALRHANWGEFDVSQLASMSSYRLIGSFFRDNSLPAL
FT                   LLLLIALVTYIAWPRTRYFGTTAPLVAGLFCVFLCLVMPHFGGRLFLFVALPMFYVFIA
FT                   GVFTDLLETRYMVPLAAVLVGALLVHAAASVMGLVQLTHLTR"
FT   gene            16925..17656
FT                   /locus_tag="Acid345_0013"
FT   CDS_pept        16925..17656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39018"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT2"
FT                   /protein_id="ABF39018.1"
FT                   /translation="MHSKFRLFALASAVAAFAALPVAAQNQGSHGGSGGGGHATSTSHS
FT                   GNWAGGAVKVAGPSHGNNGHNGNGDHGGGNGGHNGHDNNSHRNNNNGFGYGSGYGYGGT
FT                   STELPYDSEYGQLEGHGTFDHGEVQEQPDNRVGPTIFEHNGQASGAIADNRSSAPIYRE
FT                   QQPSYDEPAPVASSLDDSPNPTILVFRDGHQQEVSNYAIAGTHLIVLGSKTQRLLLTDL
FT                   DLSATSKVNADRGVNFKMPQN"
FT   sig_peptide     16925..16999
FT                   /locus_tag="Acid345_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.940 at
FT                   residue 25"
FT   gene            complement(17749..18162)
FT                   /locus_tag="Acid345_0014"
FT   CDS_pept        complement(17749..18162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39019"
FT                   /db_xref="GOA:Q1IVT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT1"
FT                   /protein_id="ABF39019.1"
FT                   /translation="MKRPVGVVLLSVLFSSLAGVVAALIAFGCWAAHIGHLTNGPLFIG
FT                   GMAELTLGFMTFGFISYGLWDLDEDARWATFSIFAGPAGLAMILGISTLSRDLVDGIIA
FT                   MTLAGLLAVPAIYLQLRPIRKHFAELILIDLHV"
FT   sig_peptide     complement(18067..18162)
FT                   /locus_tag="Acid345_0014"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.665 at
FT                   residue 32"
FT   gene            complement(18300..18869)
FT                   /locus_tag="Acid345_0015"
FT   CDS_pept        complement(18300..18869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0015"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39020"
FT                   /db_xref="GOA:Q1IVT0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVT0"
FT                   /protein_id="ABF39020.1"
FT                   /translation="MTKLDKRVQRTQYQLRSALLALIVEHGYEQLSVQDILDRAGVGRA
FT                   TFYAHYRSKEDLLVRSMDILRLHLVAETAAKKKSKRTPLGFTLAFFRHVDSHRQLWRAI
FT                   VGRESGFIVDRQMRRLLLDLVRLDTSRSAALGRSNKIPELAAHFLVGALMSVMVWWLDY
FT                   NIRLTPLEVDRVFREMSLPTLKALLP"
FT   gene            18980..19936
FT                   /locus_tag="Acid345_0016"
FT   CDS_pept        18980..19936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0016"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39021"
FT                   /db_xref="GOA:Q1IVS9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVS9"
FT                   /protein_id="ABF39021.1"
FT                   /translation="MSEGKHGHMLPMGLFGVIAAIGLMVFVPRLHAISRVMVWFAGFHV
FT                   LGAAVLGASVYVLGGNRLARTLRRARHDEYQFGWEPAWMLGPWIAASTLLGCAIVLEIA
FT                   VPRIWGLALLATLQAAGFFAGGLIARTTASYDSAVLPMVDLRLGEESVVLDAGCGSGRT
FT                   VLALNRAFPQARIVALDRFDSGYIEGGGRDLLERNLELAGIRQRVEIRKGDITHVPFED
FT                   GDFDAVVSAHAMDHLGDATMPGLREVRRVLKPDGHFLLAVWIPGWTMFAVASVLSFHLA
FT                   GKKKWRTRVCEAGFKIADEGMFNGYYFLVLGRTEPLD"
FT   gene            complement(19887..20291)
FT                   /locus_tag="Acid345_0017"
FT   CDS_pept        complement(19887..20291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39022"
FT                   /db_xref="GOA:Q1IVS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVS8"
FT                   /protein_id="ABF39022.1"
FT                   /translation="MRFAKSTYLIAAIYGFLVVTPLYFLFDRIGHDAPPPITHPEFYCG
FT                   FVGVALLFQVLFLVIASDPIRYRPIMLVTVLEKVIYTGPCILLYLQGRIAKNSLAPSLV
FT                   DPMFGLLFVIAYVKTNPAVLSAQARGSSSR"
FT   gene            20559..20954
FT                   /locus_tag="Acid345_0018"
FT   CDS_pept        20559..20954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0018"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39023"
FT                   /db_xref="GOA:Q1IVS7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVS7"
FT                   /protein_id="ABF39023.1"
FT                   /translation="MYAVIRAGSKQFRVSPGDVIKVDSAPHSESGKLEIADVLAVSNGQ
FT                   GKFGSPENATVTAEILGDGRGDKILVFHYKRKKQYKKLQGHRQGFTALKITEINVDGEK
FT                   FTIDDMPKKEAAPAKARRSTKKAAAAE"
FT   gene            20966..21226
FT                   /locus_tag="Acid345_0019"
FT   CDS_pept        20966..21226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0019"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39024"
FT                   /db_xref="GOA:Q1IVS6"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVS6"
FT                   /protein_id="ABF39024.1"
FT                   /translation="MAHKKGLGSSRNGRDSNAQRLGVKAFGGETVTGGTIIVRQRGTRI
FT                   KPGLNVGRGKDDTLFAKADGRVEFKDRGNLGRFVSIVPAKA"
FT   gene            21328..22425
FT                   /locus_tag="Acid345_0020"
FT   CDS_pept        21328..22425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0020"
FT                   /product="Small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39025"
FT                   /db_xref="GOA:Q1IVS5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVS5"
FT                   /protein_id="ABF39025.1"
FT                   /translation="MFVDEAKIRVKAGNGGNGIVAFRREKFVPRGGPWGGDGGRGGDVI
FT                   MESSERHNTLVHFRFNPEYKAERGRHGEGANKTGREGVDVLLKVPVGTLVYDDETGELL
FT                   HEFVHPDERIIIARGGRGGRGNAQFATPTHQAPRESEDGKIGDEKFLRLELKLLADVGL
FT                   VGYPNAGKSTLISRISSARPKIADYPFTTLQPNLGVVVVGEMPHEQSYVVADIPGLIEG
FT                   ASLGAGLGMQFLRHVERTRLIAHLVDVSDASGRPDPVQDYKVITKELASFGSGIEKKPT
FT                   IIVATKIDVANPDKLKKLTTFAKRSKKAFFAISAVTGEGIEPLKWEMAKRVEAIRAKAQ
FT                   DPVEEADEIEAPKKKRRAPARKSVR"
FT   gene            22422..23198
FT                   /locus_tag="Acid345_0021"
FT   CDS_pept        22422..23198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0021"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39026"
FT                   /db_xref="GOA:Q1IVS4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVS4"
FT                   /protein_id="ABF39026.1"
FT                   /translation="MNVALFGGTYDPIHLGHLAVARAAAERFNLKQIHFVPAYIPPHKQ
FT                   KQAISSFGHRYTMISLATAGDPRFIPSLLESPDAIQRSGLDASYSFDTVRRMKSRLKKG
FT                   DKLYFLIGMDAFADIAKWRNPVEVLRECEFIVANRPGYSLADVVKSLPKELQPTAEGTR
FT                   PIEREKPRGALKLEGATIHLLEDVNEPVSSTEIRLAVGKRGQALELLVGDAVADYIRKL
FT                   YLYKPTEPVQDEAGKQKSGLKDRGGLHVVGGREHQD"
FT   gene            23235..23726
FT                   /locus_tag="Acid345_0022"
FT   CDS_pept        23235..23726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0022"
FT                   /product="Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39027"
FT                   /db_xref="GOA:Q1IVS3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVS3"
FT                   /protein_id="ABF39027.1"
FT                   /translation="MSKSESRKAVALAVSAAQEKKAENIAILELDKSSSGFTDYFVICT
FT                   GSNPRQLQAISDEVDQKLSSIGQEPRHVEGYNQAEWVLMDYVDFVVHIFSENARKFYDL
FT                   ERLWKSAKHLSPEDLSKPSERTPAKSRPAAKKTAVRKSAPAVKKPRKTAAKKATKRTRG
FT                   "
FT   gene            23738..24697
FT                   /locus_tag="Acid345_0023"
FT   CDS_pept        23738..24697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0023"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39028"
FT                   /db_xref="GOA:Q1IVS2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVS2"
FT                   /protein_id="ABF39028.1"
FT                   /translation="MSEQGAASAKAAESSALSAYVAVDAASKRLVEQIKRVAQSAATVL
FT                   VRGENGVGKDLVASLLHYLGPNRDEPMVKIDCASLPHELIESELFGYEKGAFTGATHQK
FT                   RGRLELAGNGTLILDEIAALTMPMQAKLLRVIEQKEFERLGGEKTIKVHARILALTNVD
FT                   LERAVARRSFREDLYYRLSVIPLVVPPLRERRDDIQPLAEHFLSQLAQVHRRPKPVFTA
FT                   GALEALLSFSYPGNVRQLRNILERVVVMSTGPEIHEDDLPSFVRQATGRPMMTLEELER
FT                   SYIAEVLDATRGKKSKAAEILGISRKTLLEKRKRYGLD"
FT   gene            24743..25183
FT                   /locus_tag="Acid345_0024"
FT   CDS_pept        24743..25183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0024"
FT                   /product="protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39029"
FT                   /db_xref="GOA:Q1IVS1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVS1"
FT                   /protein_id="ABF39029.1"
FT                   /translation="MKLRVVWIGKTKESAIQTLTGEYLKRLSRYVATEGLEIGSEEALL
FT                   KLKDRPGRTAPVLVLMDERGKQVGSEELANFLGYHRDQGVQDLIFAIGPSDGWQKETLK
FT                   SATQVLSMGKMTLPHELARVVLLEQLYRGYTILTGHPYHGGH"
FT   gene            25183..25749
FT                   /locus_tag="Acid345_0025"
FT   CDS_pept        25183..25749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0025"
FT                   /product="protein of unknown function DUF1089"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39030"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVS0"
FT                   /protein_id="ABF39030.1"
FT                   /translation="MLSLTRIWRRIGLDGLEHITLQEVPGGYVADSVLSVEADLGGVTC
FT                   EYHFDLDARWRTKTFTLKQHQSGEDRTLRIERVHESEWKVDGADRPDLSGCLDLDLTVS
FT                   PFTNTLAIRQLALAPNEAKELNAVYVKIPQLEVVLARQRYQRLDANEPPRRFLYSGLDT
FT                   GFIQEITVDEHALVEGYPRFAERVA"
FT   gene            complement(25751..26500)
FT                   /locus_tag="Acid345_0026"
FT   CDS_pept        complement(25751..26500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0026"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39031"
FT                   /db_xref="GOA:Q1IVR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR9"
FT                   /protein_id="ABF39031.1"
FT                   /translation="MGKLSGKVAVVTGASKGIGAAIAKTLAGEGASVVVNYASSKAGAD
FT                   KVVNEIQKAGGKAVAIHADLSKPEDAKKLAAETKKQFGKVDILVNNAGVYEFRPLELID
FT                   ETHVKKIFDLNVTGLLFTTQEFVKLIPEEGGSIINISSVVAKTPPSGSAVYSATKGAVD
FT                   VISRVLAQELGPKKIRVNSLSPGFTITEGVQASGYEEDLSKSSVLRTPLGRVGQPDDIA
FT                   KVALFLASGDSGWVTGETILAGGGIRV"
FT   gene            complement(26594..26917)
FT                   /locus_tag="Acid345_0027"
FT   CDS_pept        complement(26594..26917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0027"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39032"
FT                   /db_xref="GOA:Q1IVR8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR8"
FT                   /protein_id="ABF39032.1"
FT                   /translation="MSRRQIRFARPLAYHAAMEKRQFTRIAKALADPRRFEILQQIASE
FT                   EEVSCAAVKECHEVTPATLSHHLKELESAGLVEVRKESKYVYLSLQRPAWKAYLKELKK
FT                   IGR"
FT   gene            27088..27312
FT                   /locus_tag="Acid345_0028"
FT   CDS_pept        27088..27312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0028"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39033"
FT                   /db_xref="GOA:Q1IVR7"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVR7"
FT                   /protein_id="ABF39033.1"
FT                   /translation="MKTATHPSYDEVRVQCACGNSFATRSTHKGDIHVEICSACHPFFT
FT                   GKQKLMDTAGRVERFRRKYAKADKQADKQ"
FT   gene            complement(27354..27635)
FT                   /locus_tag="Acid345_0029"
FT   CDS_pept        complement(27354..27635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39034"
FT                   /db_xref="GOA:Q1IVR6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR6"
FT                   /protein_id="ABF39034.1"
FT                   /translation="MRVWLRDRHVGAVLIAFLLYNFVTGMVRAVENPLLMWIQRWSQHS
FT                   ALSAGQPWYNKGQVFGSLSDAILFLIVSLLIAAWLYGGDKPTETKAKA"
FT   sig_peptide     complement(27546..27635)
FT                   /locus_tag="Acid345_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.909) with cleavage site probability 0.906 at
FT                   residue 30"
FT   gene            27676..28788
FT                   /locus_tag="Acid345_0030"
FT   CDS_pept        27676..28788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0030"
FT                   /product="Dihydrouridine synthase TIM-barrel protein nifR3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39035"
FT                   /db_xref="GOA:Q1IVR5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR5"
FT                   /protein_id="ABF39035.1"
FT                   /translation="MRKGFDNPIQHQAPEGACVAVRFQIGSVEIRPATVLAPMAGVTDT
FT                   VFRRFIRNLGGCGLMMTEFTSADGLARMREAKARRYLTFYGNERPISAQLFGSDAETLA
FT                   DAAKVVQDLGFDLVDLNLGCPSKRVVKCNGGSGLLRDLPQIKVIFESVRKAVTIPFTVK
FT                   FRAGWNEKELVFLELAKLAENCGLNAVAMHARTREQGYSGQANWGWIADLKQVVKIPVI
FT                   GNGDIRTPEDAAAMVAKTGCDAVMIGRSAASNPWIFRQIEQYTATGRYDLPTNEDRYEM
FT                   IRMYFRMLIENDTQGAEGKMKQFASWFTHGVPGGGVLRKAVYEAKKRETILVAVDQFFE
FT                   ALLAGKIAAASETGPSPNDELESNPAAMTG"
FT   gene            complement(28785..29210)
FT                   /locus_tag="Acid345_0031"
FT   CDS_pept        complement(28785..29210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39036"
FT                   /db_xref="GOA:Q1IVR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR4"
FT                   /protein_id="ABF39036.1"
FT                   /translation="MTQQLLTSENVERPVLILPIAIVCFSFAAVLCICGVLSLIGSMSL
FT                   RLAAQLLGSGLEVMGPTPFFLYTIALCAGGTGLLLRQNWARLLTVILCAVGILFVVPHI
FT                   SSAVVDERYAAMSLDGVQILVRMAIASYLWREREWFV"
FT   gene            29312..29611
FT                   /locus_tag="Acid345_0032"
FT   CDS_pept        29312..29611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR3"
FT                   /protein_id="ABF39037.1"
FT                   /translation="MAATKKSTRSRSSRSSGTRSRKTAAKKKSTRRTSAKKSSRRKYSP
FT                   KAGKSVKREMHEFKRGKLKSGRSGKKVKSRKQAIAIGLSEARRSGAKVPRKKAA"
FT   gene            29683..30369
FT                   /locus_tag="Acid345_0033"
FT   CDS_pept        29683..30369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0033"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39038"
FT                   /db_xref="GOA:Q1IVR2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR2"
FT                   /protein_id="ABF39038.1"
FT                   /translation="MLKAAIFDIDGTLVDSVDLHAEAWVRAFHRFRYQHVTFAEVRSQI
FT                   GKGGDQLMPVFIPQQDLERIGDALEQWRSELFRREYMPHVKPFPMVRELFEHLKNDGWQ
FT                   IALASSSNKQDLEQYKKIANIGDLLEASTSADDAERSKPHPDIFAAALDHLGGLKPTEV
FT                   VVVGDTPYDAEAARKLGVREIIGVLCGGFREDDLRKSGCTAIYPEPADILEHYAESAFG
FT                   RARKAA"
FT   gene            complement(30366..30665)
FT                   /locus_tag="Acid345_0034"
FT   CDS_pept        complement(30366..30665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0034"
FT                   /product="type I antifreeze protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39039"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR1"
FT                   /protein_id="ABF39039.1"
FT                   /translation="MPLYEYECKQCRERFEKIQKFSDEPEKVCPKCGGEVERLLSAPAV
FT                   QFKGEGWYVTDYAKKKGGAAKSSSTDSTSSEKKSESAPASAETPKPSTSSDKKS"
FT   gene            30752..31615
FT                   /locus_tag="Acid345_0035"
FT   CDS_pept        30752..31615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0035"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39040"
FT                   /db_xref="GOA:Q1IVR0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVR0"
FT                   /protein_id="ABF39040.1"
FT                   /translation="MAENVQRGTLYLVGTPIGNLEDITFRAIRTMKEVQLIACEDTRQT
FT                   QKLLNHYDIVTHTTSYHEHNELTRSAELVMQLEQGKSIALVTDAGMPGISDPGFRLITL
FT                   AIRHRIPVVPIPGPSAFLSALVASGLPTDAFRFLGFLPSKEGQRAKALEGIRNSTRTVI
FT                   FYEAPHRLLETVEEIVQVLGPERPVVVAREVTKLHEEFLRGTSTEVLSELKHRAEVKGE
FT                   ITLLIGRAPEQQHGQSVFSAATVRTRVRELMKHENLDERDALKRVAKEMGVSKSEAYRE
FT                   LQKTKD"
FT   gene            complement(31619..32092)
FT                   /locus_tag="Acid345_0036"
FT   CDS_pept        complement(31619..32092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0036"
FT                   /product="L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39041"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ9"
FT                   /protein_id="ABF39041.1"
FT                   /translation="MVTPLRVVLLCAIVVWGALATAQSSVASQSDGNAAEQQIQKVLQA
FT                   QTEAWNHGDLEGYMAGYWNSPDLTFFSNATETHGWQPTLDRYKARYQGSGKTMGKVSFP
FT                   ELKITSLSDDAAFVRGQWQLEMPDGKKPHGMFTLLVRKFPEGWRIVHDHSSGE"
FT   sig_peptide     complement(32009..32092)
FT                   /locus_tag="Acid345_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.638 at
FT                   residue 28"
FT   gene            32449..34701
FT                   /locus_tag="Acid345_0037"
FT   CDS_pept        32449..34701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0037"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39042"
FT                   /db_xref="GOA:Q1IVQ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ8"
FT                   /protein_id="ABF39042.1"
FT                   /translation="MFGARPRKSDMPTETIGRYEVESVIGRGAMAVVYKAVDPTIGRTV
FT                   ALKTMRFDVHGIEKNEVLSRFRNEARAAGKLLHPNLVTIYDAGEQEGTFYIAMECVEGN
FT                   TLQALLSEQRFLTLDRTIDIMTQICAGLDYAHANGVIHRDIKPANIMITRSGVVKIMDF
FT                   GIAKSGAQLTTGGDVLGTPNYISPEMVKGDPIDGRSDLFSAAVILHEMLLGERPFTAPN
FT                   ISTIIYKIVNEPLPPDLETKVHPAVAAILRKALSKHPSDRYQAGADLVGALKSYQALLT
FT                   QPIPTSVVPGTPIVTNWPAVSPAASAAAPKLSDTASYPRPQQSPSAPPGPTYQAPEVFG
FT                   SDVPEVFRAPVSSSDLGSTPYPPPMRSSSPPPPANPVPASFGPVGMQPAVVPPPIFGAK
FT                   NLEHETIAPPPSKSAFPRILIVAVVTVVVIAAGVFGYRAMNDQTPSKQQAPLTVVTPDP
FT                   VAITQTESAKGREETSKIDASAAAATVNKANAAPAATKGNKKNPQPTPAPAVATVAPPP
FT                   VVPGATTADLAINSNPAGASVQLDGQNRGEKTPFTASGMKAGSHTVIFTRPGYQPMTRT
FT                   VEIAAGNNASLNVNLAVAPTGIAFESTPAGAQIFVDDEPTGKVTPATVTIPPGSHSVSI
FT                   FKQGFDEGTGNVHVGEGELQHFAVVLQPGDRDSRTKRLFAGAKDKGMIIVRSRPRGAQI
FT                   RLEDMNVATTPARIIVRNGKAHLLVTKDGYKPFKKEVQVDKGDIVVVDATLEPVGQ"
FT   gene            complement(34756..35844)
FT                   /locus_tag="Acid345_0038"
FT   CDS_pept        complement(34756..35844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0038"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39043"
FT                   /db_xref="GOA:Q1IVQ7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ7"
FT                   /protein_id="ABF39043.1"
FT                   /translation="MKTLLCIFLLSLAAIAQNLPDAPSAPKPAPFGKPAPKPAVSSSSV
FT                   TVNETDALSHILTRPLQIYPALASVNKIEGDVVIEATIDTDGNVASTKVVSGHPALAPT
FT                   AVAFVKQWLFRPFYSGETRVPAVTQLTVHYSLFASEAERELEKHFQETYWPAWRAGEEA
FT                   LAKQDYATAKQQFEIGRSEASKLGQANWQELANALSRLGSVEYRQKNYSAAEPYLMQAI
FT                   QIQQNHREADSSEIADAIGNLAQVYLAENNFSKAEPLFLKAVEIYEKRLQDPTSKTQYT
FT                   NDRRHRVMNLFMLASLNQEMGAGEEALKYCDQAAGDAGQAMAKDEAIIVLRTCETVYRK
FT                   NLKYSRAREVEGLAQDLEKQAQ"
FT   sig_peptide     complement(35794..35844)
FT                   /locus_tag="Acid345_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.966 at
FT                   residue 17"
FT   gene            complement(35844..36707)
FT                   /locus_tag="Acid345_0039"
FT   CDS_pept        complement(35844..36707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0039"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39044"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ6"
FT                   /protein_id="ABF39044.1"
FT                   /translation="MNVPAISSKTHRTTIGDFELTILTDGTYWLDGGAMFGVVPKPLWS
FT                   KRVAADDQNRITLGLNSLLIRGNGKNILVETGIGPKLGEKQQQIYGNQSALLHSFETLK
FT                   LSPDDIDVVINTHLHFDHCGWNTYYKDGRATPTFPRATYYAQQGEWEHAQEQHDRDKVS
FT                   YISDNYDPLINAGQMKLLKGDAEIAPGVRVKMFPGHTRNLQAVIIESQGKTACYISDLI
FT                   PTSAHLDPTWVMGYDLDPILCIDNRKKFYDVAIPEKWLVAFTHDHEHPFAYVERDERGK
FT                   PVPRYL"
FT   gene            complement(36791..37687)
FT                   /locus_tag="Acid345_0040"
FT   CDS_pept        complement(36791..37687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0040"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39045"
FT                   /db_xref="GOA:Q1IVQ5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ5"
FT                   /protein_id="ABF39045.1"
FT                   /translation="MTTMIEKRKVLGRGLESLLPASRATAAPAVATAPAPPTGDMVREL
FT                   PIDHIDRNPYQTRTQWDETALNELAASIRVSGVLQPVTVRPHGDRFQLITGERRWRASQ
FT                   LAGKTTVPAIVRQVSNEQAMEMTIIENLQREDLNPMEQARAYERLAREFSLTQEQMAQR
FT                   TGKDRSSVANFMRLLKLPAEVQAMVEGNKLSFGHAKALMPLESPEAIIRLAQRVATLSM
FT                   SVRQTEGAVVNLLNPPEKKQPEERQVDPNVREVEREMERNLGVRVQIADRKGKGKIVIE
FT                   YKSLEDFDRVVEVLQRR"
FT   gene            complement(37699..38520)
FT                   /locus_tag="Acid345_0041"
FT   CDS_pept        complement(37699..38520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0041"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39046"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ4"
FT                   /protein_id="ABF39046.1"
FT                   /translation="MGKVIAIANQKGGVGKTTTAINLAASLAAAEVPTLLIDCDPQSNA
FT                   SSGLGFGKDPNRLSSYELLMGTAPASDVLQHTALEELQLIPASKNLIGANIELVMMERR
FT                   EYRLRDAIQVLKENFEFIVIDCPPALDLLTLNSLVAADSVLVPMQAEYFALEGVSELLD
FT                   TVERIRESYNPELAVEGVVLTMFDDRTNLAQSVASELKSYFGERLCDTQIPRNVRLAEA
FT                   PSHGKPALLYDPKSRGAESYIKLAKEVIQKHRNKAQHVAPEQMVQAHSESD"
FT   gene            complement(38797..39456)
FT                   /locus_tag="Acid345_0042"
FT   CDS_pept        complement(38797..39456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0042"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39047"
FT                   /db_xref="GOA:Q1IVQ3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVQ3"
FT                   /protein_id="ABF39047.1"
FT                   /translation="MTRNFRERKMPGVEIARIAELLDPIVVAERQLEQISVYLDLLLKW
FT                   NARMNLTAVRDPEQIVLRHFGESLFAARELFPDPDATGSLVDVGSGAGFPGVPIAIERP
FT                   GLSVTLIEAHGKKATFLKEVVRSTRLTNASVQAIRAEEYVGVADVVTMRAVEEFASILP
FT                   VSARLVRPGGRLACLLGSPQAAEAEGVIGECWRTERTVYFPGSTQRVLWIGQRAQK"
FT   gene            39495..40175
FT                   /locus_tag="Acid345_0043"
FT   CDS_pept        39495..40175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39048"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ2"
FT                   /protein_id="ABF39048.1"
FT                   /translation="MSEKITGKCVTASGLPLEIELEWPFRAASFGSDWYVLHGSARLDD
FT                   ASGLHADIAVHLTASIREILTAIDSQEALMASINTVRKAVDDKQLELLKTGKRQPCPLS
FT                   SRQYSIKNKHWWFLEANDEQLKAFVKRKVYWLGVVNGSGSVEVSDAVDQAYLGAKDKNI
FT                   AYRLREAAKALAGEGYLALDAAGEHASPTDMLRAEAPKMQAEKDAALDALMAKHAYESA
FT                   HNRA"
FT   gene            40290..40745
FT                   /locus_tag="Acid345_0044"
FT   CDS_pept        40290..40745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39049"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ1"
FT                   /protein_id="ABF39049.1"
FT                   /translation="MKSIRVAVCLAVIFLIFAASGRAQSAPDKAYLQKIWDGWQTLNAD
FT                   NQTQYYAQGPHQFFDIAPVKYNNWDEYKKTVGEDLAQYSKATFKINDDAQIHKAGDIYW
FT                   GSCTIDSDMLRKDGKSEKNTFRWTFIFQKQNGKWLIVHEHVSMAMPS"
FT   sig_peptide     40290..40367
FT                   /locus_tag="Acid345_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.704 at
FT                   residue 26"
FT   gene            complement(40785..41849)
FT                   /locus_tag="Acid345_0045"
FT   CDS_pept        complement(40785..41849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0045"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39050"
FT                   /db_xref="GOA:Q1IVQ0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVQ0"
FT                   /protein_id="ABF39050.1"
FT                   /translation="MNSSTGSEKLSGPSSFIRSLPKAELHLHLEGTVDPATLAELSRRH
FT                   PTTLPVLNNRYSDVSDSGRVLSEDDARAIYRYKDFIGFLMAFKAVTERLRDPDDYELIT
FT                   YRMCEELAREGCVYAEPYVSVGVIYWRGGEFDHLFDGMERGRERGERDFGVKINWIFDA
FT                   VRHFGPDEGWKVVEKAIQLRERNVVGIGIGGDEAGGPAENFREIYENAAKNGLHLTAHA
FT                   GESTGPESIWSAMNDLKAERIGHGLHAIEDPELVEHLAKSGTAIEVCVSSNVRTGCCRA
FT                   LAEHPVRKLFDAGVKITIATDDPEMFGCTLTGEYQILQDQFGFSDDDLRRVARNSFEAS
FT                   FLPETEKQKYLAAI"
FT   gene            complement(41854..43299)
FT                   /locus_tag="Acid345_0046"
FT   CDS_pept        complement(41854..43299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0046"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39051"
FT                   /db_xref="GOA:Q1IVP9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP9"
FT                   /protein_id="ABF39051.1"
FT                   /translation="MGIGAVIGSGIFTVIGTAIAGQKFDTSSILNAPLLDYIIHHTATT
FT                   GRPGAGPALALSLVLVALVCAFTALCYAELASMIPIAGSAYTYTYATMGELIAWIIGWD
FT                   LILEYAVSNMAVSVGFAAHLVDAFDWFGWHPNPRWISPAYLPSGLTDLQGGTIYNTGWH
FT                   FGFNIPAFLIVMLLTVVLVRGIRESAETNNIMVLLKIGAILAFVVAGMKYIHPTNYHPF
FT                   APQGWPGVLTGGSIIFFTYIGFDSVSTAAEEAKNPQRDLPIGIIATLVICTVLYIAVAV
FT                   VLTGIVKWDTLIDDAAPVVNSLKKLGLMSHSKGLHWTRLVVLFGAMMGMISSLLVFQLG
FT                   QARVWFAMSRDGLLPKLFGRVHPKFRTPSTATWIAGVLVGIPAGILDIGTLADLSNIGT
FT                   LFAFVLVSLGVIILRFKQPERRRGFRAPGGLTAPILSVVFCILLMSGLPILTWLRFFAW
FT                   LIIGMSVYWLYSRHRSEFAPVRK"
FT   gene            complement(43956..46505)
FT                   /locus_tag="Acid345_0047"
FT   CDS_pept        complement(43956..46505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0047"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39052"
FT                   /db_xref="GOA:Q1IVP8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP8"
FT                   /protein_id="ABF39052.1"
FT                   /translation="MQFLEKLNPQQREAVETVHGPVLILAGAGSGKTRVITYRIAYLIE
FT                   KVGVSPDSILAMTFTNKAAAEMQERVEHLVGGRTLAKPVISTFHSFCVRVLRRDIEALQ
FT                   INGKGYRKDFAIYDESDQQSLVKSAMKRLGIDDKQLTVRNVLSRISHAKNHLLDPQEVY
FT                   LQSGDPKVERIAQIYKVYESELAKANALDFDDLLLMTNKLLKTSTEVRERYNRRFQYVL
FT                   IDEYQDTNRPQYEIMRALAGTLHNVCAVGDEDQSIYSWRGADIRNILEFEQDFPEAKIV
FT                   RLEQNYRSTQNILEAASAVVKNNLKRKGKNLWTERMGGAKVGYYEAPDGENESLFVADY
FT                   INKYLMIAHDEDDEPKRAAVLYRTNSQSRLFEEAMRRYGIKYNVVGGFSFYERAEIKDM
FT                   ISYLKLIQNPSDSVALLRTINTPTRGIGKTTVEQIERIALETNLPLWDALGHIVEQRLM
FT                   QPRACAALKGFRELIQDARAMLYGKFEERLVETAQVSKPEESDAAEPEIADEDLQDNMA
FT                   FDFGELEPDAEEFSPEALGTAEEAAPEKVEGFRSPGENANVSEVLKFLIDRTGYIKQLE
FT                   AEDTPESLARIENLRELVNAAMDSRDRGETIADFLDHAALVADTDDIEAGAQVTLMTMH
FT                   AAKGLEFPLVFIVGMEEGLFPSSRTLMNPDEVEEERRLCYVGMTRAMRILVLSRARYRR
FT                   RYGTDMPDASTASRFLSEVPPQLFEDIGSPQKKTPVFGDDSYSTHYDYENEDQRPQYGR
FT                   TKQKTSYGGGSTYNSIDNIAEFFASRGKKFNRPSVPMEEPHGKRGFRPGQKVKHPKYGE
FT                   GTVYQREGEGEEAKITVQFPRFGLKKLVEKFAQLEKA"
FT   gene            complement(46847..47653)
FT                   /locus_tag="Acid345_0048"
FT   CDS_pept        complement(46847..47653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP7"
FT                   /protein_id="ABF39053.1"
FT                   /translation="MRRQWRKAKQWMRARGSRTELMKRWFAVALAICALLAMGEAQEKV
FT                   QETASFNPAKYPRNLYIVTRREFPLESASVRVIQARARNFVGAPADCNAFIEVRRDEAV
FT                   VTRLSFLAIDPGGFSFGLFLPLRQPIPDALVIMKEGDYDGRMIVISGDGKVANLPGGLY
FT                   FQTEDKRYLIGLHMRDDTGLAVVDVATRSMVLDEKALKDSGEIGEFYKDERGYFFTFHT
FT                   EPPRDEFLRLDLEHRRLVKDSSAALRSARKVEWDFTPGEMVDCTTK"
FT   sig_peptide     complement(47534..47653)
FT                   /locus_tag="Acid345_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.545 at
FT                   residue 40"
FT   gene            complement(47595..48029)
FT                   /locus_tag="Acid345_0049"
FT   CDS_pept        complement(47595..48029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39054"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP6"
FT                   /protein_id="ABF39054.1"
FT                   /translation="MSVCDTRGMSADPKSVKVHKTEGTGMEIEWKDGHRSAYTFPWLRD
FT                   ACPCALCIEEREKEGRKPGDPLKAIAGALPMFKALARPTEAEAVGKYAIRFTWNDGHQH
FT                   GIYSWEYLRENCTCPECKMKRDAAAVAQGEAVDEGEGKPN"
FT   gene            complement(48026..48958)
FT                   /locus_tag="Acid345_0050"
FT   CDS_pept        complement(48026..48958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0050"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39055"
FT                   /db_xref="GOA:Q1IVP5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP5"
FT                   /protein_id="ABF39055.1"
FT                   /translation="MRRREFLGSLVAAVACAAAGDAFAEERARQIAFTFDDPKTDSGPG
FT                   LTWQQVNDNLLAALDKANVKAALFVTGMRVDSEDGRKLVAKWNDAGHLIGSHSYSHLFF
FT                   DSKKVTLAGFEADLLKNEPLVERYSQFQKLFRFPFFKEGNTKEKRDGMRAFLKEHGYRI
FT                   GRATVDASDWAIDGRMRKRYEKDAKADLRPYRDFYLQHIWDRAQYYDSLAQRVLGRSPA
FT                   HTVLLHHSPMNAMFLPDLIAQFKGKGWEPVDAAKAFADPVYDRQPDILPCGESLIWALA
FT                   KETGKFDAELRYPGEDDVYENPKMDALGL"
FT   sig_peptide     complement(48884..48958)
FT                   /locus_tag="Acid345_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            49043..50599
FT                   /locus_tag="Acid345_0051"
FT   CDS_pept        49043..50599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0051"
FT                   /product="glutamyl-tRNA synthetase / glutamate--tRNA(Gln)
FT                   ligase"
FT                   /EC_number="6.1.1.17"
FT                   /EC_number="6.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39056"
FT                   /db_xref="GOA:Q1IVP4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVP4"
FT                   /protein_id="ABF39056.1"
FT                   /translation="MSDKKVRARFAPSPTGQLHVGNARTALFNWLFARQQGGTMILRIE
FT                   DTDLERSEARYEQQLLDDLKWMGINWDEGPDVGGPFPPYRQSDKIDVYREHAERLVAEG
FT                   KAYYCFCSQADLDAYREQALKDHRPPIYPGTCRSVDPAEAKRRRDSGEAGAIRLRIPER
FT                   PIRFHDIVHGDVEFSNEVVSDPIILRSSGVPVYNYVVVVDDAEMQITHVIRGDDHLSNT
FT                   PKQVALYEALGWAVPEFAHLSTILGPDRERLSKRHGATSIATFREMGVLPEALVNYIAL
FT                   LGWAPTGGTREIFRPEELVKEFDLRRVTPSPAIFDFEKLYWLNRHYIKEAATYRIAKLA
FT                   RHYWDRMMIDKIAHRVGMPKLDPIHVAQWGASNEVDEWLSKVTALVVPSVNKLDELPER
FT                   GKVFFDYDAAAALANPDNAEVLAAPKTTDVLAAFTTRIANESAPLTAERFKAIVNEVKT
FT                   ETGVKGKDLFHPIRIAVTGTHSGPEFDKLVPLIEEGASLNLPIAVKSVKERVAEFASAR
FT                   N"
FT   gene            complement(50853..51200)
FT                   /locus_tag="Acid345_0052"
FT   CDS_pept        complement(50853..51200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39057"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP3"
FT                   /protein_id="ABF39057.1"
FT                   /translation="MRWIVLMTMLFATLIAFAQQPVKIDHSLKRIQGVVQRENGEPIPN
FT                   IDVEVYGGRSLVAATKTDSKGKFKADSLEPGEYEVWFLYKPRPVFHDAEYNVTVDAKGP
FT                   KDAWVVVLKPL"
FT   sig_peptide     complement(51144..51200)
FT                   /locus_tag="Acid345_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(51200..51559)
FT                   /locus_tag="Acid345_0053"
FT   CDS_pept        complement(51200..51559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39058"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP2"
FT                   /protein_id="ABF39058.1"
FT                   /translation="MKTLLVGLMLMAGCASVWAQSDVVEVKQVQHLRGINGIVRDAKGQ
FT                   PLPGALIALRLQGSSTVMATTSSHLDGHFVMRLLAPGLYDMDVREAGFKKALYHLKVDD
FT                   QGTKELLIVTMQAAK"
FT   sig_peptide     complement(51500..51559)
FT                   /locus_tag="Acid345_0053"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(51556..51909)
FT                   /locus_tag="Acid345_0054"
FT   CDS_pept        complement(51556..51909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39059"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP1"
FT                   /protein_id="ABF39059.1"
FT                   /translation="MNRQVAALCVLFLTLLVPAFAEEQLAVHVNEMRVPQILGVVQNHK
FT                   GEPVTGVTVEVIRRENGHTVGEAKTDAQGRFAFPAVKNGRFNIKVHHNGIADFYHVRVT
FT                   EEHASPELVLKYK"
FT   sig_peptide     complement(51844..51909)
FT                   /locus_tag="Acid345_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(51930..52826)
FT                   /locus_tag="Acid345_0055"
FT   CDS_pept        complement(51930..52826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39060"
FT                   /db_xref="GOA:Q1IVP0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVP0"
FT                   /protein_id="ABF39060.1"
FT                   /translation="MNVFVTGSTGLIGRAVSARLRSEGHTVTPLVRGTPKAREVQWSPG
FT                   KTLDPAVLASADAVIHLAGKNVATRWTPEEKKELYESRVAGTKTISDAVAEAFRRTGKP
FT                   TVLISASAIGYYGNRGDEVLTEESAPGSGFLHDICVAWEGAAQSAKDAGVRVVHPRIGV
FT                   VLSKDGGALAQMLPIFKLGAGGRLSGGRQWWSWISIHDIVGAMMFALNNVQVSGPVNFT
FT                   GPYPVTNAAFTKVLGMVLHRPTLFPVPRFALHIAMGKEAAEETALGSLRVLPKRLLDYG
FT                   YQFQHADLREALHNVVN"
FT   gene            complement(52837..55080)
FT                   /locus_tag="Acid345_0056"
FT   CDS_pept        complement(52837..55080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0056"
FT                   /product="dipeptidyl-peptidase IV"
FT                   /EC_number="3.4.14.5"
FT                   /note="Serine peptidase; MEROPS family S09B"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39061"
FT                   /db_xref="GOA:Q1IVN9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN9"
FT                   /protein_id="ABF39061.1"
FT                   /translation="MKAHLATFLLFTSSFTLVSAQEAPKPKQLTIEAIFAKGGVLGRAP
FT                   ESVEWSPDGTKVSFVQRDDSGDNGALYYVDVTTGAKPAVLVAQEKLTEMKPPAKTKSDD
FT                   REKDNRERYSVAAYHWAPDSKHILFDSGGALWNYDLAAGKSAMIASAEGGLGDPKFSPS
FT                   GDRISYLREHDLYVSGLDGKAKRITEGGNANVLNGEVDWVYAEELNVRSNYFWSPNGKQ
FT                   IVYLQMDQTKVPTYPITDYIPTQATVDEEKFPKPGDPNPSVKLGVVSATGGKTKWIELP
FT                   ATDAYISRFGWVHDGLLYAFVLNRPQNKLDLYLVDAKSGRTQVAMTETSPSWIETNDEY
FT                   KFIANGEKLLWTSWRDGHTHIYLYDLDKSNALAPLKLERQLTRGDWDVVSIDGVNEKTG
FT                   IVYYSSDQEDERQRQEYRVNLADGVSEKITKDHGTHEAKFAPEANWFVDNYSALTTPPA
FT                   LAVCTLKDECTTFWSGRSVKDYALLVPQFVDAKADDGTVMHGVLLMPTEGVAMVNGKVP
FT                   LITNPYGGPGVPGDWDSWGSVDLFDQYMAKRGYAILKMENRGMAGRGEKFAAPIMHHMC
FT                   ELPLKDQLASVEQVLKQFPQLDRARLGWWGWSYGGTMTAWALEHSDWFKVGVSVAPVTD
FT                   WRNYDSIYTERYMGMPKEQAADYDRTSVVLNAKQIHGRLLVVHGTSDDNVHMQNSMQFM
FT                   YALINHGVPFDVQIYPRKTHSISGEETRVHLFHRIQRQFDDVLMPKTAASSTP"
FT   sig_peptide     complement(55018..55080)
FT                   /locus_tag="Acid345_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.958 at
FT                   residue 21"
FT   gene            complement(55120..56361)
FT                   /locus_tag="Acid345_0057"
FT   CDS_pept        complement(55120..56361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0057"
FT                   /product="UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39062"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN8"
FT                   /protein_id="ABF39062.1"
FT                   /translation="MLRSSLQFEPAHDAEFFAAAPAKAAVFLLRGAEGTEPYVSKTSNL
FT                   RRRMVRLLGAPEERTKRLNLRDRVQGLEYSLVASDFEAQFCLYRTLREIFPSTYTDRLK
FT                   LRFAPLVRLILENEYPRVAVTTRIQSLKSKSAYYGPFASRVAAEKFSNDALDFFLLRRC
FT                   TDDLNPDPAFPGCIYSEMKMCLAPCFKGCTDERYAAETASVREFFESGGRSLLRQIEID
FT                   RNIASENLEFEKAAELHTKIEKLKAVTQQASELVRNIERLDGVMVQPSQEAESVSLLKI
FT                   SGGFLHDPVPFNVTPRLQVGQVKTPQSMEARLSEALAAVPVQKPASAYEWMEHLALLKR
FT                   WYYRTSKTGEIFLTDDKGELPYRRLVRGVSRVYKGEKPQADLSETAGDYWRFRAAEGGV
FT                   PDRPSEARGGLGEK"
FT   gene            complement(56939..57220)
FT                   /locus_tag="Acid345_0058"
FT   CDS_pept        complement(56939..57220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39063"
FT                   /db_xref="GOA:Q1IVN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN7"
FT                   /protein_id="ABF39063.1"
FT                   /translation="MKLPTPERSAQAGIILLFVVIIRSLAEYFRLEHAYGYAIPRQILS
FT                   EYVGGALIAVVATGICVMFFFARRYRSVVVLVVVTIVALLVYKVRYIL"
FT   gene            complement(57238..58062)
FT                   /locus_tag="Acid345_0059"
FT   CDS_pept        complement(57238..58062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39064"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN6"
FT                   /protein_id="ABF39064.1"
FT                   /translation="MKKKVFLDTQILEYAATGNISKREWDHVTRYLQCEYRYYISLHTL
FT                   YELLVGLALGSNDYFSHNQKRLKVLFSLGARRYLGLAGDFVRVHAFGLPGRIHHFDPEH
FT                   LRIWARVIVGARDRWQLEREGVGLGTRAYGIKLDEVVSQVDRGKAQHVKSLEELRDGVS
FT                   KRSNQEIWSTSLLNLIEVPATPENVTRILNATDAAFWYSSALYDLAKARNYNFDERDSD
FT                   WLDYHQLLYLADPTVHFVTAEVKLPARIKKSVQRDRVLVWKDLISIAAKRGF"
FT   gene            complement(58072..58854)
FT                   /locus_tag="Acid345_0060"
FT   CDS_pept        complement(58072..58854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0060"
FT                   /product="DNA replication protein, DNAC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39065"
FT                   /db_xref="GOA:Q1IVN5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN5"
FT                   /protein_id="ABF39065.1"
FT                   /translation="MIETTVKCEVCRDTGWKTVADEKGPRAVRCDCQQRLRNDRLLQHA
FT                   YIPDRYKHCELSNFEHDGPFQTLSPAHLAASQFVEKYPVERAGLLLIGTIGVGKTHLAV
FT                   GIIRELMMAKGVPCLFYDYRELLKEIQNSYNNSVAVTELDVLRPVFEAEVLVLDELGAV
FT                   KPTEWVWDTVSHILNTRYNDRRTTIITTNYRDLPPGGAANGDEPPRRTYGAAERAAREE
FT                   TLGDRIGERMRSRLHEMCRIVTVQGEDFRIKWKSASWR"
FT   gene            59076..59360
FT                   /locus_tag="Acid345_0061"
FT   CDS_pept        59076..59360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39066"
FT                   /db_xref="GOA:Q1IVN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN4"
FT                   /protein_id="ABF39066.1"
FT                   /translation="MQSAVNPELPVAGALWSGVAAFFAFLGTAGACIAIVLIVSVGLGR
FT                   DEGGVWLPMRYAAIWVPITALVAVSVAVVTFRRVARRFTHVAAEIFDRQ"
FT   sig_peptide     59076..59171
FT                   /locus_tag="Acid345_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.682) with cleavage site probability 0.525 at
FT                   residue 32"
FT   gene            59402..60796
FT                   /locus_tag="Acid345_0062"
FT   CDS_pept        59402..60796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0062"
FT                   /product="tRNA(Ile)-lysidine synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39067"
FT                   /db_xref="GOA:Q1IVN3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN3"
FT                   /protein_id="ABF39067.1"
FT                   /translation="MLPSLKSYIRTHALFRPGDRVGVAVSGGADSVALLRGLLELRSEL
FT                   GIALSVVHLHHGIRGAEADADEQFVADLAGQFDLSLHLERVDVPSHSSQEKLSLETAAR
FT                   DLRYAFFRRLLESSACDKVATAHTLDDQAETVLLRILRGTGTRGLAAIPPFRDASPELA
FT                   ACIVRPLLGTERTEVETYLKSLNQPWREDSTNTDPKHLRNRIRHELLPMLEAEYNPALR
FT                   QSLANLAEIARAEEEYWGPIVERHFDQIVTMTNFGAVLDRSRLSELPQAFRRRVLLALH
FT                   DRLDMPVSFDGVDFELDFIEGNQKGHITHAQASIQVTSDQVSFFLRDLTKDGPAAPVLF
FT                   DQPLSIPTTLTLPTSTTLRTTFIPASNAPRYNPHNLLAHDRLQLPLRVRNWQPGDRYWP
FT                   AGSKQPEKLKRLFAEHHISADARLTWPVVLSGETIVWVKDFPVAQGFQAEQQDAVLIEA
FT                   VETRQV"
FT   gene            60793..61347
FT                   /locus_tag="Acid345_0063"
FT   CDS_pept        60793..61347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0063"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39068"
FT                   /db_xref="GOA:Q1IVN2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN2"
FT                   /protein_id="ABF39068.1"
FT                   /translation="MSREEGLPANLKAIVTAEQIQHRVVELGRQITADYAGKRIVIIGV
FT                   LENAFVFMADLIRHIELPTVCQFVLSDIHDVEEGLAPAREIFFFPEVEVSGEHVLLIEG
FT                   LVQSGLTTDFLVTNLMGRGAASIKTASLLNRQSSRKVSVQLDYFGFDIDDPYVVGYGLG
FT                   APHLGRNLPYVAATKPPEPGV"
FT   gene            61544..63457
FT                   /locus_tag="Acid345_0064"
FT   CDS_pept        61544..63457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0064"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39069"
FT                   /db_xref="GOA:Q1IVN1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN1"
FT                   /protein_id="ABF39069.1"
FT                   /translation="MNSTVKTVVFWLVIILAGVLLWQVLKQGTSGIKEQDINFSQFLDD
FT                   VNQTKVAAVTVTGAEVHGKYKDGNSGFHTTVPPNYNDMYKDLRDKGVNITVKDNQGSSW
FT                   QWILNFAPLILLGALWFFMIRQMQTGGNKALSFGKSRARLLSMNQKKVTFKDVAGVDEA
FT                   KEELKEIIEFLREAQKFQKLGGRIPKGVLLVGPPGTGKTLLARAVAGEANVPFFSISGS
FT                   DFVEMFVGVGASRVRDLFEQGKKNAPCIIFIDEIDAVGRHRGAGLGGGHDEREQTLNQL
FT                   LVEMDGFESNEGVILVAATNRPDVLDPALLRPGRFDRRVVVSRPDVRGREEILRVHSRK
FT                   IPLADDVDLSVLARGTPGFSGADLANMVNEAALNAARQNRKVVLMYDFEVSKDKVLMGA
FT                   ERKSMLLTDDEKKVTAYHEAGHALVAAKLPHADPLHKVTIIPRGMALGVTMQLPETDKH
FT                   NYTRDYLETMLAIMMGGRLAEEIFLNQMSTGAGNDIERATELARQMVCEYGMSKLGPLT
FT                   FGKKEEQIFLGREISQHRDYSEDTAIKIDGEVRRLIQEGYDKAKHVLETGTDVMHAMAK
FT                   ALLEREVLDAIEIKALVEGRPMPNRINPPSGGNATGDDVQQVLRPEPSRPGLQPGERPS
FT                   PA"
FT   gene            64148..64924
FT                   /locus_tag="Acid345_0065"
FT   CDS_pept        64148..64924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0065"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39070"
FT                   /db_xref="GOA:Q1IVN0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVN0"
FT                   /protein_id="ABF39070.1"
FT                   /translation="MAIRRSVSTTNKRPRRLSSPATALATAASRRKLVVPKRRAPAVPT
FT                   DPAFDAHTLLDRLGSGSSGKEFQRNGSLFAQGDLADAVFYIQSGKIKLTVVSKRGKEAV
FT                   VAILAEGSFFGEGCLAGQPLRMSTASSLQRSTLIRVEKLVMLNLLHKDKVFGERFLAYV
FT                   LSRNIRMEADLVDQLFNSSEKRLARLLLLLANFGNESKPIPVIAKMSQETLAEMIGTTR
FT                   SRVSYFLNRFRELGFIDYNGGGMSIHSSLMSVVLHD"
FT   sig_peptide     64148..64246
FT                   /locus_tag="Acid345_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.691) with cleavage site probability 0.387 at
FT                   residue 33"
FT   gene            complement(65299..66486)
FT                   /locus_tag="Acid345_0066"
FT   CDS_pept        complement(65299..66486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0066"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39071"
FT                   /db_xref="GOA:Q1IVM9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM9"
FT                   /protein_id="ABF39071.1"
FT                   /translation="MNNLDRDLRVLVLAPTGRDAELISDLLTSKGIRCEQPGTLAMARI
FT                   EMAAGVGALLVAEETLTLPEITAWAAQVALQPSWSDFPIILLTMSGEVDEESQRRSLLR
FT                   KPLGNVVLLERPARPETLVSTVQAALRSRRRQYQMRDYLAVQRLAEEALRKSEKLAVVG
FT                   RLAASMAHEINNPLASVTNLLYLMGQSGSLWECQEYAQTAGRELARVSEIVTQTLRIYH
FT                   QTGRPELVSPAEIVNSALNLFRARLTAAQIVVQTDFRECRPVLAMGAELRQLILNMIGN
FT                   ALDAMRTGGMLKIRVAASSERSNGSRPGVRVTIADSGSGIHPAIKEQLFEPFVSTKGDT
FT                   GAGLGLWVSSEIVRKHSGKIQVRSSVSPPAAGTVFSIFLPERPHFESRVFFARAV"
FT   gene            complement(66467..68065)
FT                   /locus_tag="Acid345_0067"
FT   CDS_pept        complement(66467..68065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0067"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39072"
FT                   /db_xref="GOA:Q1IVM8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM8"
FT                   /protein_id="ABF39072.1"
FT                   /translation="MDPHTKTTTASREPSNGSGLTEAKVIAPAELFSTGIAGLDDILGG
FT                   GLSRNHLFLIEGDPGTGKTTIAMQFLLEGLRGGHSGLYVTLSESKHELLEIARAHGWSF
FT                   DAIPIFEMVPDDKQLKPEAQYTVFNPSEIELTDTINSVLEEVERLHPVRVVFDSLSELR
FT                   LLARDPLRYRRQILALKRYFSGRDCTVMLLDDRTADIQDRQLQSIAHGVIMLESLEREY
FT                   GSKRRRLEVKKLRGSAFREGFHDYSIRRGGVEVYPRLIASEHTSTFTQKAVKSGLDELD
FT                   KLLGGGLDTGTSTLLLGPAGCGKSTIALRYAKSAAEEGNTAAFFAFDELLATLTKRGKG
FT                   LGLEVEQHVHSGKLSLRQVDAAELSPGQLVHEIRQLAETKELKLLVIDSLNGFLNGMPG
FT                   EKFLTMQLHELLAFLGQRGVTTLMTVAQHGFVGSNIDTPVDVSYLADTVLLFRYFEVAG
FT                   EVRQALSVIKKRSGAHERTIRELLMKNGGITVGSVLTEFEGVLTGAPKYRGNPAGMQTR
FT                   GARVNRSAADEQPRP"
FT   gene            68435..68704
FT                   /locus_tag="Acid345_0068"
FT   CDS_pept        68435..68704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39073"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM7"
FT                   /protein_id="ABF39073.1"
FT                   /translation="MSSTTLKCGLGLAAMAATLGFAQSPPQDSTKPDNTAVNQRDRDKS
FT                   QPTADQQKENSSDRDTVRKIRQALVRDKALSIYAGCPGSGRNDL"
FT   sig_peptide     68435..68503
FT                   /locus_tag="Acid345_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(69030..70118)
FT                   /locus_tag="Acid345_0069"
FT   CDS_pept        complement(69030..70118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0069"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39074"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM6"
FT                   /protein_id="ABF39074.1"
FT                   /translation="MTMSIFNSISRALFTVGLLAISQFSLADSTVTKERTTTKLAEGIY
FT                   EIRHPDAPDTFPQGNTTVIIGKRAVLVVDSCLLPSSTRQDIAQIRQWTSLPVTYLVNTH
FT                   WHFDHTLGNATYAEAFPAIQIIASRPTQKIIGDYNPGVLTRYPSRAQRFQQVLDTGKDL
FT                   NGETIGETVRKEYEKALAGLGPVAEEFKTAHQLAPNVSFEHELDIDLGDRPVRILFLGR
FT                   ANTAGDTVVYLPNDKLVATGDVLDHPVPYMFGGFPVDFVNTLRELAAIDANIFVPGHGD
FT                   VQHDKTYITQVIDLMQSVNTEVEKEINDGKTLEEAQTQVPKALESKGWKEKFAGKNDDD
FT                   QSFFDESFAGLVKSSYNQIKAR"
FT   sig_peptide     complement(70035..70118)
FT                   /locus_tag="Acid345_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            70249..71427
FT                   /locus_tag="Acid345_0070"
FT   CDS_pept        70249..71427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0070"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39075"
FT                   /db_xref="GOA:Q1IVM5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM5"
FT                   /protein_id="ABF39075.1"
FT                   /translation="MQMSMRVKEGLQHIPELDGLRGIAILAVMGFHFSGDTPVYFGKLA
FT                   AVYWAFFYGGNGVDLFFVLSGFLITSILLHTKESPQYFSSFYARRVLRIFPLYFLAVAL
FT                   FFYVELPWLEHLYGARSTLRSEQIWYWTYLVNWHDTLGNIVGAMGHFWSLAIEEQFYFV
FT                   WPLAIWLCSRKRVPLLCIGAIVLSTALRLVCDLRGYEVEYIHRATFTRFDTLALGGLLA
FT                   WIATDEHWMTVAQRCFKFVAPASLVLFAANEFAHAELGRFAGYVTVSYSLMALMCGSLI
FT                   FYGIAHTGDGTLLAKITRSAFLRNAGKYSYSMYIFHLVAKREAMVPIVNALRGYGLPLS
FT                   IAIIFGMVVCGLLTYAFALLTWNAFEKHFLKLKDRFPYDLPADTRIATVTTA"
FT   gene            71503..72429
FT                   /locus_tag="Acid345_0071"
FT   CDS_pept        71503..72429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0071"
FT                   /product="UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39076"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM4"
FT                   /protein_id="ABF39076.1"
FT                   /translation="MPLKAALHIRPQSIVFATDFSFESERAMRHAAAVARHFGSTLHMA
FT                   HIVCSMGLKLVGPEAVAVADDIAIRDLHSFEHKLAIKGLLDGVAHDCIVRDGEVWPQIR
FT                   SLIDELEADMIVIGTHGRRGLGRLLLGSVAEEIIRRAECPVLTVGPDFTLSGVENTREP
FT                   HPILLATDFQPASLQAIPYVASFASERGVPLILLHVIPLIPHRKNGDWSRSATLADRRH
FT                   ETETAAFEKLNALIPKYSLGDGQVECVVRCGETAEEIVKLARELNVDAIAMGLHRSEHP
FT                   EAVTHFRHTIACDVICHARCAVLTVRN"
FT   gene            complement(72508..75312)
FT                   /locus_tag="Acid345_0072"
FT   CDS_pept        complement(72508..75312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0072"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39077"
FT                   /db_xref="GOA:Q1IVM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM3"
FT                   /protein_id="ABF39077.1"
FT                   /translation="MALKILLADDSMTAQNMGKKILTDAGYEVVAVSNGAAAVKKIAEI
FT                   NPQLCILDIYMPGYTGLEVCEKIKSSSVTARIPVLLTVGKMEPYKPEEGARVRADGVIV
FT                   KPFEASELLRAVHRFSQRIANVAQPGRPGAPAQPASPQTPPPPPASTPATYERTVKLTR
FT                   EQIQEYMEPGLQGWRGGTSSPEHAGAHARTEAPDMPKSPAYPVEGVVASMKTGSTSDAM
FT                   PAFTISGAVAEAETSTVVAETSAAVAELETPAVPVETVAMETVAMPVESALAATEIAPV
FT                   TDVAIVTEEPAPVSTEAAVSVAETAPPVPEIAAPAIEPEAPTEAPIASASSVLPGFVDY
FT                   LIAHSSVETAPETVVPAEIAPETPVAVAEAAPETVAALETETPVVPTPEAAPVALESNE
FT                   FAVSAPAEPAPLAVEPAPVAEISVDPALQQTADGVLPTGAGFLSDDIRAAHDIGHKIPA
FT                   VDPALEITPEVAITATPDPHLESNEHIHVANATEDGLVPTSRSAESEGVVTTEDPNLSP
FT                   MEGLTDAVLPLEGGRLIIEEPAHVAEPSEPEAVAEAIATETAVETPAETVATEAVTTDT
FT                   PAVEAVATEAAPGETPVVQEAVVETSAVEAPVAETPAVVETPSVESTPSKSGKKARKGM
FT                   RPIPATTSGTETPAEASAQTAENTTAPAETAAVAEAATVAPETPAPPVEEKKEAPSAKA
FT                   DVTEEIAAVLDLLGQTTTSLSPSAPGAGVAAASAAVEEAPAVVIGAVRVWMAEEVALSE
FT                   AETTISLENEMRIAQAPKEVVPEAVVEPVAVAEPSVTAEVAPQPEAATAAPAEETVRDD
FT                   KNAPQPAVTPDTGVPPPDAGASPTQELAAAMAAAFGGALPQEDLARAEETQSISEEVRR
FT                   FAMGDAYKPKPAVGFGGAAIEDPSEKSIPSQDKLAAAISRALDRLKPQIVAEILKELEA
FT                   GEEK"
FT   gene            complement(75499..76992)
FT                   /locus_tag="Acid345_0073"
FT   CDS_pept        complement(75499..76992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0073"
FT                   /product="DNA uptake lipoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39078"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM2"
FT                   /protein_id="ABF39078.1"
FT                   /translation="MFRRALITAAIGLATLAATGCHNKKVSNPIANIDSKQPDKVLYDR
FT                   AMDAMKHNKFDVARVTLQTLINTYPDSEFIARAKLSIGDSWYAEGGSAAMTQAENEYRD
FT                   FIVFFGQSMPNESAEAQMKIAGIHYDEMEKPDRDYTHAKRAEEEYRQMILQFPDSPLVP
FT                   KAKTRLLQVQEILAQREFLIGKFYIMREDYPAAVARLQTLSDTYPLFSGSDEALFLLGE
FT                   AHQAEANLVRKASRLAETQRANAIAGFEKDAVAAYSKIITRYPATDRVEAAKKKLAELH
FT                   APIPTPTPEAIAQSKAEEAGRGHLTKKSEMMSFMKHHPDTSMATNHGDPIMVDPPQTSA
FT                   VDLVHNANATLIGKPAPTKGGSGITLETPTGTGPAPENQPIPRSDSGATAPTTAAPVET
FT                   GTPTPTAPSTSGGASSTTLSAAPASTATAAPTSAPATNTAAAPAPTRVNDANTDSSNAT
FT                   TQSTTSSTAAPAAQDSSQTPQDSSSKKKKKHGIGKLNPF"
FT   sig_peptide     complement(76921..76992)
FT                   /locus_tag="Acid345_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.992) with cleavage site probability 0.368 at
FT                   residue 24"
FT   gene            complement(77217..77891)
FT                   /locus_tag="Acid345_0074"
FT   CDS_pept        complement(77217..77891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0074"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39079"
FT                   /db_xref="GOA:Q1IVM1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM1"
FT                   /protein_id="ABF39079.1"
FT                   /translation="MIELAPSILSADFARLAEQVEAAIQGGGTVVHFDVMDGHFVPNIT
FT                   IGPPVLKSLRKAVKAPIDCHLMIENPDAYIPAFADAGANWISVHQEACLHLDRTLHLIR
FT                   DHGCRAGVVINPATPVETLSEVLDIVDYVLVMSVNPGFGAQPFIPATLHKVRKLVALRN
FT                   QGGTNFRIEIDGGMALDTIGEAIRAGVEIVVAGNAVFGKGDPAENARELLKAANSATLV
FT                   KV"
FT   gene            complement(77989..78339)
FT                   /locus_tag="Acid345_0075"
FT   CDS_pept        complement(77989..78339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0075"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39080"
FT                   /db_xref="GOA:Q1IVM0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVM0"
FT                   /protein_id="ABF39080.1"
FT                   /translation="MPHPVMYFEIGCRDVAATRDFYKSLFDWEMDESKPNYVGLPKGAA
FT                   HGIGGHIMSLGHEPHQYTLFYVEVEDIAAYAEKAKGLGGKVVVPPVDIGEGKFAWIQDN
FT                   GGNTVGLWEPSK"
FT   gene            78524..78910
FT                   /locus_tag="Acid345_0076"
FT   CDS_pept        78524..78910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39081"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL9"
FT                   /protein_id="ABF39081.1"
FT                   /translation="MLAGMIVFLMISAVQSQATPIRPDLQKMIKQSEQGRQLFIPARAG
FT                   WAEPAAAAITVNPLLESLGGEKLRHDLRDELATIATPDPWIALALVTLILLMRKLRSIE
FT                   AQKNRARAAGLVLEMPAPEVQRAA"
FT   sig_peptide     78524..78580
FT                   /locus_tag="Acid345_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.835) with cleavage site probability 0.739 at
FT                   residue 19"
FT   gene            79132..79584
FT                   /locus_tag="Acid345_0077"
FT   CDS_pept        79132..79584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0077"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39082"
FT                   /db_xref="GOA:Q1IVL8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL8"
FT                   /protein_id="ABF39082.1"
FT                   /translation="MCMHSKMSLARRRCEVHNLWPRGCNVRFFFSALLVIGMAQGLGAQ
FT                   PPQDIPHCPFKAPRDDCATVPKATFTPQPNFSDYARKKRLEGNVILSLTVLSDGTVDDV
FT                   KVTRSLEKSLDEQAIKTVRTWKFEPSMYQGKPISYSTAVEVNFRLY"
FT   gene            complement(79589..80269)
FT                   /locus_tag="Acid345_0078"
FT   CDS_pept        complement(79589..80269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0078"
FT                   /product="TENA/THI-4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39083"
FT                   /db_xref="GOA:Q1IVL7"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027572"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL7"
FT                   /protein_id="ABF39083.1"
FT                   /translation="METQQLLHELDAHISKYDLLCHPYYKAWSAGTLTREDLAAYAGDY
FT                   YHHVAAFPAYLSAFHSRLEDGETRRTVLRNLADEEISGRAHSDIWLDFAAGMGADCDTV
FT                   RSSQPMDSVANAIAWFRNIAATGTRAEALAAFYAYESQVPRVAEEKSKGLKERYGADRK
FT                   TCGYFDLHKYADVEHSRVWGDLLAQELEAHPEQREAALAASEQAAKVLWEVLDGMEARR
FT                   MTVV"
FT   gene            80450..81193
FT                   /locus_tag="Acid345_0079"
FT   CDS_pept        80450..81193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0079"
FT                   /product="PEGA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39084"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL6"
FT                   /protein_id="ABF39084.1"
FT                   /translation="MRFIFILALTLGINYPAAFSQDKPEDGPRVFVTDSQSWETHAAAG
FT                   GSGGNWGASSQGGARPQTAEIIKTFGERCPTVKVNNIEAKADYIVELDHEGGKGYLRHR
FT                   NKVAVFEHASGDVIISKSTLSLGGSVQEACEAIQKHWSANEAKMRAATSNQGAPSTPAN
FT                   STPAPPPAPELTKAATIKIAVASQPDGADIEIDAAFVGNTPSTVEATPGEHSVVVRKKG
FT                   FKTWERKLKVNGGDIRLNAELEPDK"
FT   sig_peptide     80450..80512
FT                   /locus_tag="Acid345_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.986) with cleavage site probability 0.976 at
FT                   residue 21"
FT   gene            81260..83209
FT                   /locus_tag="Acid345_0080"
FT   CDS_pept        81260..83209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0080"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39085"
FT                   /db_xref="GOA:Q1IVL5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVL5"
FT                   /protein_id="ABF39085.1"
FT                   /translation="MGFTEQYDVVVVGAGHAGCEAAMAAARMGLRTALYTLNVDLIAQM
FT                   SCNPAVGGIAKGHLVREVDALGGIMGEVTDAVGIQFRLLNTSRGPAVWSPRAQCDKQQY
FT                   RLKMREVLESEPNLKIKQAEVADLIVEDVSDPTHPERMKIARGIKLRDGRTVGALAVVI
FT                   TTGTFLNGLIHCGEEQYPAGRSGEPASVLLGESLKKMGLRGCRLKTGTPPRLDGRSIDW
FT                   SKFAVQPGDAEPTPFSFRTKKITQKQVPCYIAHTTPETHQLIRENVHRSPMYSGQIQST
FT                   GPRYCPSIEDKIVKFPDKETHQIFLEPEGLNTYEVYVNGMSTSLPIDVQLRMVHSIVGL
FT                   ENAEMLRPGYAIEYDSIDPTELQRTLETKKIGSLYLGGQINGTSGYEEAACQGLMAGIN
FT                   AALAVKHEPPLVLDRTEAYTAILIDDLISKGTNEPYRMFTSRAEFRLHLRIDNADRRLT
FT                   PHGRRVGLIKDEAWHAHLAKQQRMDELKMTLEKTRIRTSELPVELAEKFGNIDGSTVVQ
FT                   LLKRPESDVAAFEQIIRRVQPTFFERGDSEREFVSDIRNELKAVETEIKYAGYLDQQTK
FT                   AIDRLKRSEQRVIPEWFDYASVSGLSREMCEKMQRVRPQTIGQASRIPGVTPAAVSLIN
FT                   VYIEIQGRKQKATT"
FT   gene            83277..83771
FT                   /locus_tag="Acid345_0081"
FT   CDS_pept        83277..83771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0081"
FT                   /product="DinB"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39086"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL4"
FT                   /protein_id="ABF39086.1"
FT                   /translation="MSYGQSMTGELEHEMANTRRVLERVPYEKADWKPHVKSGTLKWLA
FT                   GHCAIMPGWGANVLTSDELNVHGVGSAIPDFATKEDMIAHFEAELAKYRGALMEASDDY
FT                   ILKPWTLRDNEQVIFTMSRIAVLRGMVMNHMIHHRAELIVYLRLLDVPVPGLYGASADE
FT                   K"
FT   gene            complement(83951..84247)
FT                   /locus_tag="Acid345_0082"
FT   CDS_pept        complement(83951..84247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0082"
FT                   /product="histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39087"
FT                   /db_xref="GOA:Q1IVL3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL3"
FT                   /protein_id="ABF39087.1"
FT                   /translation="MASGMTKTQLVRHMAESHEISNKTAAAFLESLAEVAIKETKKNGV
FT                   FVIPGLGRLVKSNRKARVGRNPQTGEPIKIPAKTVVKFRVAKAAKDSIAPSKK"
FT   gene            complement(84580..85074)
FT                   /locus_tag="Acid345_0083"
FT   CDS_pept        complement(84580..85074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0083"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39088"
FT                   /db_xref="GOA:Q1IVL2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL2"
FT                   /protein_id="ABF39088.1"
FT                   /translation="MIHTAYIALGSNLGDRQANLLDAIARIGGLGGVKRVSSWYETEPV
FT                   EMTDQPWFVNAALELSTNLEPIALLRGLLRVEQAMGRHREIPKGPRNIDLDLLLFDNEV
FT                   INTPELTLPHPEMHNRGFVLAPLAEIAPDAVHPLLRKTASTLLETLIDPAEVRRVPPSV
FT                   E"
FT   gene            85148..85873
FT                   /locus_tag="Acid345_0084"
FT   CDS_pept        85148..85873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0084"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39089"
FT                   /db_xref="GOA:Q1IVL1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL1"
FT                   /protein_id="ABF39089.1"
FT                   /translation="MSLSALLLSEDPNVVDILRPLLPELGIATDQCAFPDAALRLLNSR
FT                   KYEAIIVDDEILGGVEFMSSLRGLPMTRNAIIFAVIRYVGVKEAFQSGANFALEKPLTA
FT                   ERAQRSFHAALGLIMRERRRFFRYTVNVPASLEFSNRVENITVSNLSEGGMAIDTSFAL
FT                   TPGLIVKCRFDLPGLKFTIEAKGEVSWTDNQGHAGVCFQQVPHLHKEKLEEWLTTRGKD
FT                   EPVAIHRNSAESWHSDEAS"
FT   gene            complement(85870..86748)
FT                   /locus_tag="Acid345_0085"
FT   CDS_pept        complement(85870..86748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0085"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39090"
FT                   /db_xref="GOA:Q1IVL0"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVL0"
FT                   /protein_id="ABF39090.1"
FT                   /translation="MECHGVGLHSGAPVRLRLLPASTGEGIVFRRTDLDDFEIEATGRN
FT                   VAKVSYATSLMKKGVLISTTEHLLSALIGMGVDNAIIEIDNLELPILDGSAQPFVDMIV
FT                   NAGLRKQRRKRSYIRIVKPIELREGDKFIAVYPYDGYSVSYAINFPHPSIGRERFEVEL
FT                   SNGNFLREIAPARTFGFLRDRDAMLNMGLIRGASEENAIVLTDDGIKNGPLRYPDEFVR
FT                   HKVLDLIGDLALLGRRLLGRIVADRAGHAMHTALVTRILRDQSFWEESTLNDELPDMPD
FT                   FSGAHPVADQL"
FT   gene            87032..88573
FT                   /locus_tag="Acid345_0086"
FT   CDS_pept        87032..88573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39091"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK9"
FT                   /protein_id="ABF39091.1"
FT                   /translation="MKQLRLACALLALIASAFAAGPPVVEPVIHGDQAVTAEHNGTQYP
FT                   VFRFAQDQKLVASIQHVFASSFAGEMQKLFIMSRDIASARDRRDGLRGDPEFAQPIYLL
FT                   LSQEEGGYARRDFFLESEDGERVFLAADYIDLVVDQESVDSGDFEEIFSHELGHSILRN
FT                   LVGELVGARSNKMHQSVTLTDYRTAFDEGFAEHFQPVVRQNSANPSLTRQQRGVVAPSL
FT                   AQDFLSQRDQVLRNFGPPSYVFLHERMVPACASLRECYVVEETSTSFDPSQLRSGQQML
FT                   SSEGVVSTVFLQLLSEGGAPVCGADCAQLEAKYRKLFEALAEVKPNATQSPLIQMLESY
FT                   RGKYPEEGKRVVADFVLLTRGATVSTELAHGTEAMSAASSRADIAAFRTQLHAAQKLLA
FT                   QATDDVLAGKLKLDAAVGPELWIRNEAFTQASLFPGSEEAPLRTNLNTASAEEIATLPQ
FT                   FSKETAQAMVRERRQRGYFRSIDEVISSAKLNPGQAEVIKKAEQSQAGAKADPVR"
FT   sig_peptide     87032..87091
FT                   /locus_tag="Acid345_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(88570..89073)
FT                   /locus_tag="Acid345_0087"
FT   CDS_pept        complement(88570..89073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39092"
FT                   /db_xref="GOA:Q1IVK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK8"
FT                   /protein_id="ABF39092.1"
FT                   /translation="MSTPAMSPQNNARPQQIAAAKARVIVSANWFLWIAGLSVVNTLIS
FT                   MGGGRMRFIFGLGITSVLDAVGHQSGNSGQSTALIMSILAAAVIAMFGFFGRKEMKWAF
FT                   LVGMALYACDGLLLLKYGVYLSAAFHAWALFRLFVGLQAVNTLETLRSQQSSDAGAMST
FT                   SWQR"
FT   gene            complement(89263..89898)
FT                   /locus_tag="Acid345_0088"
FT   CDS_pept        complement(89263..89898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0088"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39093"
FT                   /db_xref="GOA:Q1IVK7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK7"
FT                   /protein_id="ABF39093.1"
FT                   /translation="MSSLFPEPAAKKPEKILIAHVDGGARGNPGPAGFGVVLEDERGQK
FT                   VDALSGFLGHQTNNVAEYSGLLAALDYAQKHGFKALKVVADSELLVKQIRGEYKVKSPN
FT                   LLDLYSRARVMIRTLDWFRIEHTLRGGNKEADALANEAMDRGMGRSPQQAKSGLAGDPE
FT                   NRRREDPASEARQYEKQPTEVNGIVKDGVVQFLGTKLPEGTFVKIRAK"
FT   gene            complement(90498..90764)
FT                   /locus_tag="Acid345_0089"
FT   CDS_pept        complement(90498..90764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39094"
FT                   /db_xref="GOA:Q1IVK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK6"
FT                   /protein_id="ABF39094.1"
FT                   /translation="MFDEQRIADLKKQRRKDMLAKGKKSAVRRQIAFNLLLFGGLFVID
FT                   YLPLHRRSSTELIAWALFLPIGILGGYLQGIWIWQDLEKKARS"
FT   gene            complement(90769..91560)
FT                   /locus_tag="Acid345_0090"
FT   CDS_pept        complement(90769..91560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0090"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39095"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK5"
FT                   /protein_id="ABF39095.1"
FT                   /translation="MSPVYPCRASVFMRYLIISDIHSNLEALQTALAAAPAHDYVLNLG
FT                   DVVGYGASPNEVVEIVSGLNGPVVRGNHDKACSGIGDTFGFNAVADRAVTWTSETLSDE
FT                   NRDWVKQLQRGPVDIPGFTGGQMVHGSPIDEDDYLLSSAAAFEVFRDGHSPLTFYGHTH
FT                   VQGGFIFRKGYVETFRPRYHTPMEEETWELPLMMEARYLINPGSIGQPRDGDWRAAFAL
FT                   FDSEAKKITFYRVPYPVELAQHRILTAELPEYLAVRLRAGR"
FT   gene            complement(91563..92540)
FT                   /locus_tag="Acid345_0091"
FT   CDS_pept        complement(91563..92540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0091"
FT                   /product="Oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39096"
FT                   /db_xref="GOA:Q1IVK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK4"
FT                   /protein_id="ABF39096.1"
FT                   /translation="MGDLLQIRDLKIEFPTPDGWRSAVRGISFGIAAGETLGLVGESGS
FT                   GKSVTSLAVLRLLPTQARISGEISFDGRSLLALEGEELRRLRGESISMIFQEPMTALNP
FT                   VMRVGDQVAEAVLAHSDVKKTEAWRRAVESLTEVEIREPERRARDYPHQLSGGMRQRVM
FT                   IAMAIVNRPRLLIADEPTTALDVTIQAQILDLLNELRQRHGLAMLFISHDLAVVSQISD
FT                   RVAVMYAGQIVEMATASEVFKNAAHPYTRGLLHSVPTLRTNRAEPLRTIEGTVPTAGAI
FT                   TIGCSFEPRCGDRIGNCATVNPELIEISPGHWARCPVIAGNVVK"
FT   gene            complement(93788..94216)
FT                   /locus_tag="Acid345_0092"
FT   CDS_pept        complement(93788..94216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39097"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK3"
FT                   /protein_id="ABF39097.1"
FT                   /translation="MAIDQAPQKLTFQAILSEEVNWQPFAAFPPSARLAVLVCNPSQPG
FT                   PYVTRVKIPAGIKLMPHRHPEDRVYTVISGTFYIGLGDEFDAAKLHPYPPGSVVVLPGN
FT                   TSHFHWAKSGEYITQISANGPLGMEYIHANDDPRKSAS"
FT   gene            complement(94286..94981)
FT                   /locus_tag="Acid345_0093"
FT   CDS_pept        complement(94286..94981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0093"
FT                   /product="ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39098"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK2"
FT                   /protein_id="ABF39098.1"
FT                   /translation="MKILQVLTSHDQLGNTGRKTGFWLEEGAAPYFVFRDAGVEITLAS
FT                   PKGGQPPIDPKSDLAENQTAAQVRFKKDAQALKAFANTFKLADMKAEDFDTVFYTGGHG
FT                   PMWDLAEDPVSIALLETFYNSGKPIALVCHSPGVLRHVKYKGEPLVKGKHVTGFTNGEE
FT                   TDVQLTKVVPFLVEDELLRLGAIFEKKANWQPFTITDGRLITGQNPASSTITAQALMSF
FT                   VGKTKEVAA"
FT   gene            95369..96733
FT                   /locus_tag="Acid345_0094"
FT   CDS_pept        95369..96733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0094"
FT                   /product="Parallel beta-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39099"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK1"
FT                   /protein_id="ABF39099.1"
FT                   /translation="MFRLHRPHFEKLFFALTLFWALPAFSGAYSVVYPTGIFPDDVNNI
FT                   QAAVDKGGTVLLKAVNKKGVPTEFNFSTDLLTAYGSGFINLSADVKIIGEVAAHARTTI
FT                   RGGFGPIEGLSPVKSSIQGIDFESPFSDAIDIATSNGSTEITGNVIHNVVPVRVRVPDG
FT                   NIISFADGIDFYGGSDYGIVAGKVRLVGNVIDGLGAIFSNGVQLDTVQSDVEITGNLIQ
FT                   NVNSPDTEQGGGITLVRLQKSALVSANLVIPGPSATSFADGIFIGGDLSARYKVISNLV
FT                   YSTSYNGDGIDIAGGDATGTTGTIDAVVAFNQVTTLSAPNAIPIALYDLVTNSLITGND
FT                   LRGEGYAGLMISTYGFDTEVTSGNRFLGNDLSHFKSDFADVFFDANGENNTVLGQCNSV
FT                   VDLGTGNTIRCTLHSAAQMKSPAAPRFSVEQMRKIQRQTVHPLVRNNSAGNVLQP"
FT   sig_peptide     95369..95449
FT                   /locus_tag="Acid345_0094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.579 at
FT                   residue 27"
FT   gene            complement(96748..97254)
FT                   /locus_tag="Acid345_0095"
FT   CDS_pept        complement(96748..97254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVK0"
FT                   /protein_id="ABF39100.1"
FT                   /translation="MGLFSVIRERRRVRKLFEKYVSPAAIKAIEESSEYGFTSQIEDKH
FT                   LQFIIVNLQEAPVEEVNATLTRVVDCLFRHNATLFWSSPTLVRGCFGVPSTEHDLPQNR
FT                   TAAVADLLQENGSRIRLLHGECTAPVGNFGGNFRLCYDMMLPGYTAKLKRLFELEFGTA
FT                   EEIPA"
FT   gene            complement(97525..98319)
FT                   /locus_tag="Acid345_0096"
FT   CDS_pept        complement(97525..98319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0096"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39101"
FT                   /db_xref="GOA:Q1IVJ9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ9"
FT                   /protein_id="ABF39101.1"
FT                   /translation="MSSTLVLLMTLGHAAMLFGVAILGGAINSVAGGGSFLCFPALLFT
FT                   GVPPVNANATNTLALWPGTLASVGAYRREFSKADARQIYSLVITGIAGALIGAILLLKT
FT                   PQLTFLHMVPWLLASATVIFAFSSRISRWVREREARGGAHMMTGAALVQLGIAVYIGFF
FT                   GAGAGILMLALFAFMGMESIHTMNAFKTMLASICNGVALIAFIVAKAIFWPQALVMLVG
FT                   AAFGGYFGAHFAQKVAPAKVRLIVIFIGAGLSIYFFVKQYAL"
FT   sig_peptide     complement(98224..98319)
FT                   /locus_tag="Acid345_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.947) with cleavage site probability 0.679 at
FT                   residue 32"
FT   gene            98433..98954
FT                   /locus_tag="Acid345_0097"
FT   CDS_pept        98433..98954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39102"
FT                   /db_xref="GOA:Q1IVJ8"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ8"
FT                   /protein_id="ABF39102.1"
FT                   /translation="MAEPEQDEHVFSAQKEPEKRNWTPMIVGALLVIVVVAAIAFFNRN
FT                   SNKGQVQHDPYADKLPISDMQMSKSENYVGAAVTYVDFTVTNTGDKTVTGAQVQVTFRD
FT                   SLNQSVGSETLAASVLIPNTLGGYPDVTDLTRAPLAPGKSRTIRLTFEHVSAEWNQNYP
FT                   EVKLVNLQYK"
FT   gene            complement(99032..102703)
FT                   /locus_tag="Acid345_0098"
FT   CDS_pept        complement(99032..102703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0098"
FT                   /product="protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39103"
FT                   /db_xref="GOA:Q1IVJ7"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ7"
FT                   /protein_id="ABF39103.1"
FT                   /translation="MRLGVSLPKIRHSLVPCLLATVLSIASSAQTAPNPSRIQSPILET
FT                   DRITLHSSSPAWTKAARDAGAVDSNLSLDRILVLLQPSAKQSDALKLYLDDLQNTDSKN
FT                   YHQWLTPEQYAQKFGPTDADMQKVTDWLQSHGFKISEVAAGRQWIEVAGTAAQVRTAFN
FT                   TEIHKYHLNGKDYFANASDVSLPRALSSVVRGVLSLNNFQKRSFTSHGVLVSRGTSGKL
FT                   QPVAGVVPDSKGKLTVDPSYTLTTGNGSFHFLAPGDLQKIYDETPLLTDGNNGRGVSIA
FT                   IVGRTNIELSDVHSFRQIFGLSENDPEVLINGTDPGITPDELEADLDLEWAGASAPGAK
FT                   LKFVTSSSTASTDGVDLSAAYIVDHRIAPIMSTSYGQCEAFLGPSGNAFYSSLWQQAAA
FT                   EGITAFVSSGDNGAAGCDPAAYFLPEQYGKMVSGLASTPYNVAVGGTELNENGNDSTYW
FT                   SANNAADQASVLGYIPEVTWNETCDPRTSTSCSQYINYSSSGGPSNCSDVTQNGSRFNF
FT                   TCNAGYPKPAWQTGVGVPNDGVRDLPDVSLAAAGGHDGYLLCVEGSCQTTTVNGKIVLT
FT                   NAVVVGGTSAASPSMAGILALVEQKNGQYQGQANYTFYQLAAAEQAANCNASQRVDPTH
FT                   TSQCIFNDVTSGNNGVPNLTGFNAGTGYDLTTGLGSVSAANLAANWNTGRKHLTETFLW
FT                   ASRFKAQHGQPIDLNIRVHASRASSAPTGAVALEAGSNRYPTSVPLTHGAFSGPVASLP
FT                   AGHYLLTAHYGGDGTYSQSTSNPIPIDITPEDSKITVIPYNVNLVGQYLPTTGPITFGT
FT                   EAALQINVQGLSGQGQATGSVTITVDGKNAGTATITAGNVFVTLDSLVSQTLSVGTHSF
FT                   GATYSGDTSFHASSSPHAASISVARGYVGLTRISSDLQTVAVGAPLTFYISVLAPGSSR
FT                   PSGTVQVYDNGAAISGPIALATNVPSDAVQAEFVHAFTTTGTHIIRLSYSGDKNFFPVA
FT                   PDEFRSSQFFLTVNSAKGAATVTQISQSNPTLTVGGTDTFTVSVAPQKSGGAALTGTVT
FT                   LVSMYNSIIAGPVALTNGKASFVVPWSKFLNVGTSELLASYSGDANYAPSASGNIETTV
FT                   NPATPAITLSADASEVRAGATSELAVIVKPTLSGDSSIVLPFGKVQFYDAVNGRAPQPL
FT                   GPAYGLTQGNGNFTTFLFATQLPAGHNVITARYLGNGEWGPAASNPVVVLVGRAHRD"
FT   sig_peptide     complement(102608..102703)
FT                   /locus_tag="Acid345_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.847 at
FT                   residue 32"
FT   gene            103054..104016
FT                   /locus_tag="Acid345_0099"
FT   CDS_pept        103054..104016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0099"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39104"
FT                   /db_xref="GOA:Q1IVJ6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ6"
FT                   /protein_id="ABF39104.1"
FT                   /translation="MLGKLARQQDANVLVGFDKADDAGVYLLTPELAMVQTVDFFTPIV
FT                   DDPYTFGQIAATNALSDVYAMGGKPVSALAMVCFPDKGDPEVLERILAGGLSKMIEANC
FT                   TVIGGHSIRDEEIKFGYAVTGTIHPQKVLKNAGAVAGDALLFTKSLGTGVISTAIKRGK
FT                   AEPEWIAAAERSMTTLNKLAAEVIAAGDYAVHGMTDITGFGMIGHGREMALGSGVTLRI
FT                   RAADVPVLPGALECVRLGFVPGGLNNNRDFAECLVTYADDVPHELRTILYDPQTAGGLL
FT                   ISVSEADAKRLLRAMQNAGVPAVRIGEVIAAEKPGIDVC"
FT   gene            104112..105413
FT                   /locus_tag="Acid345_0100"
FT   CDS_pept        104112..105413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39105"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ5"
FT                   /protein_id="ABF39105.1"
FT                   /translation="MPIRSLALRALTLWCLIVLLCAPGAYAYSVLTHQAIIDLAWDDSI
FT                   RPFLLSRYPNATAEQLQVAHAYAYGGCAIQDMGYYPFGHTFFSDLTHYVRAGDFVASLF
FT                   RNAQNLNDLAFAAGALSHYLGDSFGHSIATNQATPIEFPDLGARYGTVVTYEQDPHAHV
FT                   RTEFGFDIEQVSKQRFAPHSYLVHIGLLIPRPLLEKAFFETYGMPLHTLLGEEGPSMRS
FT                   YRSAVRSFIPFFARGEVVLHRHEFLQEQPSPEFSTYSEESEHADFRNHSPQGYRNPGFV
FT                   GHLSAAIVWIVPKRGPAAMLAIKIPSHESQELYAKSMTTTLEHLHKHLGDLGHGEVTTF
FT                   ALADRDLDTGARTKPGGYARTDATYAKLLHDVVTRPQMTIPLGLKEDVLAYYADLNAPI
FT                   TTKQNPKQWAQVQQELEHFRTMKSTSQVLIPSEP"
FT   sig_peptide     104112..104195
FT                   /locus_tag="Acid345_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            105618..108044
FT                   /locus_tag="Acid345_0101"
FT   CDS_pept        105618..108044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0101"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39106"
FT                   /db_xref="GOA:Q1IVJ4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ4"
FT                   /protein_id="ABF39106.1"
FT                   /translation="MHGLLQELRFALRQIRKSPGFSLAVVLTMAIGIGMSTAMFTVMDA
FT                   VVLRPLAVPDMERVASVSEESTDHIARADAMGNVQDWYTQSHSFSEMAWHRPVAMNMTG
FT                   AGDPEQLMATLSSANLFDLLRVKPWLGRTFAKGEDEPGADRVAVLSYSLWQKQFGEDRN
FT                   AVGRKIQLDGKEYDVIGVMPQGFRYASYSDIFIPLGLTPAEKADRAGHLYSVLARLNPG
FT                   VTREAALAELSAIAAHDAKEHPETNLGWGLKLRTLADSVNDDYTPMYMRLMLGVGIFVL
FT                   LIICANVSNLQFARSIGRRTEIAIRSAMGAGRTRIVRQLLIESTLLCVTGALAGILVAR
FT                   LQLHLTLITMPPRVARFLPGWSNINLNGRALAYSLGLAVFAGIFSGLAPSLSALRLGVA
FT                   EQLKAGGRTVAGDRRSHALRNIFAVAQITLAVALVAGAALMGSGMRAMLRQTDRYSPKT
FT                   LLTFEVNLPHARYATAAQQKAFYDESLQALRNTPGVASADITPTFPVNNTGVWWQDVNL
FT                   EHVQAVPGESRATQRLTISPSFLSAMHVSLLEGRWLNDSDGTSTTPVAVISKKFADRYF
FT                   EGKDPIGRRMQLGKPSEATPWITVVGVAEDITWLWVDKTPQPTVYLSYAQFPGDKTYFA
FT                   VRANGDADSIAPAVRRAFAQIDATLPLSDVQSYDVYLHETLVGLEYVVGMFVIDALVAL
FT                   LLAAIGIFGVMANSVSERTHEIGVRMAMGAQPKQIRILVLRRAAVLTIVGLALGIPMAG
FT                   GLARMMANLIFGVSAGDLRVFVGTAGAVTLVALLATLLPAHRATSVQPMTALRNE"
FT   gene            108100..108603
FT                   /locus_tag="Acid345_0102"
FT   CDS_pept        108100..108603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39107"
FT                   /db_xref="GOA:Q1IVJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ3"
FT                   /protein_id="ABF39107.1"
FT                   /translation="MRPLGISTLTGLWFVLSVGDFFVPHFPGTAVPTWIFVAIASFEVG
FT                   LFWLLLWFFWRGHNWSRIVMLLVSPFSIVSLGAVSFPLISALMWNATVISAAALSLFQL
FT                   YYLNKSMVRAWFKKGAEARKTSRMTIALVSILAVLVSIYGLEAMHVKYLRHKLGPEYQQ
FT                   LRAT"
FT   gene            complement(108611..108937)
FT                   /locus_tag="Acid345_0103"
FT   CDS_pept        complement(108611..108937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39108"
FT                   /db_xref="GOA:Q1IVJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ2"
FT                   /protein_id="ABF39108.1"
FT                   /translation="MRSPSHSVFVLLARSIKHFAFADLFLLFVAGFFWGFAKGWPQGIF
FT                   AAFFQIGLLPILAIGEVFKDPTSHNLWPLEFVMYGFMGGVGAFGAALGLALKSSRIGAR
FT                   QTTA"
FT   gene            complement(109055..109507)
FT                   /locus_tag="Acid345_0104"
FT   CDS_pept        complement(109055..109507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0104"
FT                   /product="GatB/Yqey"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39109"
FT                   /db_xref="GOA:Q1IVJ1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ1"
FT                   /protein_id="ABF39109.1"
FT                   /translation="MSLSEQIQKDMVAAMKSKEEEKLSTLRMMKSAVKNKEIDKRAPLD
FT                   DKEVLAVLSTMIKQRKDSVEQFTKGDRPELAAKEEREIVLIETYMPKTASEEQIVAAVR
FT                   ATIAEMGSPTMKDMGTVMKATMAKFADVRVDGKLVSETVKKELAGK"
FT   gene            109913..114349
FT                   /locus_tag="Acid345_0105"
FT   CDS_pept        109913..114349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0105"
FT                   /product="protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39110"
FT                   /db_xref="GOA:Q1IVJ0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVJ0"
FT                   /protein_id="ABF39110.1"
FT                   /translation="MNRFFVRARLLSICLALLWIASYAGAQAVKNPSRITQKIDNTARV
FT                   TLSGTVPKAAKNAHDLGEVDGGMKLQRMMLVLKPSAEQQASLQRLLDSQQNKKSPNHHK
FT                   WLTPEKFAASYGPSEEDVAKVKNWLESQGMSVSKIGNGRQWIEFSGSAHQVGTAFGTSL
FT                   HYFETNGERHMANATEISIPRAISPVVSGVLSLHNFHKQPNTSKLSKVKLGDDGKLAPV
FT                   DPAWTYRDYNLNPYYYLAPTDAQKIYNASPLLNDGVDGTGISIAVAGRSNIYLSDVQLF
FT                   RNVFGLKQNDPNFIVNGPDPGYPFGDLVENTLDVEWASAMAPGATINFVASGSTDTTDG
FT                   VDLSAAYIVDNAVAPIVTVSYGLCEALMGPASNQFYNSLWAQAAAQGMTVFVSTGDVGA
FT                   AECDGDLQRAGYDPPGPAQYGPTISGLSSTPYNVAVGGTQYNEGSNFGQYWSPNNDSTF
FT                   GSVLGYVPEQAWNESCDPNLPQEGTNCVYGQTNYNLDGGGGGPSNCSQSTVDDQGLITC
FT                   VAGTPKPSWQTGLGVPNDGVRDTPDLSLNASPDDDGFLFCLIGGCQTTTVNGQTILTNA
FT                   STIGGTSASTPAMAGIMALIEQKNGAFQGQANYIFYKLAAMDDQAACDSSKRTDPTATS
FT                   TCNFNDVTMGSNSVPGLPGYGTDSAEWSATTGYDMATGLGTVNAANIATNWAKVTFAAS
FT                   STALTVGGGTVAHGDPVTVNIAVTATDGGSSKPTGPVSLVTDKYGAVGQVTLDANGSYS
FT                   GPVANLPGGSYSLTAQYGGDGTFGASTSAPAAVTVTPEDSTTTIIGLYTVDPNTSRVIP
FT                   YTGSAQWAYPLWISVKVDGKSGEGRATGTVNVLRNGTVVMSAPLNSDGSAYIQTGNGMS
FT                   YTFPAGDSDLSIQYSGDSGFNASTSGVTKISFTPQKVWSTIQISWWQVQAGQPVLLTAG
FT                   VRAFGTPVPTGTMTFYDNGKKLSDAIPLATDGPYGPTVPEVTYTAKLTTVGDHWITAEY
FT                   SGDANYAAVAQDDPTYSWGSSYTVIPAAGETTTTTVTQYPAAVSFGQWINFLVNVKPAK
FT                   AGGAAPTGEVVLTSNGQVNGQGNLVNGQVTISVQAGAQTAEVYAQYQGDSTYASSSSGV
FT                   FKTTIAKLDSTVSLTTTGAYVLAGQQTSLNFVVQGYYYNSTSWYQPQGSVQFFDAVNGG
FT                   APQAITAQLGMTGMNPWANSGLSLRETLPAGTNVITAQYSGDSYFNPATTAAVTVVVSP
FT                   PDFTVSSDPSALTISAGGTTSAILSVAPILGFSGAVTLTCGDGLPAGTTCSFSPATLDA
FT                   SGGQSTMTVTMKGPFTNAAANHVSGWWMLTGGSGALGFFLLGISGKRRKYLAGMLATIA
FT                   LFGLMMACGGDSHPPAATTSVMLESSQPKVAAGASVTFTADVSGGNNGATGSVTFYDGT
FT                   TALGNAVDVSNGQATLAVNTLTVGTHAITAKYTGDSSHAASVSQPMYQAITGTTTLAVT
FT                   ATSGSTSHVLNLNLTVQ"
FT   sig_peptide     109913..109993
FT                   /locus_tag="Acid345_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.797 at
FT                   residue 27"
FT   gene            114467..114862
FT                   /locus_tag="Acid345_0106"
FT   CDS_pept        114467..114862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0106"
FT                   /product="putative S-adenosylmethionine decarboxylase
FT                   proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39111"
FT                   /db_xref="GOA:Q1IVI9"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI9"
FT                   /protein_id="ABF39111.1"
FT                   /translation="MQGIEWIVEAQGCRAADLRSLAALQELFAAIIRDLDLHVVGEMRW
FT                   HQFPGSNGVTGFALLSESHLAVHTFPEHQSLCLNLFCCRPRPNWDFVGELQVRLGADRV
FT                   NVRRVERPYVADADDVLRAMPVGEAVQ"
FT   gene            114859..115491
FT                   /locus_tag="Acid345_0107"
FT   CDS_pept        114859..115491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39112"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI8"
FT                   /protein_id="ABF39112.1"
FT                   /translation="MTHVSAACPNCGAPLDFKWPSSVQTVCTYCKSIVVRTDVDLEKVG
FT                   TVSDLPPDSSPIQIATEGIYQNKAFTVAGRIVYEYDEGTWNEWHVVMQDGTSAWLSDAQ
FT                   ATYCFTRATPHKDLPAANAVQAGQHYTWDGIPFTVSVITNAKYRGVEGELPFQYWDKTT
FT                   ATFADCQSARGDFATIDYSDDEPALYRGEIVDFDALKMKNLRTFEGW"
FT   gene            115491..116813
FT                   /locus_tag="Acid345_0108"
FT   CDS_pept        115491..116813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39113"
FT                   /db_xref="GOA:Q1IVI7"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI7"
FT                   /protein_id="ABF39113.1"
FT                   /translation="MSTPPVPPRPTAKALNCPSCGAALVLRSMDRAVTVVCDHCHAILD
FT                   AKDPNLKVLETFSEKLTDKPLIPLGSRGTFRGTEYEVIGFQRRTIQVEGTDYSWHEYLL
FT                   FNPFKGFRYLVEYDGHWNDVSPTKGLPAVRGSSAEYLGKKYSLFQTSDAHTTFVLGEFP
FT                   WQVRFNDAAQCNDYVNPPFMLSCEQTSEETTWSLGEYIPGSLVWSSFKLPGAPPAAVGV
FT                   YENQPSPLGTSWRGVWKSFGLLMLAMIVLFIANVGMGASEKVFTQNYVFTQPKPGQEAS
FT                   FVTPTFELKGRISDVEVKTKSNINNEWIYLNYALIDDVNGQAYDFGREVSYYHGSDSDG
FT                   SWTEGSNEDSVIVPSVPAGHYYLRVEPESEANFGPIQYTVTVTRDVPVMSLYGWAFLAL
FT                   LVPAVFISWKAFNFEQMRWAESDYQPAAAAMGMHVKGGGDE"
FT   gene            116806..116988
FT                   /locus_tag="Acid345_0109"
FT   CDS_pept        116806..116988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39114"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI6"
FT                   /protein_id="ABF39114.1"
FT                   /translation="MSKAFLVYGLLILAAVGFAQYRGFSFNSVSELKNVPRSVRDNPGS
FT                   YRSVYGVYHHYTGGK"
FT   sig_peptide     116806..116865
FT                   /locus_tag="Acid345_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.877) with cleavage site probability 0.755 at
FT                   residue 20"
FT   gene            116989..117201
FT                   /locus_tag="Acid345_0110"
FT   CDS_pept        116989..117201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0110"
FT                   /product="protein of unknown function DUF350"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39115"
FT                   /db_xref="GOA:Q1IVI5"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI5"
FT                   /protein_id="ABF39115.1"
FT                   /translation="MNLIPVTNIVNALVFAFIGIFIFTVAFIVLDKMTPYHLWKEIVQE
FT                   HNQALAILVGALSIGICIIIAAAVH"
FT   gene            117202..118698
FT                   /locus_tag="Acid345_0111"
FT   CDS_pept        117202..118698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0111"
FT                   /product="Spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39116"
FT                   /db_xref="GOA:Q1IVI4"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI4"
FT                   /protein_id="ABF39116.1"
FT                   /translation="MAILLFISVLLISACGLIYELIAGTLASYLIGDSVFQFSTIIGSY
FT                   LFAMGIGSALSRYIRSGLVHRFIWIELMVGLIGGFSSALLFLAFAYTQAFGLLMYTLVI
FT                   VIGVLLGLEIPLLMRIVREKYDFRDTVAHVLTFDYIGALGASLLFPVLLVPKLGLVRSA
FT                   MLFGIVNALVALWSTFLFGSELAKRTMLRAMSAIVLIALCAGMVNARKITAAAEDNIYA
FT                   DEIVFARDTRYQHIVLTRFKDDLRLFLNSHLQFSSRDEYRYHEALIHPGLSAVPVPRHV
FT                   LVLGGGDGLAVREILKYPQVESITLVDLDPEMTKLFSTNPMLTALNKKSFLDPKVKVIN
FT                   ADAFPWIDQSTESFDFIVIDFPDPTSYSLGKLYTTTFYRAVARHLSEQGFMVVQSTSPM
FT                   FARDSFWCIAETLKQTGLKTYPYHVYVPSFGEWGFVLAGTHEYEAPTSLPQGLRFVSTA
FT                   TLPTLFQFPPDMAPMNVPANHLNDQVLVRMYDNDWKDISH"
FT   gene            118746..120209
FT                   /locus_tag="Acid345_0112"
FT   CDS_pept        118746..120209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0112"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39117"
FT                   /db_xref="GOA:Q1IVI3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI3"
FT                   /protein_id="ABF39117.1"
FT                   /translation="MTQKSGRPIPGGWVNENFTAGHAIRDRQPFGDPKQTEKTTLVIVG
FT                   GGIAGLSAAWRLHKRGFHDFVLLEMNDAAGGNARSGENEVSAYPWAAHYLPVPGLRAVY
FT                   VRELFEDLGVLKNGVWDERHLCFAPQERLFALGRWQDGIEPVGLAQGDRDQFARLEDLF
FT                   AKHRASGAFTIPSELGLTEKSADLDRLSFAQWLDQNGVNSAPIRWYMDYCCRDDYGALA
FT                   ADTSAWAGIHYFSSREPVERGPLTWPEGNGWITKQLLKIVGGYVRTSQPVRRIRTEKNK
FT                   YTVQTADTAYLCDAVIFAAPTFLAPYIIEGFGPKPSFEYSPWLTANLTLDRSPRGANQD
FT                   ERAWDNVVMHSPTLGYVDATHQTLRSHVEKTVWTFYWALAEGAAADNRRKLLASDADYW
FT                   KDAILRDLERVHPDIRACVTRIDLMRMGHAMARPTPGAIFDPQRRELAKLRGRLLFANS
FT                   DLSGFSIFEEAQYRGVKAAEAVLAVLGRV"
FT   gene            120371..121591
FT                   /locus_tag="Acid345_0113"
FT   CDS_pept        120371..121591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39118"
FT                   /db_xref="GOA:Q1IVI2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI2"
FT                   /protein_id="ABF39118.1"
FT                   /translation="MDTNTILILALGVVLIALASVIIPYINALRRYAGYSELRDDARAI
FT                   EFFLRGETFRDLNDLVITGNTQSYRTTLRFSKEENTPAVNIRMDVPATFDMMLVPKDSP
FT                   VTEGGQVVKTGNDQFDAKWVLRSNQPTQAKIFVAGDTTMKQIKKLCCSSRTFVEIQRGA
FT                   LEISELTLPEGSPSRHLIDHMESMAVIGKQLALMPGAAQVKVERVSAPRPTSKVLAAVI
FT                   AVVAVCTGIAALANYEHSKKMNAAMVGSGGSPVGIPADEALHIPDLQGWRLADSPDFDP
FT                   SLVQWLRSSHVQPTGRLEGDFAGGGAGADHAYLLVNTNGGHRLVVLVNNQVKLDQQFNE
FT                   VVLVAKVPKSAIRSIKIENGSPATGNADGILVVTNKDDLHSGVVVSFNGNSPVTAVPQN
FT                   YKSTTLE"
FT   sig_peptide     120371..120430
FT                   /locus_tag="Acid345_0113"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.962) with cleavage site probability 0.930 at
FT                   residue 20"
FT   gene            121595..122782
FT                   /locus_tag="Acid345_0114"
FT   CDS_pept        121595..122782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0114"
FT                   /product="phosphoserine aminotransferase apoenzyme /
FT                   L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39119"
FT                   /db_xref="GOA:Q1IVI1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI1"
FT                   /protein_id="ABF39119.1"
FT                   /translation="MLHKNRLYTPGPTQLLPSAQFAMAAATMHHRTADFRDLYVRTLAD
FT                   LKSFIGTQNDVILMACSGSGAMEASVSNLTSPGDKVLVLTAGKFGERWSSLAKAYGVKT
FT                   EVVSAPYGETWTLDAVKEKLDGVSVVYMQGTETSTGVRHDVEGVAKLLKGTDTLLVVDA
FT                   ITGLGTTHFDVDGWGVDVIIGGSQKAVMIPPGLAFLSVSERAWKKMDATKNPRFYFDLR
FT                   KERKSAAKGESAYTPATSLIAGLGAALDFIRGMGNGNLSDGRHALVENAETAAAMTRAA
FT                   AEALGLTMFAKHSPAAAVSAINAPAGVDSGAIVKGFRNQFGAVVANGQGDEMKGKIFRV
FT                   AHLGYYDYLDTIAIVGALEHVLASISKPAHVEFGPGLRAAQFVYAQRATFAAATV"
FT   sig_peptide     121595..121669
FT                   /locus_tag="Acid345_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.866) with cleavage site probability 0.859 at
FT                   residue 25"
FT   gene            123038..124633
FT                   /locus_tag="Acid345_0115"
FT   CDS_pept        123038..124633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0115"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39120"
FT                   /db_xref="GOA:Q1IVI0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVI0"
FT                   /protein_id="ABF39120.1"
FT                   /translation="MKIVVAEKIAKAAIDLFKQDPTWNVVTPDQVAQKEQLLEQLKGAD
FT                   ALIVRSAVFVDAAMLEHADQLRVIGRAGVGVDNIELEAATRKGIAVMNTPGANAIAVAE
FT                   HTIGLMLALARFIPRATETMHAGKWEKKSLQGTELRGKTLGIVGLGRIGLEVARRAASF
FT                   GMTLVAHDPYVSPAIAHDAKIRLADRDEVLAVADYITLHVGLTPQTANMINATTLATMK
FT                   KGVRIVNCARGELIDDAALAEAVKSGHVGGAALDVFTEEPLKASPYHGVPNVILTPHIG
FT                   GSTAEAQDAVGVQIAHQVRDYLQRGVVQNAVNMPSLTEQEYVALEPFITLGERLGSLLA
FT                   QLAESRFEEIGIRYTGPLADWKTELIRNASIKGILQHTTDESVNVINANSVAETRGIRV
FT                   HESKKEHPSSGAAANVLGLTVTTPKGTLSVRGTVLHGNSPRLLSFDNIDVEAPLEGTLL
FT                   VIRNRDIPGVVGRVGTILGEHEVNIANFALGRPSGNSGGNAIAAVQVDGPLKEPVLQQL
FT                   RQQKAILAANVVQF"
FT   gene            complement(124797..125894)
FT                   /locus_tag="Acid345_0116"
FT   CDS_pept        complement(124797..125894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0116"
FT                   /product="peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39121"
FT                   /db_xref="GOA:Q1IVH9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH9"
FT                   /protein_id="ABF39121.1"
FT                   /translation="MRSWSIPIGRLFGVEVRLHLTFFFLLMFVWFAQSAANGTALAMRG
FT                   LALVGLVFGSVVLHELGHALVAIRLGVKVRGIVLLPIGGITFMDDNAPHTRQTAARDIR
FT                   ISAAGPLINLGIGIGAAIACVGLLHMNLLARPLITPVNLTKSFVWANLFLGLFNLLPAY
FT                   PMDGGRVLRSWYAQRMDYVQATRRAVTIGQTFAALFMVAGIWAPWLMMIGFFLFIGAQI
FT                   EDRTAIFQSVLETVRIEEVMLTDFSTLSSADTLEDALHKAVHSLQDEFPVIRGSDLVGV
FT                   ISRQRILDALRGGNGYVQGVMNRGFQIAQKSETLAAIFRRIGTKGLSLVPVVDGDRLVG
FT                   IVTMQNLTHSMALLAESRKLQRMEE"
FT   sig_peptide     complement(125784..125894)
FT                   /locus_tag="Acid345_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.644) with cleavage site probability 0.224 at
FT                   residue 37"
FT   gene            125987..126547
FT                   /locus_tag="Acid345_0117"
FT   CDS_pept        125987..126547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0117"
FT                   /product="conserved hypothetical protein 95"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39122"
FT                   /db_xref="GOA:Q1IVH8"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH8"
FT                   /protein_id="ABF39122.1"
FT                   /translation="MRIISGKFRSRSLKTPQGMDVRPSSDRLRETLFNVLASGYQLEDS
FT                   RWIDLFAGTGAVGLEALSRGAGYIYFVEKAPKIARITQENVKSLDAQDQAEVLTSDANA
FT                   GLRQLEGIDPVDYVFLDPPYREEGAYLGVLRILSDSPLLKPSAIVIAEHTKHFDPGDGV
FT                   GALQRYRSLKQGDAVLSFYRRAT"
FT   gene            complement(126540..127097)
FT                   /locus_tag="Acid345_0118"
FT   CDS_pept        complement(126540..127097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH7"
FT                   /protein_id="ABF39123.1"
FT                   /translation="MGQLADSRPLQEMFLNLVDRHFDEDIGLRDPDVKEYVAAMLAEFA
FT                   DAENLFRVKNAEGKPIQDVGEMLLESDPIYGPASSFDRERQVRKHIGDYTLFFSGMFPE
FT                   SINHVRLRKQRLENMIDFMKAGKESYYIVSKFEHFEYAKVAPLFAKLSKEFESCVYGLN
FT                   CVKNDLQEMHHPIIGKTRDFIM"
FT   gene            127364..128707
FT                   /locus_tag="Acid345_0119"
FT   CDS_pept        127364..128707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0119"
FT                   /product="FolC bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39124"
FT                   /db_xref="GOA:Q1IVH6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH6"
FT                   /protein_id="ABF39124.1"
FT                   /translation="MTYETAVEALYQLGHELAGTPSHKFDLAHMRVLLDALAHPERRFA
FT                   SVLIAGTNGKGSTAATLSSILLAAGYKTGLYTSPHLVKINERFRINGSQVNDAEFTAAY
FT                   EHVETLASALVETKALPWHPSFFEMLTAMAFELFARAGIQIAVLEVGMGGRLDATNVVE
FT                   PLISVIADISLDHQKFLGNTIAEIAAEKAGIIKPNGTVVTLPQHPAANDVIGHAILDHQ
FT                   AKGISAVKHMPPMAPGSADYRDVEGRNRYPLEVMNEIIEVNSPLPGRHQLRNLALAITT
FT                   AEELARFGFPVTSKQIEQGIRETRWAGRFQVISAEKNALKRELIFDVAHNPDGAWALRS
FT                   ALSDKIAERPLTLVFGAMHDKAFREMVQILFPTAQQVIVTQAKNPRAATTAELAEVAKE
FT                   VGTEVVQCASVEAAVHKAPELTAENGVIVVTGSIFVVGEAMNALQVET"
FT   gene            128769..129578
FT                   /locus_tag="Acid345_0120"
FT   CDS_pept        128769..129578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0120"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39125"
FT                   /db_xref="GOA:Q1IVH5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH5"
FT                   /protein_id="ABF39125.1"
FT                   /translation="MPALLSRLRSYFFYVPMVYLYTAIMGAGSLISSLFDRDGRIQHWF
FT                   ARTWSKMILGTASCPVTIINPEKLYVGGAAVYVVNHLSAFDIPTLYAALPFQFRIMAKK
FT                   ELFRYPVLGWHLSRSGQIPIERENARASLKSLMKASDTLKAGTSMVVFPEGGRSPNGQL
FT                   QPFLGGSFYVAIKAQKPIVPMALIGTYEALPMNSFHIRPRAFQLVIGDAISTAGYAPRE
FT                   MDKLAALAEDAVAELYYSRSTIERPATEPADEALRHAQLTESPEGQG"
FT   gene            129575..130342
FT                   /locus_tag="Acid345_0121"
FT   CDS_pept        129575..130342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0121"
FT                   /product="peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39126"
FT                   /db_xref="GOA:Q1IVH4"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH4"
FT                   /protein_id="ABF39126.1"
FT                   /translation="MSSTKPRIAIPEPHSSRQYTGKRLQDYVAPIEAAGGEAVIIELAL
FT                   PSAEQAHRMKSCDAVLLPGSPADLDPEKYGEVKDPHTAAADVARDNADELLLQDAYNMR
FT                   KPVFGICYGVQSLNVWRTGSLVQHIESKIAHEVKHEARAHTVEVKPATMLAKIAAEAEP
FT                   NVAEHWVNSSHHQSLATLGDGLQLAATSPHDGVVEAVEGTAPDQWVLGVQWHPERTYKE
FT                   DKFSRLLFERFLAEARRWHEQFAAKKNDFEAVR"
FT   gene            130343..131113
FT                   /locus_tag="Acid345_0122"
FT   CDS_pept        130343..131113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0122"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39127"
FT                   /db_xref="GOA:Q1IVH3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH3"
FT                   /protein_id="ABF39127.1"
FT                   /translation="MSVPMSLNGKVALVTGGSRGIGAAIVRLFVQAGAKVVFNYQRAAD
FT                   AANQLVAELGVDHCFAVQADLSNIASAGPLVEAAVAKFGAVDIMVANHGLWPPEDIPIN
FT                   EIPDEHWRNTLSINLDSVFGLIKHTVAQMKQQGRGGHIVLISSTSGQRGEAFHVDYSAS
FT                   KGALISMTKGLATELARYGIYVNAVAPGWVNTDMSASTLVDPKADALIYQQIPLGRVGK
FT                   PEEIAAPVLFLCTPMAGFITGEIFNVNGGAVLVG"
FT   gene            131140..132033
FT                   /locus_tag="Acid345_0123"
FT   CDS_pept        131140..132033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH2"
FT                   /protein_id="ABF39128.1"
FT                   /translation="MKQMIQKLLPFLLLLAAASAQTAPATTPAPAATPATTAASNDWLP
FT                   KLTGDEDATVKKARTLLTQMIEALGGDNYMNVTTIEQTGITYSFYNGKPNSLGIEFHRL
FT                   FKFPDKERLELTKQRDVIYIENADVGYEITYKGTAIQEPSSWREYVGRRNYSLENLLHV
FT                   WLKEPGTQIYYEGSAIAEQRMTEVVTVMNVHNETASIYIDQNSHLPVKKSFTYRSVLDK
FT                   QKDTEGEIYGNWRMEGPLNTPHSIVRTHNGDYTNQRFIRNVTYNAPMADSLFEAKPTYD
FT                   PYVLERKLDTREHPKK"
FT   sig_peptide     131140..131208
FT                   /locus_tag="Acid345_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.948 at
FT                   residue 23"
FT   gene            132687..133280
FT                   /locus_tag="Acid345_0124"
FT   CDS_pept        132687..133280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH1"
FT                   /protein_id="ABF39129.1"
FT                   /translation="MAINLCNHIKANGTGCESPALRDQDYCYFHTAHRQSQRRQRRAAR
FT                   LNLPFQLPLLEDAASIQLAINDTLNALLAGQIDHKTAGLLLYGLQTAAINVRHIDLDVS
FT                   GFDRQAAEYDDDEADLLEEEIAADIAEEKKLEVVAAKKTERETAKTAANTATLPGKKPA
FT                   ARAETAAAESKRAVGANPTSPTAPKSQLRSDGMK"
FT   gene            133433..134083
FT                   /locus_tag="Acid345_0125"
FT   CDS_pept        133433..134083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0125"
FT                   /product="NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39130"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVH0"
FT                   /protein_id="ABF39130.1"
FT                   /translation="MKIGILGSGAVGQTLGSGFLKHGHEVMLGSRDPRKSEVQAWVKAN
FT                   AGAKAGAFAEVAAFGEFLVLATLGVAAEHALEIAGLANLAGKTVMDACNPIAEGTPPQE
FT                   GVLKFFTGPNESLAETLQQKFPKAHIVKAFNSVGAARMVNPHFEEGVPTMFYCGDDDAA
FT                   KKQVAKLIQELGWEPFDCGGIIAARAIEPLCMLWCIPGFTRNQWTHAFKLLVK"
FT   gene            134177..134917
FT                   /locus_tag="Acid345_0126"
FT   CDS_pept        134177..134917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0126"
FT                   /product="MIP family channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39131"
FT                   /db_xref="GOA:Q1IVG9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG9"
FT                   /protein_id="ABF39131.1"
FT                   /translation="MSLTKRAVAEFFGTFWLVFGGCGSAVLAAGFPTLGIGFVGVALAF
FT                   GLTVLTMAYAIGRISGCHLNPAVSVGLVAAKQFPASELLPYIVAQVVGAIAAAGTLYVI
FT                   ASGKPGFELGGFASNGYGEHSPGGYSLLACFVAEFVLTAFFLFVILGAVDKRAPLGFAP
FT                   IAIGLCLTLIHLISIPVTNTSVNPARSTGQAIFVGGWALSQLWLFWVAPLAGGAAGGLL
FT                   FSTLFGSTEEEMLTRVAKAAEKAQ"
FT   sig_peptide     134177..134263
FT                   /locus_tag="Acid345_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.972) with cleavage site probability 0.780 at
FT                   residue 29"
FT   gene            complement(134925..136067)
FT                   /locus_tag="Acid345_0127"
FT   CDS_pept        complement(134925..136067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0127"
FT                   /product="alanine-glyoxylate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39132"
FT                   /db_xref="GOA:Q1IVG8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG8"
FT                   /protein_id="ABF39132.1"
FT                   /translation="MTTNSSIHPPQRLLFGPGPTQVAPSVYAAMSQPIVSHMDPYFFQT
FT                   SEAVQDMLRTVFGTKNPLTFAISGTGSGGMETAISSLVEPGTKVCVFANGFFCDRMTEM
FT                   AKRNGGNVVRLEKPWGEVFTDAEAAEFIAHEKPQVVMYVQAETSTGAFQQGTGICKAAH
FT                   DAGALVIADVVTSLGAMPVKVDETGIDIAYSCTQKGLSCVPGLSPITVSPRAAEYIEAR
FT                   KTPNRSWYFDLKLLNDYYKVSHRYHHTASATLFYALREALSLITQEGVENRWERHRRMH
FT                   HAFVSGIEKLGLKMHVAPEHRIVNLNTPRVPEGVDDAKVRKLLMDEHGIEIMGGFGPLA
FT                   GKVFRIGIMGPLATPEHVENFLKVFANALERSRTTAAVSN"
FT   gene            complement(136144..136734)
FT                   /locus_tag="Acid345_0128"
FT   CDS_pept        complement(136144..136734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0128"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39133"
FT                   /db_xref="GOA:Q1IVG7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG7"
FT                   /protein_id="ABF39133.1"
FT                   /translation="MALAKQKSANVSHLRSQEIRDERVRRTRARIDSGFVQLLHRRRYG
FT                   DIRISDICKKAAVGRATFYAHYATKDDLLRSQFERIVAPMLIIKPNSPCVIYATPFFGH
FT                   IQQMPDIFGAFMGPRGGTAPLVLRECFEARARQAIDLDRLTGLRKSALARFIAATLLTV
FT                   IECWLENGSRETPNELQDLFSSLITPAIVSANR"
FT   gene            136788..137471
FT                   /locus_tag="Acid345_0129"
FT   CDS_pept        136788..137471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39134"
FT                   /db_xref="GOA:Q1IVG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG6"
FT                   /protein_id="ABF39134.1"
FT                   /translation="MTTTTNDPIRRILAVALFAFPCLFVLVFLMHFHHGADFFHFHLHY
FT                   VPRDPARVVAALVAAQNRWPMVHDPHILGYLSLPLIQLCAFALYTVGRTRRPMASALAM
FT                   MTTVTGTIYLGGVFGMWTAFYRGLGNVDPSQTQGAIATFTAMTANQGAFLMTTTLAKLA
FT                   MIGLGAQALTLIGRIPAWAVACIVAGAVLFLLFWDLDNWMTIGTLLMCAGFVPVRRALL
FT                   AEEPA"
FT   gene            complement(137413..138657)
FT                   /locus_tag="Acid345_0130"
FT   CDS_pept        complement(137413..138657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39135"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG5"
FT                   /protein_id="ABF39135.1"
FT                   /translation="MRLLLSVLLLLSPLLAQESAPPAPSAPDDQEWIQKEVGLEQMFRN
FT                   PPDRFASLLFNRIDKVKVNGVEKVRYSLSSAGLEAGKPYLFMAWELGADAPHLLLPAVQ
FT                   VDDKGVLHCNPDNKECPGGPGSEINVALSDRPGQPSRFVIADQDEKPIAIGEVIPNPST
FT                   VTDHDCTLETVLLRPDATMALVIGHGFHPEEDIKVISTSFDQHVTNAGEANDQGAYQTV
FT                   LLPIAKDHDSGDTMVTMNSSQCELSTQFAWGATKSIAAEPAVAQESPTQAPTATSPATA
FT                   SETVVAPIRTATDQIQRAIADQAAAAEAEKHKPQLHAGPEPADVGPPADAQPTPEAPAA
FT                   PSATTPQPDEKPNQTEPAPDATAKPETPPATENPPSEAQPEAKPAPADEPAPNPDATPA
FT                   PPPAKPDAPEQTPHT"
FT   sig_peptide     complement(138607..138657)
FT                   /locus_tag="Acid345_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.615 at
FT                   residue 17"
FT   gene            complement(138688..139521)
FT                   /locus_tag="Acid345_0131"
FT   CDS_pept        complement(138688..139521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39136"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG4"
FT                   /protein_id="ABF39136.1"
FT                   /translation="MLHFPLMRICVAIILLFCGVGVVAAQDQPTAEQQEFLKKQVNIEL
FT                   TFQNPPEKWSRLSFNRGDSVVDSGQTKIRYSINAPKLDPTKKYSLMPWPLGAKSPQVGL
FT                   PAVEVDANGLLHCAKDRTDCPGGAGAAVAVAVPDVPGMPTRFIITEDKTPVAMGEVIPT
FT                   PIKGTDQACTIEVTILAPSAALTVISAQGFTPGEALKFTSTSYDDKVENSYTANEKGEF
FT                   QTIDLPGVKGHDDGMSTVTVQGAKCKPSAQFHWGAQTPAAATPAAAPTSPKPTPQ"
FT   sig_peptide     complement(139444..139521)
FT                   /locus_tag="Acid345_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.937 at
FT                   residue 26"
FT   gene            139622..142411
FT                   /locus_tag="Acid345_0132"
FT   CDS_pept        139622..142411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0132"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39137"
FT                   /db_xref="GOA:Q1IVG3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG3"
FT                   /protein_id="ABF39137.1"
FT                   /translation="MAHELPKAYEPSAIEHRWAEYWVQEKLYHVETPAENDHTPTFTLL
FT                   LPPPNVTGRLHMGHMLNHTEMDIIIRWRRMRGERTLWLPGTDHAGIATQMMVERQLATE
FT                   GKNRREIGREKFLERVWEWKKEYGGAITSQMRRIGDSVDWDREYFTMDDHLSVAVREAF
FT                   VRLYEQGLVYRGKYIVNWCPRCGTAISDLEVAHEETQGKLWEIRYPVEGTDESIVVATT
FT                   RPETMLGDTAVAVNPKDERYTHLHGKMVRLPLMDRLIPIILDELAQPEFGTGAVKVTPA
FT                   HDPNDFQAGLRHNLPQIDVMDEHAVMNENAGGYQGLDRYEAREQIVNDLQAQGFLVGIK
FT                   DHTLALGKCSRCKTIVEPRLSTQWFVAVNKKPNHGGMSWAEAAIAAVEQGHIRFTPENY
FT                   KPIFLQWMRNIYDWCISRQLWWGHRIPAWYCEECKEVTVARTTPEECSKCGGTKLDQDN
FT                   DVLDTWFSSGMLPFTTLGWPEKTRDLEVFYPTSLLLTAFDILFFWVARMIMMGCYFMSG
FT                   PNRPTEIAGGKENELKESIPFKEVYIHSLVRDAERQKMSKTKGNVVDPIDVLNKFGTDA
FT                   VRFTLASMAAPGTDIAFSESRTESYRSFANKIWNAARFIFMNVDRAAEKGVWSLEEFAK
FT                   TQPKGEGLPGFSTETLEDRWILSRFNKVAREVSEALETYRFHEASHVVYHFFWGEFCDW
FT                   YIELTKPRLEADEATARKTFANLLAVFEGALRLLSPFMPFITEEIWHAIYDGKPPLKSI
FT                   SLAEYPKANVAQISDEAETEMAILQDLIQAVRNIRSEIADIKAQPKIKAGIEVFATAEI
FT                   QQLVERNRGALERLANVSEVKFVGESLAKASLARSTARFEVRVVYEQKVDVAAERERLS
FT                   KELKKLEGEFANNQRQLGNENFLQKAPAKVVEGLRTREGELKVLIEKAQSALKGLEGK"
FT   gene            142546..143424
FT                   /locus_tag="Acid345_0133"
FT   CDS_pept        142546..143424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0133"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39138"
FT                   /db_xref="GOA:Q1IVG2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG2"
FT                   /protein_id="ABF39138.1"
FT                   /translation="MDWNSRRVTAVLENALTEDRATRDATTYACIDPNQRATGTLIAKE
FT                   DCILAGIGAVQRIFEVYAMLDGAVVSHPEVTTHPEIFDGVRLRKGQTVAVIRHNARVLL
FT                   SCERVILNVIQRMSGIATATRRFVDAIAGTHAKILDTRKTVPGLRVLDKYAVRCGGGTN
FT                   HRLDLSDGVLIKNNHIALAGSAVEALDRAIRNRRGEQPIEIEVRSLEELEQVLEKGAES
FT                   VLLDNMTAEDVRTAVERVKKLDRSVPLEASGGIVLENVRSYAETGVNFISVGALTHSAR
FT                   AVDLSLRIMPA"
FT   gene            143505..143906
FT                   /locus_tag="Acid345_0134"
FT   CDS_pept        143505..143906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0134"
FT                   /product="Ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39139"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG1"
FT                   /protein_id="ABF39139.1"
FT                   /translation="MSFVFRDFFFRIGTMPKFQKHVFICQNQRPAEHHRGSCDPGGTGE
FT                   LQKIFKKKLADHGIRGDQVRANKSGCLEQCEHGPTVVVYPEAVWYGGVQAADVDEIIES
FT                   HILGGKPVERLLIADECLNAEKCAHRPRK"
FT   gene            143985..145076
FT                   /locus_tag="Acid345_0135"
FT   CDS_pept        143985..145076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0135"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39140"
FT                   /db_xref="GOA:Q1IVG0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVG0"
FT                   /protein_id="ABF39140.1"
FT                   /translation="MTDFPTDNAGIARSGQNRDAMEGTLTDERLGHLVRLLGDHPTVVM
FT                   SGTKIADELGVSRSEVWRLIEHLRELGVQIEGHPATGYQLGAIPDLLLPEALEPQIKGT
FT                   LFAHNVHHYFRIGSTNVAAMQAGAAGAPEGTVFVAEEQTAGKGRGGHSWHSVESAGIYC
FT                   SVLLRPRVAPADALILALAAGVATADAIASVTGLAPDLRWPNDLLFGLKKFCGILTELN
FT                   AEATRVRYVVIGVGINVNHQEFPEEISKVATSLRLESGRVWSRVEVAAALLKSLDRVYA
FT                   ELLRGGAEARRGMIARFQEMSSLAKDRRVFVEEDGGYAGTSAGLDERGFLQVSTNHGKS
FT                   VRTVLSGGVRSIEDVEGIRQLHH"
FT   gene            145086..145910
FT                   /locus_tag="Acid345_0136"
FT   CDS_pept        145086..145910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0136"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39141"
FT                   /db_xref="GOA:Q1IVF9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVF9"
FT                   /protein_id="ABF39141.1"
FT                   /translation="MLLVLDVGNTNTVLGVFEATPAENGSYTYGRLIAHWRVGTIRTQT
FT                   VDEYGVLFRNLFAMGNVDFKVIHGIIISSVVPPMDTTLRSVCERYFALKPLFVEPGVKT
FT                   GMPVHYDNPSEVGADRIVNSVAAFEKYGGPCISVDFGTATTFDVVSAKGEYLGGVIAPG
FT                   IGISAEALFQRTARLPRVDIKRPTKVMGTNTVNSMQSGFYWGYLGLVDGILERLVEEMG
FT                   GNVKIVATGGLSPLIGAGSKYIKDVDDLLTLDGLRIIWERNQSNTRKREHGK"
FT   gene            145993..146679
FT                   /locus_tag="Acid345_0137"
FT   CDS_pept        145993..146679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39142"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF8"
FT                   /protein_id="ABF39142.1"
FT                   /translation="MENYFNYFTEIEEHFQRRRGSLLILSTLDWALIETWKDAGIPLEA
FT                   VLRGIDATFDGWEKKPNRTRKVNGLAFCTQEVLGAAEQIAEAAVGAAPAEKKESGLEQG
FT                   QVAKFLLANAVKLRKLELPEPAFTLAGLTANTLTELAGSVMKDSAFRAEDLERRLTVAE
FT                   EKLFAALLAATADDAIVSVRIEADRDLAPYRGKMTGPQIEQLHKQYIHKRILERYNVPR
FT                   LSLFYM"
FT   gene            146694..148019
FT                   /locus_tag="Acid345_0138"
FT   CDS_pept        146694..148019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0138"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39143"
FT                   /db_xref="GOA:Q1IVF7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF7"
FT                   /protein_id="ABF39143.1"
FT                   /translation="MVELKIEKLIYGGDGLARMHDAKLGRSKAVFLPFVAPGETVEAII
FT                   REQKPGFARAQAEKVLQPSEFRQTPPCPYFFKCGGCQYQHLQYAEQVKAKAQILEETLS
FT                   RTAKLKLEQPIQTHAAEPLGYRNRTRMRVSHVPQFAIGYYRFGSHSLLPVEQCPISSPL
FT                   INRVLQGLWAAGREERIAREVREVQFFANHDDSRLLLELYIDHHAEPDALQPMIETLRG
FT                   KMPEIAGVAVFRGAPADDSEDQRAPLTRAKASPGVFFGERSLRYKTKRHEYQVSAGAFF
FT                   QTNRFLLDEMAETVTRGHSGKLALDLYSGGGFFSLPLADQFEKVIAVEASGHSQADLKT
FT                   NALRNVKAVRSGTEEFLRGEGRQLRPDLVVVDPPRAGLGEKTSHLIGRMSVGRVTYVSC
FT                   DPATLSRDMKVLVESGFRVEEVHLFDLFPQTYHLESVLHLVR"
FT   gene            148033..148326
FT                   /locus_tag="Acid345_0139"
FT   CDS_pept        148033..148326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0139"
FT                   /product="YCII-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39144"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF6"
FT                   /protein_id="ABF39144.1"
FT                   /translation="MYALAIIRYRRPLEEVVNVTNAHRAYLGELKAQGILIASGPFDPR
FT                   IGGGLLLRVPDGDVAGTLDRVRDNDPYVKSGMAQYELLAWNPGIGKEELDKL"
FT   gene            148330..150936
FT                   /locus_tag="Acid345_0140"
FT   CDS_pept        148330..150936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0140"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39145"
FT                   /db_xref="GOA:Q1IVF5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF5"
FT                   /protein_id="ABF39145.1"
FT                   /translation="MNSPGPTDVPRSPFCGGKQPLFLTALAFGCGILAARFVFHPSNAW
FT                   LIAALLVVACAIGLRKSPTVAFAGMMLSAAMAGGLAHELRGPEGVDYPQAMSDGECTVT
FT                   AHVVRDGVLQRGMFGGQQQSVDLETERVQLADGSGFGRPVGLRLSVYARKSDYEDEEQQ
FT                   QAGVLPMPVLRYGQRVRLTAKLHEARNYKNPGAWDYRGYLRAQGIELLGNARVSSVEVL
FT                   PGFGGSRWKQSQHRARAAVLAKIHEIWPAEQAALFDAIVIGERSELGSELKTSFQSTGT
FT                   FHILVVSGMNVGILAFGFFWLFRRIRMGDVVATICTLASSFAYAWLTDLGSPILRAVWT
FT                   LTIYLLARLLFRQSSRLNAIGVAALVILAWSPDALFDASFQLTFLSVAVIAGVVVPWIE
FT                   RTSDPYRKALQNLNIVRADRGYRPQQQQFRLDLRMIGGRLARVLPHRIVRPMLTTPFRV
FT                   TFAAYELLLVSLLMEFTLALPMAVYFHRVTLMAPVANALVVPLTGVLMPACAAAVLLGF
FT                   VWLRLARLPAMVALWSLKAITGAVAVLGHLRVSTGRVATPSLVVALSAAVAIALAMLLA
FT                   RRRCWLAAVGSLAIIASGAAVLFIVPQPQHKSGALEVTAIDVGQGDSLLLVYPNGQSML
FT                   LDSGGPLGGSHSDFDVGEQVTSPYLWARGINRLDVVAYSHPHSDHMGSMATIIRNFRPR
FT                   ELWLGFAPPVRDVENVLQAAREEHVTVRFFRTGDQFGFGGANVRVLLPLRDQEPHMPPK
FT                   DDDVLVLKIAYGKTSALLIGDSHKKEERELIDLAPEADLLKVAHHGSNTSSSPEFLAAV
FT                   HPKFGVISVGARNSFKHPRPEVLERLASFGVQTYRTDMAGATTFYLDGTNVSVVRR"
FT   gene            complement(151107..151388)
FT                   /locus_tag="Acid345_0141"
FT   CDS_pept        complement(151107..151388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39146"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF4"
FT                   /protein_id="ABF39146.1"
FT                   /translation="MATQPTPNSDLVRVFDTEQESEALVVKGLLESAGIDALVISLDAQ
FT                   QDILPGVGGVVVQVPGDRADEAREIIEAFRNQPTTDDEAAVEEEPPTA"
FT   gene            complement(151432..152070)
FT                   /locus_tag="Acid345_0142"
FT   CDS_pept        complement(151432..152070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0142"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39147"
FT                   /db_xref="GOA:Q1IVF3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF3"
FT                   /protein_id="ABF39147.1"
FT                   /translation="MQLKAIVFDYGMVLSLSPTEDDWSRLASVFNVSVEQFQEPYWDLR
FT                   LDYDRAVYTGQTYWFAVAEHLGKTISHADVHRLIAFDNEQWTKANPEMLEFAWQAKAAG
FT                   LKIGILSNMQSDMLHAMRQRLNWLNRFDAQIYTCDIGSVKPEPEAYRAVLAALHVSAGE
FT                   SLFFDDKQPNIDGARAVGMHAELFEGETETAYQAVERLGVPLAERKCAD"
FT   gene            complement(152107..153009)
FT                   /locus_tag="Acid345_0143"
FT   CDS_pept        complement(152107..153009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0143"
FT                   /product="Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39148"
FT                   /db_xref="GOA:Q1IVF2"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF2"
FT                   /protein_id="ABF39148.1"
FT                   /translation="MYTPQAGIFALGTSSHAYLEFDALDATKHDEFAAKLAAIHEPRTT
FT                   TGGVNFVIGFRPELWRKLTPGDIPTDVKGFNAPINGIEGFAMPATQHDAVVWLSGSAYD
FT                   VLFDMARDVIRDLDGLAKLADETASWPYRHVRDLTGFIDGSENPSLLDAPAAALIPEGT
FT                   PGAAGSILLLQKWVHKSAEWEALPVERQEKIMGRLKLDSTEIEDKPEDSHVARTDQDDF
FT                   GKVFRRNMPYGGVQDHGTMFVGFTCEQQRLAKMLDSMAGLVNGTRDALTRFTTPLTGSY
FT                   YFVPSVESLRRLRPDEAAS"
FT   gene            153075..154229
FT                   /locus_tag="Acid345_0144"
FT   CDS_pept        153075..154229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0144"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39149"
FT                   /db_xref="GOA:Q1IVF1"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVF1"
FT                   /protein_id="ABF39149.1"
FT                   /translation="MSMSFSFQVEATQGAARAGRMITPHGEVETPVFMPVGTVATVKGI
FT                   PQDLLEELGVQILLNNTYHLYLRPGVEQIRKLGGTHKFMSWDRSILTDSGGFQVFSLSE
FT                   LRKVTEEGVSFRSHLDGSSHLFSPESAMASQIGIGADIIMAFDECTEYPAERTRTERSM
FT                   ELTLRWAERSKNAFEAHKHEVPWFAERGKKSQALFGIVQGGMFPNLRKESAERTVEIGF
FT                   PGYALGGFSVGEPREKTAELVANTVPLLPENKPRYLMGVGYPEEIVQYARMGIDMMDCV
FT                   LPTRAARHGLLFTSEGRLTIKNQRFASDEGPLDPNCSCKVCKRYSRAYLRHLYASNEVL
FT                   AQVLNTTHNLSYYLDTMRRVRQAIILGENSVSLPVVRSPHLSAT"
FT   gene            154407..154730
FT                   /locus_tag="Acid345_0145"
FT   CDS_pept        154407..154730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0145"
FT                   /product="protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39150"
FT                   /db_xref="GOA:Q1IVF0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVF0"
FT                   /protein_id="ABF39150.1"
FT                   /translation="MTNLLAVFWQAVGGQFGGSLIFMVAIFAIFYFLLIMPQQRRQKKW
FT                   QQMLGELKSGDKVVTTGGIRGVIFSVKDDALVLRVAPDNIKLEVTRQAIASVITEDKEN
FT                   SKS"
FT   gene            154746..156353
FT                   /locus_tag="Acid345_0146"
FT   CDS_pept        154746..156353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0146"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39151"
FT                   /db_xref="GOA:Q1IVE9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVE9"
FT                   /protein_id="ABF39151.1"
FT                   /translation="MKKNLTWKVVVIVAVLLVFAFGIIGNPAEVKWDKEGLKTALMNRI
FT                   HLGLDLRGGTHLILQVVVNDAVNAETDRAIERIKEDLANNKVTYSDITKPDAANAPERI
FT                   AIKGITPDGATTLRRVSDERLPEYSFGSGPEGSYTLTMKPAQLKDLKDRAVQQAIQKIR
FT                   ERVDSLGVSEPVIQEHGLGDYQILVQLPGVDDPARVKEVMQSTAMLEIRQVFGGPYSKE
FT                   SEAAQGQMQQPDTVVLPGKSESDPGTQVFYLVARSSAVAGHDLRQARVGRDQNGGANVQ
FT                   FNLTRDGGVRFSQFTSAHVGDKLGVILDGKVMEVANIKSEISDSGEIEGRFTDQQASDL
FT                   ALILNSGALPASIKYLEERTVGPSLGMDSIRQGVRAAIIGFVAVIIFMLIYYKGAGINA
FT                   DLSLLLNLVILLGFMGYFGAVLTLPGIAGVILTVGMGVDSNVLIFERIREELRNGKTPP
FT                   SAVEQGFGHAWLTIIDTHVTTIVSAIILFLFGTGPVKGFAVTLSFGLFANLFTAVFVSR
FT                   VIFDSILNRHQRGEALSI"
FT   sig_peptide     154746..154823
FT                   /locus_tag="Acid345_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.983) with cleavage site probability 0.444 at
FT                   residue 26"
FT   gene            156415..157629
FT                   /locus_tag="Acid345_0147"
FT   CDS_pept        156415..157629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0147"
FT                   /product="protein translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39152"
FT                   /db_xref="GOA:Q1IVE8"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVE8"
FT                   /protein_id="ABF39152.1"
FT                   /translation="MELFRNTNIDFLGKKWYFLAFSLVFSVAGLISMGARYAKTGTAVP
FT                   LGVDFKGGTLVYVKFAQTPNLGDIRAAMDRSGLKDPKIQTYGGPANNEVLIALEQKETS
FT                   EQALDAGKNTIIKALETNPASGKNDLNNVGSTTIRDYLMSKDPLHEVVDPGAKYQQIAS
FT                   QIVDYRDKERGGVLSSVDELQGHVPADVVNALKTDYFTSGFGVRNVEIVGPQVGKQLSN
FT                   QALLATLYSLGGMLVYLWFRFELIYGIGAVVACFHDTIITVGAFSLLNRDISLTVVAAI
FT                   LTLIGYSMNDTIVVYDRIRENIKLLRRESLADIVNKSINQTLSRTILTSGLTFLTVLSL
FT                   YVFGGEVLRGFSLALVIGILIGTYSSIAVAAPMLVAYQEWRGHRGTAALPGPAPRKNDR
FT                   VKVKA"
FT   sig_peptide     156415..156531
FT                   /locus_tag="Acid345_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.994) with cleavage site probability 0.978 at
FT                   residue 39"
FT   gene            157760..158494
FT                   /locus_tag="Acid345_0148"
FT   CDS_pept        157760..158494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0148"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39153"
FT                   /db_xref="GOA:Q1IVE7"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE7"
FT                   /protein_id="ABF39153.1"
FT                   /translation="MFEDSLLESGGRLKTKSKTTTTIAFIVQIALVGVLVLIPLIYTEA
FT                   LPKGQLTTFLVAPPPPPPPPPPPAAAPVHVVKKIETDLNNGQLRQPTAIPKKVAMIKED
FT                   EPPPSSAGVMGGVAGGVPGGSMNGVIGGIVSSAPAPVVKMATPQKVRVSQGVSEGLLLH
FT                   KVTPNYPALAKQARIQGSVVLQATIGKDGSIQNLRVLSGHPMLTQSALDAVKQWKYKPY
FT                   LLNGEAVEVETTVQVNFTLSGG"
FT   gene            158707..159462
FT                   /locus_tag="Acid345_0149"
FT   CDS_pept        158707..159462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0149"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39154"
FT                   /db_xref="GOA:Q1IVE6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE6"
FT                   /protein_id="ABF39154.1"
FT                   /translation="MFLANLATLVLANAHLAAWAFQDDAGAVGWDPVSLWKQMGILAKI
FT                   VVIILFIMSGWSIGVMIDRALAFSAARKQSRAFAPAVAGALREGKIDEAIRVAERNKKS
FT                   HLAKVVTAGLQEFKAHGESADIPGEQIEASKRALERAEAIVHAELKRGLSGLATIGATA
FT                   PFVGLFGTVVGILNAFRSISQNKATGLGAVAGGISEALVTTAIGLFVAIPAVMMFNYFT
FT                   GKVEAFDVEMDNSSSELIDYFLKRRGIKR"
FT   sig_peptide     158707..158769
FT                   /locus_tag="Acid345_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.972) with cleavage site probability 0.960 at
FT                   residue 21"
FT   gene            159499..159948
FT                   /locus_tag="Acid345_0150"
FT   CDS_pept        159499..159948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0150"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39155"
FT                   /db_xref="GOA:Q1IVE5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE5"
FT                   /protein_id="ABF39155.1"
FT                   /translation="MAIAKRTANVNSNINVTPMVDVMLVLLIIFMVITPMLQKGVSVDM
FT                   AKTNSPAPMPDADKEDSLLVAVQRDGTVFFGSDKINPDDLTNKVKDRIANKTDKRVFIK
FT                   ADARAKYGRVVEVVDDIRSAGVDTVGLLTEQKKPLAAPPPTPATH"
FT   gene            159967..160413
FT                   /locus_tag="Acid345_0151"
FT   CDS_pept        159967..160413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0151"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39156"
FT                   /db_xref="GOA:Q1IVE4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE4"
FT                   /protein_id="ABF39156.1"
FT                   /translation="MSMNVGGSGGGPTADMNVTPLIDVLLVLLIIFMVITPLTPKGLDA
FT                   LVPQPPPKDQKQQPPPPERTIVVQVIKSGDPDRPTLKINQDEANYDNLEGRLRDIFASR
FT                   AEKVMFVKGDDDISFSSVAQVIDIAHSAGVDKVGLITAKIEAGQ"
FT   gene            160542..161363
FT                   /locus_tag="Acid345_0152"
FT   CDS_pept        160542..161363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0152"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39157"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE3"
FT                   /protein_id="ABF39157.1"
FT                   /translation="MTRSARVLVVVAALLAMLAGTGCNKLKARDQLNKGVQSYKNAKYE
FT                   EAIEHFKNAVELDNSLTNARLYLATAYAQQYVPGMDAPENVRNANMAIEEFTKILDANP
FT                   SREQQIHSLKGIASLYFNMKKFDQASEYHKKVIALDPNDPETYYSIAVIDWTEAYQEDQ
FT                   KARAAAGVQATAQLKDKKVCQELRTKNAQKVEDGINALTKAIQLRPDYDDAMAYINLLY
FT                   RQRAEYECDDQAAYDADIKTANEWVDKTIATKKAKAEKAGPTGVITTDQSK"
FT   sig_peptide     160542..160628
FT                   /locus_tag="Acid345_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.991) with cleavage site probability 0.720 at
FT                   residue 29"
FT   gene            161506..163062
FT                   /locus_tag="Acid345_0153"
FT   CDS_pept        161506..163062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0153"
FT                   /product="pyruvate carboxylase subunit A"
FT                   /EC_number="6.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39158"
FT                   /db_xref="GOA:Q1IVE2"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE2"
FT                   /protein_id="ABF39158.1"
FT                   /translation="MAKLFNKILIANRGEIAVRVIRACREMGIESVVVYSDADRRALHV
FT                   RKADYAYHIGPSAASESYLRIDKILDVAKKSGAEAIHPGYGFLSENARFARACVAAGVK
FT                   FIGPTGDAMDAMGSKTKARQAMAKANVPMVPGNAEGLKSAEEAEVLAEQIGYPVMLKAA
FT                   AGGGGKGMRMVKSRGELRSALEAASSEAQRSFGDSEVYLEKFIVNPRHIEMQIFADEHG
FT                   NTVWLGERECSVQRRHQKVLEESPSPIVDPDMRRRMGEVAVRVAQVANYTNAGTVEFLV
FT                   DEQKNFYFLEMNTRLQVEHPVTELVTGMDLVHLQIRVASGELLPFKQEDLLLRGHAIEC
FT                   RVYAEDPDNQFFPSPGRITRLISPSGPGIRRDSGMYEGWTVPLDYDPLLAKLIAYGSDR
FT                   EQCIHRLQRALYEYFVGGIKTNIPLFRRILSDADFQAGKLHTGFLDRLLSEPHLPAPEH
FT                   EERTRMAAIAAAIFASTEPQVTLGKPFDGVTYAAAAKPVNGAANGEKSEWKFQGRTEAL
FT                   R"
FT   gene            163062..163565
FT                   /locus_tag="Acid345_0154"
FT   CDS_pept        163062..163565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0154"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39159"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE1"
FT                   /protein_id="ABF39159.1"
FT                   /translation="MVYDIVISEKTYRVEIARAGSRWSGKIDGQPFDVDAVPTARDILS
FT                   IIEGEGKAYEVKRERALNGELHMLVGSSRYSCEINDPRSLRTRRAAAGSTEGPQKIVAP
FT                   MPGKVVRILVPQGGEVEVGKGVVVVEAMKMQNELKSPKSGKVQKVLVSEGATVNAGDTL
FT                   AVIE"
FT   gene            163664..163915
FT                   /locus_tag="Acid345_0155"
FT   CDS_pept        163664..163915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0155"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39160"
FT                   /db_xref="GOA:Q1IVE0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVE0"
FT                   /protein_id="ABF39160.1"
FT                   /translation="MDEIARTSKQLGALLRKTRKSLGLTQADLASRIDVRQATISDLEH
FT                   GEREARLGTVLQVLAALDLELVVRTRTRGDAKHLEDLF"
FT   gene            163915..165216
FT                   /locus_tag="Acid345_0156"
FT   CDS_pept        163915..165216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0156"
FT                   /product="HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39161"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD9"
FT                   /protein_id="ABF39161.1"
FT                   /translation="MPRHATYAPLNVFINSRRVGVLRRESSGAVEFRYSDEWLAWAHAF
FT                   PISLSLPMRPEKYVGAPVLAVLENLLPDNEAILRRVAERVHANGTDAYNLLSAIGRDCV
FT                   GALQFRPEDTQPGPAGVVDGEELEGHGIEQLLANLTRAPLGLTTDDDFRISIAGAQEKT
FT                   ALLRWNDRWWKPLGATATTHIFKRPIGMAHNIDLSDSVENEYLCLRLTKALGIPVANAE
FT                   IEQFGKQKALVIERFDRLWTSDKRLLRIPQEDCCQAFSMPPTKKYEAEGGPGAVKILTL
FT                   LNASDTPTDDQKMFLKALITFWLLGAIDGHAKNFSIRIAEGGRFQLSPLYDIVSGQPAV
FT                   AAGSIRHNQFKLAMAVGKNRQYVVNSIAPRHFAETAAQAGVGRVVVEEAMQELHSAAVK
FT                   NVSHVFKDLPSKFPMKMAEAVQKGFDRRLKMLSA"
FT   gene            complement(165262..166215)
FT                   /locus_tag="Acid345_0157"
FT   CDS_pept        complement(165262..166215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0157"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39162"
FT                   /db_xref="GOA:Q1IVD8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD8"
FT                   /protein_id="ABF39162.1"
FT                   /translation="MARVNGHKITRPEVEKYYKNQIAGSPQQPSDEQADNLRLNILREL
FT                   INNEILMQRAEKLGLLATDEEVDSKVNAAKAPYSQEQFDARLKERGITMDDFRRDLRRS
FT                   ITIDKVINKEITSKINVSDGDISSYYNAHKAEFNLIEPQYHMAQILVTPQPNPQVKNLQ
FT                   KANNDAEAKKKIQQLVNRLDSGEDFASVAMNYSEQPEISPNGGDLGFIPESSLKGDKLA
FT                   FDAVARLKPGQYTGVLPIVDPSNKQVLGYRILKLIAKESSGQRELNDPRVQQAIREQLR
FT                   DGREQLLKAAYYESVRDKSSVENYFADDVLKRAGQK"
FT   gene            complement(166381..167322)
FT                   /locus_tag="Acid345_0158"
FT   CDS_pept        complement(166381..167322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0158"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39163"
FT                   /db_xref="GOA:Q1IVD7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD7"
FT                   /protein_id="ABF39163.1"
FT                   /translation="MSLFKSLAVVVLAVCVGCSAQSSSNTQSQNKLSDAQLNRRIQDQI
FT                   RAHFSVPPQVNITVGAPKPSDFSGYDAVTVAISDGDKSKNYEFLLSKDGKTLARLSKID
FT                   LSKDPYEENMAKIDIANRPVRGNKDAKVTIVNYDDFECPFCARMHSELVNVLKQYGDKV
FT                   RIIYKDYPLTEIHPWADRAAVDSNCIASQNTDAYWDFADYVHSNQPAITGKKEEHRSVA
FT                   AMQEAVDKVTLDIGRKHSLNVDQLQACIKNQSESAALKKSVSEANGLDVSATPTMFVNG
FT                   EKLEGAIEEDALIDVIKKHLQEQGSTGTGASK"
FT   sig_peptide     complement(167248..167322)
FT                   /locus_tag="Acid345_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.430 at
FT                   residue 25"
FT   gene            complement(167429..168280)
FT                   /locus_tag="Acid345_0159"
FT   CDS_pept        complement(167429..168280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39164"
FT                   /db_xref="GOA:Q1IVD6"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD6"
FT                   /protein_id="ABF39164.1"
FT                   /translation="MAVSPLPELSLEKKQQSLEAHLRSLGRLLVAYSGGIDSAYLAYVA
FT                   HQVLGDNMLAILADSASLARAQMRDALAFGEEQSIPVQVVQTSEMDSPDYRRNDAMRCF
FT                   HCKDELFAVMERVATEHGYSKVAYGVNLDDQGDFRPGQRAAKQHGVVAPLLDAAMTKSD
FT                   IRELARQAGLRVWDKPASACLSSRIEYGRPVTTEALEQVEKGEDALRGLGFRQVRVRHH
FT                   GQIARIEIAKDEIARAMTPEMAREFTRVFKALGFTYVTLDLEGFRSGSMNSLLPLEVLQ
FT                   KQ"
FT   gene            complement(168325..170823)
FT                   /locus_tag="Acid345_0160"
FT   CDS_pept        complement(168325..170823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0160"
FT                   /product="Organic solvent tolerance protein OstA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39165"
FT                   /db_xref="GOA:Q1IVD5"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD5"
FT                   /protein_id="ABF39165.1"
FT                   /translation="MTFRRETNTTLRMGCHLLLLCCLLTSGLLAQKNLKSEKTSPAIKS
FT                   SQSSRPPEDVLIEAREQEKIGSIYKLRGNVVIRFRGFVLHSDEITYDDSTGEVQATGHL
FT                   VLEGGPHDEHLTATHGTLNVQTQTGKFYDVTGMTGAKFRGKNVILTSSNPFVFTGEVVE
FT                   KVAPDRYVVYHGVITTCELPQPKWTFHAAKIDVVVGADAKIYHSDFRLHGIPVFYFPYV
FT                   QHPVENLGRQTGFLLPNIGQSSQKGTILGDSFYWAINTSSDLSVGAEYFSQRGWAEHGE
FT                   FRSRPDEKTTIDLHYFQVLDRKNQGGAEVRLSAETKAKYDIRAVADIDYLTSFIFREAF
FT                   AESYTQAINSEVKSVAFLTKSIDTLSFNAMASRYQNFLGTNQCSTLGIYVPCSVTGTPL
FT                   VTTGGDSAILIVHAPTFELTNVEKQIARTRFFFWLEGAAEGLKRSEPDLATLKTTVINY
FT                   SVPYMGRYDIQPALSYALFLNGWTLRPSIAMRDTYYTQRALGNVSIEDPVNRRSLEAGF
FT                   EFRPPALEKIFEKPIFQHQVKHTIEPRIIYNYVNGVDNFHNIIRFDARDILSNTNEVLY
FT                   AFTTRVYTKNLRATSDCPDPLTPENKLPHEQLESLKPKSTCGDLASRTREAFSWDLAQK
FT                   YYFDPTFGGAVINGTRNVFTTSAELTGIAYIDSPRRFSPFVSRMRIQTTANTDVQWNFD
FT                   YDSVAGRINASTVIGNYRFSEYFVGASHAFLNTTVPDATSSNVALVPARFNQIRFLGGF
FT                   GHPNKTGFGAAASLGFDATQGFLQYSAAQLNYNWDCCGVSAEYRRFALGNIRNENQFRF
FT                   SLTLANVGSFGTMKRQERLY"
FT   sig_peptide     complement(170731..170823)
FT                   /locus_tag="Acid345_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.994) with cleavage site probability 0.932 at
FT                   residue 31"
FT   gene            171133..172119
FT                   /locus_tag="Acid345_0161"
FT   CDS_pept        171133..172119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0161"
FT                   /product="Rdd"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39166"
FT                   /db_xref="GOA:Q1IVD4"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD4"
FT                   /protein_id="ABF39166.1"
FT                   /translation="MDESLPLDESWKSEVASRLDSYRSKSKRKLSGDFSMRFNFEGELA
FT                   RPRQQICVPAAPKSETVEPDAEEQAAETLELSVVAKVEAEQQVIEEKVQLEQVELPQTV
FT                   PPSQPPPLRPSVPFKRKIRMEANVIEFPRLFPPEPPLSNVLAEPVLPSAPRILDAPEIA
FT                   EPLWETPILEGMRLEHIEHESAPQFELPLQVASVIQRVNAYVADGLIVLIASAVFCAVV
FT                   LKLLPGLELSKPLIFGAAAVPPIFWATFEYLFIVYAARTPGMAMTKLALSTFDGTAPNR
FT                   RQRHRRVLGMAVSCCSLMLGFLWAFFDEDMLCWHDRMSRTYSFHQKS"
FT   gene            172200..174467
FT                   /locus_tag="Acid345_0162"
FT   CDS_pept        172200..174467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0162"
FT                   /product="Amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39167"
FT                   /db_xref="GOA:Q1IVD3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD3"
FT                   /protein_id="ABF39167.1"
FT                   /translation="MSSFSDQANRPAVKVFVATTVMLSFISFWRAAAIVLSDLASSAYY
FT                   VGGDAEKVIGKSAPWFVLAVMLFANGVRAVYIESSVMFVRGGVYKVVKSAMGSQLAKLS
FT                   VSALLFDYVLTGPISGVSAGQYLAGLLIDTLGHFGHPIHATDQQINYFAAVVAICVSLY
FT                   FWWNNIKGIHESSDKALRIMQITSIMVVLLIGWCLITFILHPETAHLPPFPSRETLKVS
FT                   GESLGWLYGTWAGKLLPILLIVGFGHSVLAMSGEESLGQVNREIEHPKLQNLIKAGIVI
FT                   ACFALFFTSLVSIFAVMIIPDSVRPNYFANLISGLAMNVAGPYTLRLFFQAFVVLVGAL
FT                   LLSGAVNTAIVGANGVLNRLSEDGVLTSWFRHPHPRFGTSHRVINMIVILQIGTIIASR
FT                   GNVYLLAALYAFGVVWSFSFMSLAVLVLRFKNPENRQWKVPGNIRFGQVEFPITVSVIF
FT                   LALLSVAIVNLFTKPLATKYGIIFSALLYGVFTVTERMNQRTVASGKHELEQFRVAAQE
FT                   EPSYESIEVRPGNILVAVRDPKNLTYLRKILQETDTTKRDVVVMTARVYHRQHSFGDVR
FT                   SMEPTEVFDQYEQSLFTAVVNIAEKEGKHISLLVAPTNDVFDAILATAQRLRSSKIVCG
FT                   LSNKLSDDEQAKLSGDAWERLPEPRPRLRLVIVAPDGREREYELGPHNPRLRLQDLKLM
FT                   HEIWLELTRDPKYSGLHHYHVVGAALKELQDRLHGTDRVGAIRDIEAEIKRDSDEPPQI
FT                   VG"
FT   gene            complement(174513..175820)
FT                   /locus_tag="Acid345_0163"
FT   CDS_pept        complement(174513..175820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0163"
FT                   /product="transporter, CPA2 family (2.A.37)"
FT                   /note="2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39168"
FT                   /db_xref="GOA:Q1IVD2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD2"
FT                   /protein_id="ABF39168.1"
FT                   /translation="MSTAEFGSLTLLLFVVIASAQLLGYLFQRMRQPKVIGEILAGVLL
FT                   GPSLLGHFAPRISQAIFAGSGPVGQKYELILSFLYNLGLLLLMFCSGAEVKGLFKKRDR
FT                   REVTWLASVGTAVPFLLVIAAYKFIPLEKLATPNAPRMSVLLIVGIAASVTSIPVISRI
FT                   LHDLKILHTRFASLILGVAVIEDIVLWAVLAVATALISTNGVQTGHVLRHVIAALVYFG
FT                   IGMTIAPVLLRWITRARWNILVHASPVGYVTVVLLAYSAIAAAFDVSLVFAAFLAGYGL
FT                   IGELETLAPAVESLKTFSFATFIPIYFAIVGYRLDLSKTFSFSMLAIFMGLACLLKLLS
FT                   AGLGARLARFNWYDSLNLAIATNARGGPGIVLASVAYDAGIINAAFYTTLVLTAILTSQ
FT                   AAGAWLEYILRSGKPLLTASVEELPVKVADPEQLAA"
FT   sig_peptide     complement(175758..175820)
FT                   /locus_tag="Acid345_0163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.955) with cleavage site probability 0.747 at
FT                   residue 21"
FT   gene            175993..177801
FT                   /locus_tag="Acid345_0164"
FT   CDS_pept        175993..177801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39169"
FT                   /db_xref="GOA:Q1IVD1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVD1"
FT                   /protein_id="ABF39169.1"
FT                   /translation="MALPVLSRRSFLSSASLAAASLPFLRSSAFAISSVPLDEFGYGDV
FT                   SLESELHNRQFQNTHDVLMGLEDDALLKPFRAMVGQPPPGRDLGGWYCFDPNYNPNDVG
FT                   VGFAPTATFGQWISALSRSYALRPDPAVRDKVIRLNRLYAQTISPEFYGLKNRFPAYCY
FT                   DKLVCGLIDAHQYVGDPDALKILERTTDTATPLLPGHAVEHGTVWRSVKDDGYTWDESY
FT                   TISENLFLAYRRGAGDRYRALGKQYLDDTYYNPLAEGRSDLEGRHAYSHVNSLCSAMQA
FT                   YLTLGDEKYFRAAKNGFDFVLAQSYATGGWGADETLRAPNSPEVAKSLTGTHHSFETPC
FT                   GSYAHFKLTRYLLRVTRDSRYGDSMERVMYNTILGALPLMPDGRTFYYSDYNFKGSKFY
FT                   HDARWPCCSGTMPQIATDYGISTYLRDPQGIYVNLYIPSTVRWQQDGAQVSLTQKTAYP
FT                   FDPVVEIELSTTKQREFEVHLRIPAWAEQASIEVNGKREGVPVAERFATIRRTWKNGDR
FT                   IQLELPLKNRLEPLNRERAKLVALLNGPLVLFPIGEKAQQLTQGQLLAAKRAGSAWRAE
FT                   STGGPVKLLPWTEIQDQPYSTYVQLA"
FT   sig_peptide     175993..176088
FT                   /locus_tag="Acid345_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.773 at
FT                   residue 32"
FT   gene            177876..178064
FT                   /locus_tag="Acid345_0165"
FT   CDS_pept        177876..178064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0165"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39170"
FT                   /db_xref="GOA:Q1IVD0"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVD0"
FT                   /protein_id="ABF39170.1"
FT                   /translation="MAQVCDMCGKGPQFGNNISHAHNVTKRRWNVNLRPVRAKVNGATK
FT                   RMRVCTTCLRSGKLVKA"
FT   gene            178254..179798
FT                   /locus_tag="Acid345_0166"
FT   CDS_pept        178254..179798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0166"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39171"
FT                   /db_xref="GOA:Q1IVC9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC9"
FT                   /protein_id="ABF39171.1"
FT                   /translation="MATITHPYALSNPMSLLTDKPREEFTRADLLDVIEQKEIERITFH
FT                   YTALDGKYKELKVPVANRRQAERILADGERVDGSSLFRDMVDVNLSDLYVVPVYKSAFL
FT                   NPFGEPSLELTCRYLNVRGEMVDFAPDAILHNAAELFRRSTGCELWALGELEFFLLSDA
FT                   GPSLFRLPMQRGYHASGPFVKSGAVLDEIVRLLTQITGAVKYAHNEVGCIDAVRSDLEE
FT                   IRGKSAEQLEVEFLPAPVEDAGDFLVLARWLIRNVAYRHNCVATFTPKIEEGVAGNGLH
FT                   VHMEVRRDGRNIMRDRGELSAEARQVIGGLCTYADSLTAFGNTVSSAYLRLVPNQEAPT
FT                   RVCWSDLNRSTMIRVPLGWSEVGDLSRRINSQQLEESVNEDGRQTVELRSPDGSAFAHL
FT                   LLAGITMAAEWGMTHEQSLQIAADLYTKGNIFHDETVLSRLRSLPRSCVESARILSEKR
FT                   DFYERDGIFPASMIEYMAKLLRAEDDEGMNRKLIDLPADDRLHETRKIMHKDLHRH"
FT   gene            complement(179814..180728)
FT                   /locus_tag="Acid345_0167"
FT   CDS_pept        complement(179814..180728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0167"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39172"
FT                   /db_xref="GOA:Q1IVC8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC8"
FT                   /protein_id="ABF39172.1"
FT                   /translation="MLRSILTALLLVAASIFCAGQPALPASFVAKTIHSPAGAEIYVRS
FT                   GGKGPAVVLLHGYAENSDSWAPLAENLMKDHTVIVPDLRGIGKSSIPAGGYDKKTQAAD
FT                   VRAVVTGLGFDKTVVVSHDIGIMVAYAYAATYPDKVERLVVMDAPIPGLGPWTEILQMP
FT                   GVWHFNFHGPDAERLVQGRERIYFDRIWNDFTGDPGKPDNATRDFFTASYTRPGGMRAG
FT                   FAQFAAFGQDAKDNREFAKTKLTMRVLAVGGEKSMGTLEGAIMRDAAVNVQEAVIAGSG
FT                   HWLMEERPAETVALIRTFLDQGH"
FT   sig_peptide     complement(180666..180728)
FT                   /locus_tag="Acid345_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.912 at
FT                   residue 21"
FT   gene            180874..181548
FT                   /locus_tag="Acid345_0168"
FT   CDS_pept        180874..181548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0168"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39173"
FT                   /db_xref="GOA:Q1IVC7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC7"
FT                   /protein_id="ABF39173.1"
FT                   /translation="MFKEHLSKGKASRAQIYETAIRLFRERGFEETTMRDIGAELGGAA
FT                   SAAYYYFKGKDAIVLEYYDEIQRKHEVLVNEMMAHEKDPAKRIAQIHHLKLDILKSDRR
FT                   IMGALLRYAGEPESELSFFSAKTRGLRQAAMKLFAEAIADADLPPDMAQVLPTMLWASH
FT                   MGILLYFLYDKSAEQKNTRMLVDRGTQLLMGFIKVAKNPLLRPIRRKTLEFVQEAGLAP
FT                   SA"
FT   gene            complement(181667..182140)
FT                   /locus_tag="Acid345_0169"
FT   CDS_pept        complement(181667..182140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39174"
FT                   /db_xref="GOA:Q1IVC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC6"
FT                   /protein_id="ABF39174.1"
FT                   /translation="MRLRTLIALVAASLCYIAFTVYVSSGPRPLPPPARWVNWLVFPIT
FT                   ALIAGYSFLHCEEFASHGRRSTSTLDLKLLAFLCLFSTTLSILGLAATLLFPLALVMLP
FT                   AFIASLLLLVRPNLLRNAPVFRKYLRITAVSSLVFVCCSLLALGVQAIRGGGL"
FT   sig_peptide     complement(182069..182140)
FT                   /locus_tag="Acid345_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.553 at
FT                   residue 24"
FT   gene            complement(182209..182592)
FT                   /locus_tag="Acid345_0170"
FT   CDS_pept        complement(182209..182592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39175"
FT                   /db_xref="GOA:Q1IVC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC5"
FT                   /protein_id="ABF39175.1"
FT                   /translation="MLVVVLAIVIIVVGVFALLPGYLIVIARRKVTRMEPWDVPRLHQY
FT                   SLSLQILCYGSFVYLALSQIAQSFNLVTSEPLGVPIPLALGLACIANIAMAARSGPLRD
FT                   LLITNGLLIVVNVWLLLAVTSTW"
FT   gene            complement(182597..183025)
FT                   /locus_tag="Acid345_0171"
FT   CDS_pept        complement(182597..183025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39176"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC4"
FT                   /protein_id="ABF39176.1"
FT                   /translation="MRFLYVFYDATCGLCTRLRSWCERQPAYVELRFVAAGSPDAHRLL
FT                   PADLAKVSREDLIVLSSEGGVYQGEGAWLMCLWALRGYRQLSIRLSDPRLAPKVREAFQ
FT                   IFSGSRHALSRWLGLSTDSLQKELQWTFTPRCEPRWLE"
FT   gene            complement(183038..183436)
FT                   /locus_tag="Acid345_0172"
FT   CDS_pept        complement(183038..183436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0172"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39177"
FT                   /db_xref="GOA:Q1IVC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC3"
FT                   /protein_id="ABF39177.1"
FT                   /translation="MYIVTAYLLYLIVSVALTVWVAQTLHKNGLIFLVDSFLGNRELAN
FT                   SVNHLLVVGFYLINLGYVLMALATPVRPTSVQAVIELLSTKLGVVMLVLGAMHFTNIVI
FT                   FSKMRKRAMLRYEPPPVAPQQFVRPPAA"
FT   gene            complement(183523..184266)
FT                   /locus_tag="Acid345_0173"
FT   CDS_pept        complement(183523..184266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39178"
FT                   /db_xref="GOA:Q1IVC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC2"
FT                   /protein_id="ABF39178.1"
FT                   /translation="MNHHVLASVSIAGTTLDLLGGMYLAYDLLGGQHGPLRLLTRIVTY
FT                   SVIFGIFYGLGLGLIFGIAAGVTTGITISFELNRAATGKPHYPVWGEALCSLIRGAGFA
FT                   IGLYKQDGLLFAAAFAVLTTVGQIFAYSRGMRPAIDYSPQLRPRLTRRQFLGTVNRVFG
FT                   WLIAALICSFVSHRVEGAWLFALRVGLTTGVATGAVIMFGPIVEYYADHLPERRMGVFG
FT                   ICLILSGFALQSLQYWVALLDVKVS"
FT   gene            complement(184276..184653)
FT                   /locus_tag="Acid345_0174"
FT   CDS_pept        complement(184276..184653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0174"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39179"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC1"
FT                   /protein_id="ABF39179.1"
FT                   /translation="MRDVIVTNQGPKAIGPYSQGIRANGFIYLSGQIPLDPATQQLVEG
FT                   DIHAQTDRVLRNIQGMLEASGSSVAKVVKTTVFLKNMSEFTAMNEVYGMYFRDNPPARS
FT                   TVEVARLPKDVLVEIEVIALA"
FT   gene            complement(184763..186985)
FT                   /locus_tag="Acid345_0175"
FT   CDS_pept        complement(184763..186985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0175"
FT                   /product="(p)ppGpp synthetase I (GTP pyrophosphokinase),
FT                   SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39180"
FT                   /db_xref="GOA:Q1IVC0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVC0"
FT                   /protein_id="ABF39180.1"
FT                   /translation="MATLRQQIATNVLSATRYRDLLNIVRQNRPKDDIEIVKKAFEFSQ
FT                   KHHAGQTRASGEPYLVHPLEVGIILADMRLDTTAIAAGLLHDSVEDTSVTIEEIQEQFG
FT                   EQVAHIVEGVTKISRIDFASREEAQAENVRKMVLAMVDDIRVVLIKLADRLHNMRTLQH
FT                   LSQERQEKIARETLEIYAPIAHRLGMGRVRGELEDLAFPYVDPIGYKRVEEAVESRRKK
FT                   GEEFLEQVKGVITAKLKENSIDARVDSRIKRLYSINQKLIRQRIDVEQVYDMYALRIIT
FT                   KSVVDCYSILGIIHNLWRPVPGRIKDFIAMPRPNFYQSLHTTVIAENGNPFEVQIRTEE
FT                   MHKLAEEGIAAHWKYKDGPISAKDEQRLAWLRQVVEWQRDVQDPGEFLSSLKIDLYPEE
FT                   VYTFSPKGKIVILPRDATPLDFAYTIHTEVGHTCVGAKVNGRIVPLRYKLRSGDIVEIL
FT                   TQPGHTPSRDWLTIVKSPRSRQKIKHWLNVHQRERAIEIGRKLIEKEARKYRIPLKEIA
FT                   DEHLAKIANEYGLGKADELLAGIGYGKFSARSILAKLAPAINPEAPAPSEDEPKSGGFT
FT                   SVVRRVFGGSDGSALKVTGHDDLLVYRAKCCNPIRGEEIVGYVTRGKGVAVHSRNCPNV
FT                   HNLLYEPERRIAVEWAREAHRGSGEAGYPVKITVFCDDRPGMLKQITSIISDANTNIRN
FT                   IEAHTGDAHATIDVIIDIEDLKHLERMITGIRKIPGVRDVQRVQKL"
FT   gene            complement(187077..188129)
FT                   /locus_tag="Acid345_0176"
FT   CDS_pept        complement(187077..188129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0176"
FT                   /product="Fe-S protein, radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39181"
FT                   /db_xref="GOA:Q1IVB9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB9"
FT                   /protein_id="ABF39181.1"
FT                   /translation="MQIQPILQTWGRVLTGRVPNLSIEITRECPLRCPGCYAYEDNHLG
FT                   GDTNLRSLTDYKGDDLVRRVLSLVDEHKPLHLSIVGGDPLVRYRELEIVLPQLAERGIH
FT                   VQVVTSAFRPIPTQWATLPRLRMTVSIDGLQPEHDLRRKPATYERVLRNIEGQHVAVHC
FT                   TITGAMVRRAEYLRGFLDFWSENPNAEKIWFSIFTPQIGADSVECITADERTRVIQTLL
FT                   DLRESYPKLDMPEGMLKAFLAPPHSPEKCVFARTTRTISADFKTHVEPCQLGGAPDCSR
FT                   CGCIASMGLSAIGNHKLLGPLTAGSIFFASASIGDAFKRSRNRKLPEHPSPKTDTELIT
FT                   IDQNPKREVA"
FT   gene            188252..189043
FT                   /locus_tag="Acid345_0177"
FT   CDS_pept        188252..189043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0177"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39182"
FT                   /db_xref="GOA:Q1IVB8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB8"
FT                   /protein_id="ABF39182.1"
FT                   /translation="MRYCRFVHRGQPKYGLIETENTRDYIIRAIATMPQDYNTFAGAEP
FT                   LHVLLEEAELLASVVPTKIVCVGRNYKAHAEELGHEIPKYPLIFSKPTSAIIAPGADIK
FT                   RPAKLSQRVDYEGELGVIIGRECRHIPEDHDVRSYIHGYTVVNDVTARDLQNKDGQWTR
FT                   AKGFDTFCPVGPIVNDALDPWTGVEVETRVNGAVRQHGNTSSFIFPLDVILRFISEVMT
FT                   LFPGDLIATGTPEGVGPIIAGDVVEVSVAGIGTLRNPVADE"
FT   gene            complement(189110..190375)
FT                   /locus_tag="Acid345_0178"
FT   CDS_pept        complement(189110..190375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0178"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39183"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB7"
FT                   /protein_id="ABF39183.1"
FT                   /translation="MSTHRLVRLLVLALMLMSIPALSFGGVFVSVSVGPPPIPVYTQPL
FT                   CPGAGYMWTPGYWAWGDEGYYWVPGTWVMAPTPGFLWTPGYWGWGGGAYLWHGGYWGPH
FT                   VGFYGGINYGFGYGGVGYGGGYWHGNNFYYNRSVNNVNVTNVTNVYNKTVIVNNNNHVS
FT                   YNGGHGGVTRQPTSQERQWQNEKHVDATSAQQQHFQEAGRNPQLLAKNNGGKPAIAATA
FT                   RPADFKSAVPAKAVGGPINKTALTATPKNMPAPKSNAAATANGNVNANAKGNANIPKPG
FT                   NASASTNSKVGTNASANTTAHNVPKPPAASSNTRDVNTAHTNTTASPSTSTHNVPKPPS
FT                   TNATSTNRSNASVNSPKTYSSQPNTASHQSQPAPHYSAPATHNPPPQTHAAPQVQHNAA
FT                   PAQHSAPPQHSAPATHDNKPKR"
FT   sig_peptide     complement(190304..190375)
FT                   /locus_tag="Acid345_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.498 at
FT                   residue 24"
FT   gene            190599..191093
FT                   /locus_tag="Acid345_0179"
FT   CDS_pept        190599..191093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39184"
FT                   /db_xref="GOA:Q1IVB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB6"
FT                   /protein_id="ABF39184.1"
FT                   /translation="MEVLRIHHLRDFSEKSQISSALFGGYYGQRTTPFVMHHLRYYSIA
FT                   LCGLSAAVVGFAWLSRSKLQKPDHEKERRTRLSRTGRLTIGTAMDVQDLEDESQHLTQL
FT                   LIYRYDVAGVAYEASQDITHLRQFIDVHSCRLGLPASVKYDPHNPGNSIVISETWSGLR
FT                   K"
FT   gene            191168..191890
FT                   /locus_tag="Acid345_0180"
FT   CDS_pept        191168..191890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0180"
FT                   /product="cytochrome c biogenesis protein, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39185"
FT                   /db_xref="GOA:Q1IVB5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB5"
FT                   /protein_id="ABF39185.1"
FT                   /translation="MSSLPLPIAVFLAGLLSFLSPCVLPLVPGYVSLISGASVEDLQSG
FT                   DRKLSRTVLLNSIMFIVGFSVVFIALGAVATGIGQFMNIYRRQLMQVAGVVIIIFGLHL
FT                   IGVFKIKALLADKRLHDMKGSGTAIGAFLIGFAFAFGWTPCIGPILAGVLAIAGSQDTV
FT                   VKGVLLLAVYSSGLAVPFLLTSLFVGGFLAFYTKFRRHLHAVEVVSGVFLVVVGALILT
FT                   RHFTILSSYLSFLNRFSL"
FT   gene            191899..192450
FT                   /locus_tag="Acid345_0181"
FT   CDS_pept        191899..192450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0181"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39186"
FT                   /db_xref="GOA:Q1IVB4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB4"
FT                   /protein_id="ABF39186.1"
FT                   /translation="MKNNIAILGFAVLVIAAMLFVGSNIARKKQAEAARSGSLVVGQVV
FT                   GKPAPDFTLQTLDGKKVTLSDLRGKAVVLNFWATWCPPCKVELPWFVDFQKQYGPQGLQ
FT                   IVGISEDEGGKEKVAAFVKEMGVNYTIAVDDDTVSRKYGDVEDLPTTFYIDRNGKIVQF
FT                   AMGLADRSEIEEKIKSALAQ"
FT   sig_peptide     191899..191985
FT                   /locus_tag="Acid345_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.994) with cleavage site probability 0.332 at
FT                   residue 29"
FT   gene            192462..193007
FT                   /locus_tag="Acid345_0182"
FT   CDS_pept        192462..193007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39187"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB3"
FT                   /protein_id="ABF39187.1"
FT                   /translation="MRMQHWIFTTIALSLPLAVAAQSEFSSPKPSVEIVKVESAPLIKG
FT                   KSANVTLNFRVASGYHINSNKPNSELLIPTVLKLSPPTDLSIGNIQYPGGEQLSFAFAP
FT                   DEKLSVYTGDFSVQATARSIGAIHAGNYRVHGELKFQACDNSACYPPKSIPVNFDVQVE
FT                   NAPKPGHKNPAQSPNVHN"
FT   sig_peptide     192462..192527
FT                   /locus_tag="Acid345_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.996) with cleavage site probability 0.653 at
FT                   residue 22"
FT   gene            complement(193056..193436)
FT                   /locus_tag="Acid345_0183"
FT   CDS_pept        complement(193056..193436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB2"
FT                   /protein_id="ABF39188.1"
FT                   /translation="MGRAIGFIAVILIAAFGMYYYISASKAVSPANGVPQATVDTTGVE
FT                   QDLLQIANAERRHWATNNKYASLDDLISSGELQMARTTRGPYSYSVDATASSFVARARA
FT                   SNPPQGAPANLSVDESMRVRHD"
FT   sig_peptide     complement(193353..193436)
FT                   /locus_tag="Acid345_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.767) with cleavage site probability 0.690 at
FT                   residue 28"
FT   gene            complement(193501..194943)
FT                   /locus_tag="Acid345_0184"
FT   CDS_pept        complement(193501..194943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0184"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39189"
FT                   /db_xref="GOA:Q1IVB1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVB1"
FT                   /protein_id="ABF39189.1"
FT                   /translation="MSSQVSSPVRVRFAPSPTGYLHVGGARTALFNWLYARHVGGTLVL
FT                   RIEDTDLERSTPEMVEGILVGMRWLGLNWDEGPYYQTQRMDLYKAAAEKLVASGHAYYC
FT                   FCSKEGLEQRRKAATAAGRAPQYDESCRKIGREDAAARKQGGAPCAVRFAVPETGNTKF
FT                   QDAVFGEVEFANPELEDFVLLRSDGVPTYHLSVVVDDVDMKISHILRGADHISNTPKQV
FT                   LLYQAMGATLPIFAHVPLILGPDKTRLSKRHGATSVISYSDEGIVPEAFRNFLALLGWT
FT                   APEGSPEKLGDEELIKLFSLEGISHSNAVFDRPKLDWFNTEYIRAYPAEKLLPLIQKEW
FT                   QKVGLTPANPDAQHLVATIELLKPRARNLKDFAGSFKAFFTDDYANDPEAVEKFLKDPA
FT                   VREMLVELGERYANAGEFTEQSTEQVLRDLAAEKGVKAGGLINGARVALTGQAVAPSLF
FT                   AVMVNLGREKTVSRLRRAKEIQ"
FT   gene            195158..198535
FT                   /locus_tag="Acid345_0185"
FT   CDS_pept        195158..198535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0185"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39190"
FT                   /db_xref="GOA:Q1IVB0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVB0"
FT                   /protein_id="ABF39190.1"
FT                   /translation="MEPLLAGTVFVPGLVALAFLLVFAYLQRQSSERYFHSWQWFWFAN
FT                   TAYYALVAVADTHPKIPAYASLAHTAEICGAVALFVSARSFAKTEPPAWTKYLVLCALI
FT                   YWTALHAIPPLRVMVRPYLHAWIAVLVVLLLATMEYARVAYQRDSAGLRWMTASTALWI
FT                   VMQAGKEIPPSLLVGRYLHRGSEYLEIMPLLLLGTAMVVVLFDDERRAIQENALAFSSL
FT                   DIDPTTPVTREQIQPSIESLLTRFMSLLRLEQAVLYVSEPWRGSVPSVARGFSPDFITR
FT                   LEVQNAGDYLADIAFRRGGILSIHSLKELQGPMRSAAHPGLTSLVNTLKEENISRFSAV
FT                   CLQTRERNMGVVIFPHGKRHAFSASRLRLLLSVSMQMGMTLENYLLVHDAHRRTKEFEL
FT                   LTQIGQVISSRLDPDEVLAAVHRELGRLFDTSNFYVAFLEGLELRYEFETVGAIRQPRR
FT                   SRRSKNGLSDFVIRTGQPILIRSDMKRVSQRLGIEPSSHPAKCFIGVPIRIGAVSVGVV
FT                   AALNFDREFVYEQRDVEVLATAAGQVAVAIENARMFAHEQRRARYLSFLNNVSQTAISS
FT                   QNAEEMLSEIVGQIQKNFNYDHIGIGILDYATKEIEIKAEAGTTAHAKGKRVALGVGVL
FT                   GRVARTGDTSLVQDTAATHLAGILPDSRSALCIPITYAEQLLGVLNIESRRENAFTEED
FT                   TLLLRTLADLLATALHNAFVFQKMQQQSITDALTGSKTRRYFLEALQSEWKRASRSTRP
FT                   FSVVMIDLDKFKQVNDTMGHLEGDLVLARIARLLEQKCRQSNVVARFGGDEFVILMPET
FT                   GVDQAQILAERLRLWIATDPMLSEHQITGSFGVATYPIHGSSVEDIMRVADAGMYVSKH
FT                   AGGNKVATADEFIDGQNTSVQRQLISAYVEGFLQREHYGPEYTSELVSALKKFSENEAE
FT                   GKREVMMDAILALNRASESRELFASGHGEQVARTAEIIARELGIGGQDIQDLIFAARIH
FT                   DVGKIVVPEKILNKPAMLTEDEHYLVAMHANVGAEIIDAIPDAQHIRQMVRHHHEAFDG
FT                   SGYPDGLKGEQIPLYARIISVAEAYVSMMVDRSYRAARSQADAVRELESRSGSQFDGML
FT                   VRILIRQFKAERAAQGND"
FT   sig_peptide     195158..195232
FT                   /locus_tag="Acid345_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.680) with cleavage site probability 0.605 at
FT                   residue 25"
FT   gene            198539..198898
FT                   /locus_tag="Acid345_0186"
FT   CDS_pept        198539..198898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0186"
FT                   /product="zinc finger, RanBP2-type"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39191"
FT                   /db_xref="GOA:Q1IVA9"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA9"
FT                   /protein_id="ABF39191.1"
FT                   /translation="MFELIGLAIAVSAIVALARGRGASTVLFGVISVVGWVVIRYGALF
FT                   VVRSEDGVLLAMIGAWAWLGAIALYLRFVVGAKMPKPDGKWNCSSCNYLNERSSVICEA
FT                   CQTPYQPKASAADAG"
FT   sig_peptide     198539..198610
FT                   /locus_tag="Acid345_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.824) with cleavage site probability 0.446 at
FT                   residue 24"
FT   gene            complement(198895..199362)
FT                   /locus_tag="Acid345_0187"
FT   CDS_pept        complement(198895..199362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0187"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39192"
FT                   /db_xref="GOA:Q1IVA8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IVA8"
FT                   /protein_id="ABF39192.1"
FT                   /translation="MIRVGLGFDSHEFREGIPLRIGGLTIPHTHGLSGHSDGDVLLHAI
FT                   TDALLGAVAAGDIGAFFPPSDPKWKGANSVVFIEEAMRHIETAGYRVGNVDCSLVLNAP
FT                   KIGPHAKAIQESVAKLLKIEPTAVGIKAKTPEGLNLDGTALAHVVVLLEKR"
FT   gene            complement(199359..200096)
FT                   /locus_tag="Acid345_0188"
FT   CDS_pept        complement(199359..200096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0188"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39193"
FT                   /db_xref="GOA:Q1IVA7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA7"
FT                   /protein_id="ABF39193.1"
FT                   /translation="MSKVIVIIPAAGLGTRMARGKAGVTSKQFFELNGTPILIHTLRKF
FT                   VECKQVSEIWVALRKNEMAGFRKHLEQAGIKKEIKLVEGGEHRQDSVANALNAIEASAD
FT                   DIVLVHDAVRPFVSPETITAVIAAVEKHGAAIAGTPAIDTVKQVERTSEGAVITSTILR
FT                   ERVVLAQTPQGFRFGTLKKAFDEAIREGFSGTDEASLIERNGGAVQVVMGSANNIKITT
FT                   PADLELAEFFMSQEDSRKANLAG"
FT   gene            complement(200211..201365)
FT                   /locus_tag="Acid345_0189"
FT   CDS_pept        complement(200211..201365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0189"
FT                   /product="PilT protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39194"
FT                   /db_xref="GOA:Q1IVA6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA6"
FT                   /protein_id="ABF39194.1"
FT                   /translation="MDLAIIRLVFVVLSALACFELKPFGLMGYEAAGVGVLIGIAVVVF
FT                   EMRLRNASLKRLIGAVIGSILGICGAYLFSLVIRDAIKEGPTQHFLELFVMLLMAYVGL
FT                   VIGAGKGDLLNLAALGGIFGGEKQSKRSYKILDTSVIIDGRIADIAETGFLDGTIVIPQ
FT                   FVLRELQLVADSADSLKRNRGRRGLDILQRVQKLTNLHVQIVEDDFPAVREVDLKLIEL
FT                   AKVYEGKIVTNDFNLNKVAQLQGVEVLNINELANSLKPIVLPGELMRVFILKEGKEYNQ
FT                   GVAYLDDGTMVVVDNARKMIGKTIEISVTSVLQTTAGKMIFGKFDERASGTMPRAEQRP
FT                   ERQDLRKSNPQPSFPAANGTTSTPPSSPGIPAASSPGTGGTGTE"
FT   gene            complement(201908..204076)
FT                   /locus_tag="Acid345_0190"
FT   CDS_pept        complement(201908..204076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39195"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA5"
FT                   /protein_id="ABF39195.1"
FT                   /translation="MRRFAYVLSLLLLLGSQIFAQQTKQPTTTGVVPRLIRFSGVAEVA
FT                   AGTTGITFSLHRGPRDSEVLWSETQNVKVDANGKFSVLLGATKLDGVPVDLFTSGEAQW
FT                   LAVRVEGQAEQPRVLLVSVPYALKAAEAETLAGHAVSEFVTNEKLTAFQQTMQTVTGEA
FT                   EKKKSVGPIRNAIAGSPTNFTGTTTDQIVGVTQSGTGAGVSSNATTGYALYGKSSGTAV
FT                   YGLSTATSTTGFGVYGATTSTSGYGMFGANNATTGVAVGVRGTSLSNSGIAVYGTANTA
FT                   TGTATGVKGITQSPDGYGVFGQNTAATGNGIGVRALSASTGGIALLANETGSTGNTVGL
FT                   QVSSASPSGTTALLQSTNTAGKLISGRSGAGNSEVFSLSGAGTATFTGVGAPAIIGDVG
FT                   CFAPSAGVSFVAAPACTNYALLQQNTDLFLNRPLTGEIHFRQGNVEQMTLDAAGDLFAG
FT                   GGKFVAYADGTVLFGGGQISNATLSANGIGAIPGGTFTAGYTPSTIGNYGLITAGGAAD
FT                   PGLLGGPGLLALPGNYGMSGQGLAGEFLGDVKIHGTVSAPAHSFTIDNPLDPAGKFLRH
FT                   ASVESSEMKNMYDGTVTTDEQGQAVVRLPEWFEALNGDFRYQLTVIGEFAQAIVAKKIA
FT                   NHQFTIRTDKPNVEVSWMVTGVRHDAYAVAHPLAVEEEKATNEKGYFLYPELFGAPREK
FT                   NVEFVHSPELLKQMQKHENPSRDSTGGK"
FT   sig_peptide     complement(204014..204076)
FT                   /locus_tag="Acid345_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.990 at
FT                   residue 21"
FT   gene            complement(204127..206316)
FT                   /locus_tag="Acid345_0191"
FT   CDS_pept        complement(204127..206316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA4"
FT                   /protein_id="ABF39196.1"
FT                   /translation="MRKYLYLVVAVLVSFSFTFAQQTKETNAVAVPRLIRFAGQLQGPE
FT                   RTVGISFTLHKGQKEAATLWTETQNVKLDAEGRYSVLLGSTKADGLPVELFASGEAQWL
FT                   GVRVEGQAEQPRVLLVSVPYALKAAEAETLAGHSVSEFVTNEKLAAMQQGLQPASGGTE
FT                   KKSSGVTRNAISGSPTNFTGTTTDQIVGVTQGGTGAGISSNTASGYALYGKSSGTAIYG
FT                   LSTATSAAGIGVYGATTSSAGYGLFGANNATTGTAVGVRGTSLSNGGIAVYGTANTATG
FT                   TATGVKGITQSPSGYGVVGQNTATTGNAMGIRALSASASGYALVANETAPSGSTTGLLS
FT                   TISSPGGTALVVQDTTGAAKLISGQSGAGNTEVFAVDTYGHVHATASFNADYAVTAFEM
FT                   NTGYLLANTSVASYSSAVTGYAGTGGGGGGEFYGAITPAFYGVQGYSGHGALSDLANSG
FT                   YSGLSASGGVFSGPNGVIAITSTKDGTGGYAVTGIGADSNGVGVTGINLGATGFAVYGS
FT                   DKVNASGSYAGFFSGKVYASGTFTHAGPAFQIVDHPADPANKTLTHASVESSEMKNIYD
FT                   GVVTTDASGEADVVLPSYMEAYNHEFRYQLTAIGQFAQAIVSREIQNSRFTIKTDKPLV
FT                   KVSWQVTGVRNDAYAKAHPLEVESEKPESQRGRYFHPVENGAAAELTIGDARMRENLAE
FT                   AKAEREKHPRAPVDNAQASVRSRRDTHLQVAAQKQ"
FT   sig_peptide     complement(206254..206316)
FT                   /locus_tag="Acid345_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.931 at
FT                   residue 21"
FT   gene            206478..207449
FT                   /locus_tag="Acid345_0192"
FT   CDS_pept        206478..207449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0192"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39197"
FT                   /db_xref="GOA:Q1IVA3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA3"
FT                   /protein_id="ABF39197.1"
FT                   /translation="MKALLVEQLGKLESLALRDVPDPQVKPDRVVVNIEAAGVNFADIS
FT                   SSMGKYPGVKVPYIAGREFAGTVEGTGERVMGYTQMGAFAEKIAIPRAFIWPQPQGWTS
FT                   VESAAFPVNFFTAYLVYWKAGLTADAFEPAAPSKSPRRALIHAVAGGVGTAAVQIGKLL
FT                   GIETIGTSSSDEKLEKAKALGLTHGINYSHDDYQQRVMELTNGEGVDCVFEMLGGEHTK
FT                   RSTRCTREFGRVILYGTATGERPEFDTLTMYSKSISVHGLWLSTLANNREVIAAAWIAL
FT                   KPWVEAGQLKPEVGHVMPMANASEAYKLMLNRKNYGKIILTV"
FT   gene            207446..208006
FT                   /locus_tag="Acid345_0193"
FT   CDS_pept        207446..208006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39198"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA2"
FT                   /protein_id="ABF39198.1"
FT                   /translation="MNRSDRMRKSLFVAAIFCLFACVALGEKPPSADKMMSEAKARAKA
FT                   ENKSIFLVFGASWCPDCDVLETFLKTPDAKALFDRYFVVVHFDVFEEAGEKPGVNTPGG
FT                   ENWILKFGGVSAAGEVGLPFEVVLNADGKPIVDSHLRTKGKTVGFPETPEEIAWFIKML
FT                   RSGAPAMTSDESSQIEDLLKRQS"
FT   sig_peptide     207446..207526
FT                   /locus_tag="Acid345_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.984 at
FT                   residue 27"
FT   gene            complement(207990..208445)
FT                   /locus_tag="Acid345_0194"
FT   CDS_pept        complement(207990..208445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0194"
FT                   /product="Mov34/MPN/PAD-1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39199"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA1"
FT                   /protein_id="ABF39199.1"
FT                   /translation="MVVIEQRELDRLKVLGESAYPEEACAILIGKREGEVTWVTRALPA
FT                   INVHEEPAHAYEISPQALIAAQRKAREDGQEIVGFVHSHPDEAAKPSSRDLEEAFWLGL
FT                   TYGMMSVYAGTFTALNFYRLEGESPEGRRFRQVGVRVAPMRNASSDV"
FT   gene            208638..209096
FT                   /locus_tag="Acid345_0195"
FT   CDS_pept        208638..209096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39200"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IVA0"
FT                   /protein_id="ABF39200.1"
FT                   /translation="MAKKLKIKPYADAVSFFRDHGFDILEAPGTSNRIFLKKYNVSAAI
FT                   EQAPDGSAKIFAFPGYLIGGEISKLVDKGYQKFLKTSKLEVPATADHLTAMHQFSEELK
FT                   EGIGATSLYNESMGTVSEAYVYDRVKDRDKPDAARPQRPWEGGSKKPA"
FT   gene            complement(209176..210240)
FT                   /locus_tag="Acid345_0196"
FT   CDS_pept        complement(209176..210240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0196"
FT                   /product="Fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39201"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV99"
FT                   /protein_id="ABF39201.1"
FT                   /translation="MVLCYFSMLRHFIAVTGVLALAAIMTSCGQPGAPQPPSLEMPRAV
FT                   TDLSVTRKGDRVAMRWTSPARFTDGRIIKKVGKTNICRTPGNLPAVKCDEIGNVPTELP
FT                   KASGPIEQSHFEDKLTQVTLGTVMYGVEVQNAYGKSVGLSNQVEISTAPALAAPSRVNA
FT                   TVGENGVTILWAPIAAPALPEVRFGYQISRRGESGQFAAIATVPIGDTSYVDQTFEWEK
FT                   KFEYRIDVVTESASDNRVLVEGEDSETASVLAHDVFPPAVPKELQAVFSGPGQKVFIDL
FT                   TWAPNLEPDLAGYFVYRREEGGTFTKLNSAALTVPSFRDDQVQAGKTYIYSVSAVDVRG
FT                   NESAKSAETSESVP"
FT   sig_peptide     complement(210151..210240)
FT                   /locus_tag="Acid345_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.861) with cleavage site probability 0.848 at
FT                   residue 30"
FT   gene            210378..212216
FT                   /locus_tag="Acid345_0197"
FT   CDS_pept        210378..212216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39202"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV98"
FT                   /protein_id="ABF39202.1"
FT                   /translation="MLSPLRTLELLLIAALFSCASFAATPTSGSVTPTTGSKTAWTSSA
FT                   FGATNGESTCVEGTTCDSFTLTITGAASSYNNKYVNISIAWSLSTNDYDLYIHKGSLTG
FT                   PVVASSTGGVPQTGEGVSLSPTSLGVGVYVVHVVASTTVPGDSPKGTAVVATAPITPPP
FT                   PNVTPPTYRNYQSPTGIGDNSGEPSIGDNWNTGRVMTSAVLDTLRVSFNTAVSPATATW
FT                   VVKNSPLTSITSLDPILFTDRKTGRTFVSQLAGTTSLSEFTDDDGTTYTPSQGAGIASG
FT                   VDHQTIGGGPFRVCNAQQKSQNPTYCATLTARGPLTSYANAVYYASQDIGLAQMALSQD
FT                   GGLTYEAAHPMYTLAQCGGLHGHIRVAGDGTVYVPNKNCGGTQGLVSSKDNGLTFTVYK
FT                   VTGSTPGSSDPSVGIGSKGRVYFGYTDANNHPWIATSDDGGQSWHNNQDLATRLGIKNA
FT                   VFPEVVAGDNDRATFFFLGTKSAGPGTGDDTTTIFDGVWHAYFASTYNGGQNWVVVDAT
FT                   PSDPVQLGVVCTNGTTCPSGTRNLLDFNDVTIDWHGRVLAAYTDGCITAKCIADGNNST
FT                   AQHTKAQNDGTTKASIIREATGLSLFQKYDSTPLKP"
FT   sig_peptide     210378..210449
FT                   /locus_tag="Acid345_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.941 at
FT                   residue 24"
FT   gene            212259..212681
FT                   /locus_tag="Acid345_0198"
FT   CDS_pept        212259..212681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39203"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV97"
FT                   /protein_id="ABF39203.1"
FT                   /translation="MFQRLTALLVLATACALAQQPSLVKVSLGQTRSTVHAQLKDQATF
FT                   DREEEGQEIWKSNSGPIQHVIIGYDAEGEVRYITAVGSDISCDALGTSPQQTGHAPDLT
FT                   FQRPEKSYLVIAHGPARDHLTSCSLKNPNAQLSDPD"
FT   sig_peptide     212259..212315
FT                   /locus_tag="Acid345_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.965 at
FT                   residue 19"
FT   gene            212812..213228
FT                   /locus_tag="Acid345_0199"
FT   CDS_pept        212812..213228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0199"
FT                   /product="DGPFAETKE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39204"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV96"
FT                   /protein_id="ABF39204.1"
FT                   /translation="MRFMMLMIPGGYEKAAPDTTPPADAVEKMMKYNRDLQEAGVLIAL
FT                   DGLHPLSSGARVSFAKGKPIVTDGPHVETKEVLGGYWMINVKSKEEAIEWAKKCPASAN
FT                   ETIEIRRVFEMDDFPQDVKDAAGNYEDLQEKLKH"
FT   gene            213300..214415
FT                   /locus_tag="Acid345_0200"
FT   CDS_pept        213300..214415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39205"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV95"
FT                   /protein_id="ABF39205.1"
FT                   /translation="MSSVRLLVGTKKGAFVLTSDGKREKWDVAGPHFSGWEMYHLKGSP
FT                   ADPNRIYASQTSGWFGQQVQRSDDGGKTWNPVGNKFIYDGVPGTHQWYDGTPHPWDFKR
FT                   VWHFEPSLTDPDTVYAGVEDAAIFKTNDAGQTWTELPGLRNHSTGNKWTPGAGGMGLHT
FT                   IILDPTNDKRIWIAISAAGAFRTDDGGATWKPINKGLTSKYIPDPDAEIGHCIHHMAMH
FT                   PKKPGTLFMQKHWDVLRSDNSGDLWTRVSGNLPTDFGFVIDVNANEPETIYVVPIKSDE
FT                   HHYPMDGALKVYRSKSGGNEWEPLTKGLPQQNCYVNVLRDAMSVDQLDKCGIYFGTTGG
FT                   QVYASNNAGDSWQAIVHDLPAVYSVEAQTLP"
FT   gene            214412..214711
FT                   /locus_tag="Acid345_0201"
FT   CDS_pept        214412..214711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39206"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV94"
FT                   /protein_id="ABF39206.1"
FT                   /translation="MIRVTLPGHLRNLAKITDSEVALDLQGPVTQHAILSALEARYPVL
FT                   GGAIRDHGTLKRRPFIRYFACGEDLSHDPADAPLPDEIASGKEPFMVIGAIAGG"
FT   gene            214827..215210
FT                   /locus_tag="Acid345_0202"
FT   CDS_pept        214827..215210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV93"
FT                   /protein_id="ABF39207.1"
FT                   /translation="MLKLSEMHDGYFDGAWNSGYGETHLFLRSNSGFRGTVVLRGVAAA
FT                   NVESFRQGNVIFDIETIPTEQLTSSNISDSYGLASDEESRCEKLLALAKSEGLSILNVN
FT                   PSYGAQCTFLYRSAEILDGHVTN"
FT   gene            215221..216348
FT                   /locus_tag="Acid345_0203"
FT   CDS_pept        215221..216348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0203"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39208"
FT                   /db_xref="GOA:Q1IV92"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV92"
FT                   /protein_id="ABF39208.1"
FT                   /translation="MTLSQPELLRYSRHLSLPEFGLEAQERLKQTKVLCIGTGGLGSPL
FT                   AMYLAAAGVGTLGLVDFDIVDYTNLQRQIIHTTPDVGRPKVESAAEKIDVLNPFVNVVP
FT                   INAKLTSANALELFSQYDIIADGTDNFATRYLVNDACVLTGRPNVYASVFRFEGQASVF
FT                   ATKSGPCYRCLYPEPPPPGTVPSCAEGGVLGVLPGLLGIIQATEVIKVACGIGQPLIGR
FT                   MLLVDASTMKFQELRLKRDYQCPACGTRTLKELIDYDQFCGIRGQESSVAGDITVEELK
FT                   RRLDAGEKPFILDVREPHEYQIANLGGHLIPLNDLPKRIGELDPTQEIITHCKMGGRSQ
FT                   QAVDFLRQQGFKNAKNLTGGINAWSEKVDPKIPKY"
FT   gene            complement(216440..217801)
FT                   /locus_tag="Acid345_0204"
FT   CDS_pept        complement(216440..217801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0204"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39209"
FT                   /db_xref="GOA:Q1IV91"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV91"
FT                   /protein_id="ABF39209.1"
FT                   /translation="MDTIAVTYVHWLVAASIATSVVASYAAFSFAERVAASDRQRSLGW
FT                   LIAGAFAMGLGIWSMHYLGMLAVQLPVPVVYHVPTVIISLLLAVAASAAVLWVVSRESL
FT                   SGRAIVLGSVAMGGGIGAMHYTGMAAMRSYAMHRYNPSLVLLSLVIAVAFSWMALRITF
FT                   LLRREPGAHELRRMGGAVLMGIGIASMHYTAMFAVTFERGNTEFSTVHTVPVTHIDQLG
FT                   IVVMAGMVLFGALISAYFDRQMSRDLRVSNERLAEMQVALLQREKELKEAVAKLEELST
FT                   RDGLTGLYNRRFFDTTLTAECKRAARANYPISLLIIDVDCFKALNDHYGHLVGDDCLQK
FT                   VGKSLASAVRRTSDVVARYGGEEFALILPNTSEESATTIGENIRRAVLGLEIANANSTA
FT                   GPFVTLSVGVCTRRPSHPRSSEDILVTTNEIIRAADEALYRAKREGRNRVLLGA"
FT   sig_peptide     complement(217706..217801)
FT                   /locus_tag="Acid345_0204"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.702) with cleavage site probability 0.510 at
FT                   residue 32"
FT   gene            218085..218645
FT                   /locus_tag="Acid345_0205"
FT   CDS_pept        218085..218645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0205"
FT                   /product="protein of unknown function DUF882"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39210"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV90"
FT                   /protein_id="ABF39210.1"
FT                   /translation="MSLLKHFISQSRKSLFALPLLIILLCAGTANGAPVNGMKEYRLRL
FT                   FHTHTGERIDIVYRRGDQYLPEALDQLDHYLRDHRTGTVHHYDPRVFDLLHDLTADLGE
FT                   PDTEVNVICGYRTPWSNEYLRTHGHGVASHSLHMQALAIDIRIPGVKTSDLRDAALAMH
FT                   RGGVGYYSSSDFVHVDVGRERRW"
FT   sig_peptide     218085..218183
FT                   /locus_tag="Acid345_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(218675..220552)
FT                   /locus_tag="Acid345_0206"
FT   CDS_pept        complement(218675..220552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0206"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39211"
FT                   /db_xref="GOA:Q1IV89"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV89"
FT                   /protein_id="ABF39211.1"
FT                   /translation="MSRDSRSIISHVLGTAQHARARTSKANIVYVDCLLATDSQRKLAA
FT                   KRTDDTAMMNLGFARCAFVRGCTFGLCVVGILATSACATGKALLPGGETFQAATSGPTV
FT                   ADSSLREIVAAGQLSDLRWPDFSDYRAYVQTFYESSGYNLAWTRGGQTTPQALAIIEIL
FT                   KQADGKGLNAEDYDASRWADRTKQLSQPAAAARFDTALTVCVMRYISDLHIGRVNPTHV
FT                   KFALTGRSAKYDLPQFLTQRLVNGQNVEAELAAVQPQFAGYKATQAWLQRYIELARQDN
FT                   GEQLPVPTKALDPGKPYAGIPRLTSLLHLLGDLPADAVVPAGDVYQAPLVDAVKRYQSR
FT                   HGLTADGRLGAQTVKELNTPLSTRVEQLRLTLERWRWLPQEFPQPPVVVNIPEFRLRAY
FT                   DANHKVVLSMNVVVGKALRHETPVFDDEMKYVVFRPYWNVPPSIQRSEIVPAIQRDRDY
FT                   ISKKNYEVTTQAGQVVTSGTISDEVLQQLRAGKLAVRQKPGPTNALGLVKLIFPNQYNV
FT                   YLHSTPSQQLFSQARRDFSHGCIRVEKPAELSAWALQDKPEWTVERVRAAMQKGPDNVQ
FT                   VNLSKPVPVLILYGTAVAEEDGSVHFFDDLYGYDADLEKALARGYPYPL"
FT   gene            complement(220569..221549)
FT                   /locus_tag="Acid345_0207"
FT   CDS_pept        complement(220569..221549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39212"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV88"
FT                   /protein_id="ABF39212.1"
FT                   /translation="MSRAQFHWPTLPCTVAGVSRVLVLVFALLVTRGAHAQDLTPRAYL
FT                   ITPLHGNAITMSYSYFNGALDFNNVVPITDGSGEFSVPSVAYYHSFNFFGRSANFLAAL
FT                   PYGVGNFEGLVLGRQRNGYRSGLLDSVYRVSVNLKGGPAMELPEFMKWKQKTLLGVSLK
FT                   VVAPTGQYNPDLLINWGTNRWAFKPEFGYSRRFSEKWVLDAYAGAWFFTDNSQFFSVTP
FT                   PPAVQSLSPIGSFEGHLSRNFTRNPLLWASLDGNFWFGGQASNNNVPVNGTRQTASRIG
FT                   GTGSFPLTKSQSIKVSFNSGAYVRFGGNYKNLSVGWQYAWFGHPK"
FT   sig_peptide     complement(221439..221549)
FT                   /locus_tag="Acid345_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.997 at
FT                   residue 37"
FT   gene            complement(222050..222988)
FT                   /locus_tag="Acid345_0208"
FT   CDS_pept        complement(222050..222988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39213"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV87"
FT                   /protein_id="ABF39213.1"
FT                   /translation="MNRISKLLIVVTIFLVSTISLLAGTRDSGDWTMRKSDVAGKVEFS
FT                   LMQSSKGHHSQNSSDWPIATFQGLDLNTAARHDVKFTIARDAGTFECDGFLKDGEGAGI
FT                   FHFTANANYAQQMSQLGFRGIDEDKQYEMAVMDVSTAFAKEMQGLSLRALDTDKLIEFR
FT                   IFGVDSKFVHEMRDAGLPANESSRLVEFRIHGVTPEFAKVIKARGYQADEAKLVELRIH
FT                   GATPEFMDQMANAGYSNLPLEKLVEFRIFNVTPDFISQIEKLGYKHPSPERLVELRIHG
FT                   VTPDYIAGMQQRGLKDLSLEKLVEMKIHGIN"
FT   sig_peptide     complement(222917..222988)
FT                   /locus_tag="Acid345_0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.844 at
FT                   residue 24"
FT   gene            complement(223016..224998)
FT                   /locus_tag="Acid345_0209"
FT   CDS_pept        complement(223016..224998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0209"
FT                   /product="peptidase M56, BlaR1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39214"
FT                   /db_xref="GOA:Q1IV86"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV86"
FT                   /protein_id="ABF39214.1"
FT                   /translation="MTLHLSPEIIRMTGWALLHFLWQGAIVAALLSMTLAFCHQASMRY
FT                   AAAVMALIVMVALPFGTYYFLQQRADEAMAFDLAADTSAQTPVVSTLGPVNGHHHSSPV
FT                   SNDTQPELMLWLVRLWLVGVVVFSLRSAGGFLLVQRLRSVAKTPVQDDLLELCTAVQER
FT                   MGISRAVKFCRSAALQVPAVVGGIRPIVLLPVSALTGLTDSQIEAIVAHELAHVRRLDY
FT                   FVNLFQVFAETVLFYHPAVWWVNKRIRTERENCCDDTAISVCGNRLEYVHALTHLESVR
FT                   LTPQFAMGADGSPLKARVRRLLGMSEEREGIRTGSSVLGVLVVAGLVLAASSIATGAKA
FT                   QAANTTQTQEALVVSTPQEPIELNVDAEPVVVNVNPVSSLPRLADGTMISPMDVHVPAI
FT                   TVNVPPVNVQLPQMAHFAVPAMNVAVPAVHVAVPAISVHVPAIGAMPMLWQANGETRSN
FT                   VPAQSYIDSMKAAGYDNLDVDQLVAMKIQGITPEYVREMKAAGMKMDADDLIGLKIQGV
FT                   TPDYVKQMRAAYPGIDNDTIIGFKIQGVTTQYAGEMSKLGVKADPDDLLAMKIQGVSPE
FT                   YVRGMQATGLRFDSDALVGMKIQGVTPEYVNAMKNAGFKDLDADEVIGAKIQGVTPEFI
FT                   EKAKSHGFKDLDLDKLIQLKNAGVL"
FT   gene            complement(224995..225384)
FT                   /locus_tag="Acid345_0210"
FT   CDS_pept        complement(224995..225384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0210"
FT                   /product="transcriptional repressor, CopY family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39215"
FT                   /db_xref="GOA:Q1IV85"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV85"
FT                   /protein_id="ABF39215.1"
FT                   /translation="MKRETLKAPTQSELEILHVLWERGPSTVKDVHETLGASKPVGYTT
FT                   VLKLLQIMTVKGTVTRNEHDRAHIYEAVLPAERTKRQLAGDMLQKVFGGSASELVLHAL
FT                   SGRKASHEEIEEIRRLLDEYERKLP"
FT   gene            complement(225488..226195)
FT                   /locus_tag="Acid345_0211"
FT   CDS_pept        complement(225488..226195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0211"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39216"
FT                   /db_xref="GOA:Q1IV84"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV84"
FT                   /protein_id="ABF39216.1"
FT                   /translation="MRFDGKTALVAGGTGGLGKAVSLALMAEGARVVVTYIIPEEFNAL
FT                   RTAAADRQIEGHHIDVTDETATQNLVADIIGKYGRLDFLINTIGGYAGGIKLWELETKT
FT                   FEKMFTLNLRAGYSLARAVIPAMLKQKSGAIVNIAAKAAVDHAGGASAYASSKAAALAM
FT                   MDSLAEDLRGTGVRVNSILPSIIDTAANRHAMPGADYSKWPKPEDIAKVILFLLSDDGK
FT                   VIHGAAVPVYGAL"
FT   gene            complement(226249..226325)
FT                   /locus_tag="Acid345_R0001"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(226249..226325)
FT                   /locus_tag="Acid345_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(226406..227824)
FT                   /locus_tag="Acid345_0212"
FT   CDS_pept        complement(226406..227824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0212"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39217"
FT                   /db_xref="GOA:Q1IV83"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV83"
FT                   /protein_id="ABF39217.1"
FT                   /translation="MAIYLPATTDDEQVMLDELTPREIVAELDKYVVGQHEAKRAVAIA
FT                   LRNRMRRQRLTPDLAEEIIPKNIIMIGPTGVGKTEIARRLAKLANSPFLKVEASKFTEV
FT                   GYVGRDVESMIRDLVEIAIDMIREEKLDDVADKAEMNAEERLLDLLLPSSPQPAAAHEA
FT                   GAGFTQGQLELPGDGGGSRTREKLRQQLREGKLDERTVELDVREKNFPAFEIISNQGVE
FT                   EMDINMKDMLPNIFGSRTKKRKMKVNEAFDYLIQEEEQRLIDMEQVQRVAVERVEQSGI
FT                   IFLDEIDKIAGREGGHGPDVSREGVQRDILPIVEGTTCNTRYGMVRTDHILFIAAGAFH
FT                   VSKPSDLIPELQGRFPIRVELQSLSVADFIKILTEPKSSLVKQYTALLETEGVKLEFTR
FT                   DALDEVANFAAIVNEGTENIGARRLHTIMEKVLDEISFSAPDLENKNVTVDAEYVRNAL
FT                   VHIVKNQDLSRYIL"
FT   gene            complement(227914..228336)
FT                   /locus_tag="Acid345_0213"
FT   CDS_pept        complement(227914..228336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39218"
FT                   /db_xref="InterPro:IPR021412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV82"
FT                   /protein_id="ABF39218.1"
FT                   /translation="MAGYSGTPLVQKLGIKPGHRIATVSEPPSFDKALGALPEGAAFVG
FT                   STAKNVDVVVAFETDAKQFQKHLPGLASRIKQDGMIWIAWPKKASGVQTDLTEDPIRNF
FT                   ALKLGLVDIKVCAIDETWSGLKLVIRKENRAKAAKK"
FT   gene            complement(228355..228897)
FT                   /locus_tag="Acid345_0214"
FT   CDS_pept        complement(228355..228897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0214"
FT                   /product="ATP dependent peptidase CodWX, CodW component"
FT                   /note="Threonine peptidase; MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39219"
FT                   /db_xref="GOA:Q1IV81"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV81"
FT                   /protein_id="ABF39219.1"
FT                   /translation="MSSKRLVRSTTVLCVRRDGKVVMAADGQVTLGEGVIKHNARKLRR
FT                   LYQDKIIAGFAGSTADAFSLFGRFESKLEQYHGNLSRAAVELGKDWRTDKMLRQLEALL
FT                   LVADKDQTFLISGQGDVIEPDTGIAAIGSGGSYATAAATALLEHSTLDARQIAEEAMKI
FT                   AGKICIYTNDRVTIEEL"
FT   gene            229083..229337
FT                   /locus_tag="Acid345_0215"
FT   CDS_pept        229083..229337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39220"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV80"
FT                   /protein_id="ABF39220.1"
FT                   /translation="MQLYVYIRHVMLNLNGHIFKMRLAPRMKRPPKTCGFLWAKQAHIQ
FT                   LSVVVFVFVSAYGPPTRSNSKRESWNCTRSNAEFLNRIA"
FT   gene            complement(229556..230107)
FT                   /locus_tag="Acid345_0216"
FT   CDS_pept        complement(229556..230107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0216"
FT                   /product="single-stranded nucleic acid binding R3H"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39221"
FT                   /db_xref="GOA:Q1IV79"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV79"
FT                   /protein_id="ABF39221.1"
FT                   /translation="MPIDDKVAAAKKVSELLNTVIREGNLHLKYRITVDPPQPHKEFTA
FT                   PEILVELSGPDSSLLLERNAELLRSLEFVCIEMLRLAPDEHDQLQFDSMGYRATRLDEL
FT                   KMAAQHAAAKVRDSGMPYSFAPMSSRERRIVHIALRSETDLRTESAGEAAGRHVVLYPK
FT                   DYKGAAPVERRPSFGRRGRR"
FT   gene            complement(230198..231949)
FT                   /locus_tag="Acid345_0217"
FT   CDS_pept        complement(230198..231949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0217"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39222"
FT                   /db_xref="GOA:Q1IV78"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV78"
FT                   /protein_id="ABF39222.1"
FT                   /translation="MAEIKNPQQEPGSERKLLLIFALTFIMIVIGQTVFFKNIPKKQDD
FT                   KNQKSAPVAAQTSQPAASAPAVATPAVAKQAQAETETVVENAVSRIVFTNRGAQVKSWV
FT                   LKNYKDDHGNPLELVNREAAKQFGYPLSFFTYDQGLTTKLNDAMYVASATGRIEVPGEL
FT                   TFEFSDGDLSAKKTLRFTNGYVVGVETSVTRGGSNVTALPAWPSGFGDDVQPTSYALQA
FT                   IAYENSGEVERQTGKKIVGGATLRGPFNWAGAQDQYFAALFLPDNPPAASMVTLHNTLK
FT                   IPADLDKPDPNKTQPVDVIGSAVGDLSGPTVTRLFVGPKALHILESVKSNAAPGQPNGP
FT                   DLSKVVDFGKYLGFIAKPLFLWLRWTHDHWVPNWGWSIIILTVIINLVLLPLRLSSMKS
FT                   ALKMQKIQPQMKAIQEKYKKYKMNDPKRADMNTEMAALYKQHSVNPVGGCLPLVIQMPF
FT                   LIAFYGMLAVAIELRQANWFWLHDLSGPDHLYIIPVLIVASTILMQRMTPQAGIDPAQQ
FT                   KMMTIMMPAFLGWISLRYASGLGLYWIVGNIIGFAQQFIMNKTELGREIAAVRAKQANK
FT                   RRLKGKE"
FT   gene            complement(231964..232230)
FT                   /locus_tag="Acid345_0218"
FT   CDS_pept        complement(231964..232230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0218"
FT                   /product="protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39223"
FT                   /db_xref="GOA:Q1IV77"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV77"
FT                   /protein_id="ABF39223.1"
FT                   /translation="MKAVLVQMLKGYKRWISPLLPVSCRYVPTCSEYAMEAISIHGAVR
FT                   GSVLALGRLLRCHPFVRGGYDPVPRSHSCCDDKISTTAHDAVR"
FT   gene            complement(232227..232691)
FT                   /locus_tag="Acid345_0219"
FT   CDS_pept        complement(232227..232691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0219"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39224"
FT                   /db_xref="GOA:Q1IV76"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV76"
FT                   /protein_id="ABF39224.1"
FT                   /translation="MTLRENAVSGGVSAKIPKASRLLRHADFRLVYEQGRRHFSANFTA
FT                   FYRANITEKSPRIGYTVSRALGGAVDRNRMKRRLREATRACWAGFRPTFAVDVVVNPKK
FT                   TVLATDFAVLTAEMQKALTVIEKAANSGQANPRPVENVSRHKPRARKEQR"
FT   gene            complement(232746..232901)
FT                   /locus_tag="Acid345_0220"
FT   CDS_pept        complement(232746..232901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0220"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39225"
FT                   /db_xref="GOA:Q1IV75"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV75"
FT                   /protein_id="ABF39225.1"
FT                   /translation="MPKRTFQPNRRRRSKTHGFRTRMKTKSGAAVLSRRRAKGRKRVSV
FT                   SAGYRD"
FT   gene            233067..233465
FT                   /locus_tag="Acid345_0221"
FT   CDS_pept        233067..233465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39226"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV74"
FT                   /protein_id="ABF39226.1"
FT                   /translation="MQLTVSRQTYTPRSTCGTLSIDGEFQCFTLEPHADQSQGKPFSIP
FT                   EGTYQVTLEFSPKFKCDTPHVQHVPGFEAIEIHYGNFPKDTEGCCLVGTTHAPDFVGNS
FT                   RAAFAELMAKLKAAGTPLSVTYEKAAVP"
FT   gene            233584..234033
FT                   /locus_tag="Acid345_0222"
FT   CDS_pept        233584..234033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39227"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV73"
FT                   /protein_id="ABF39227.1"
FT                   /translation="MGYAVVVDIEKGHSLAAAVEAIARKHEQAWNSHDRRAYEEMFTEE
FT                   ADFVNVIAQHARGRDHIGRDFEQIHRTFMRNSVLKTERPEVRPLTDDSAIAHIRWEMTG
FT                   MEKLPGWNIPDVRRGVLLYVLVKRDGEWKVTAFQNTEEIAVKVPE"
FT   gene            complement(234034..235695)
FT                   /locus_tag="Acid345_0223"
FT   CDS_pept        complement(234034..235695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0223"
FT                   /product="sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39228"
FT                   /db_xref="GOA:Q1IV72"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV72"
FT                   /protein_id="ABF39228.1"
FT                   /translation="MHEWLPKSVLALRDYSRQRFVADLLAGITVGLVALPLAMAFAIAS
FT                   GVPPQSGLYCAIVAGFLVSACGGSLTQIGGPTGAFVVVVYNIVAKHGIDGLFMCTLEAG
FT                   VILVLLGITGLGSAVKFIPRPVVVGFTNGIAVIIASTQIKDFFGLKIEKVPGDFLDRME
FT                   VLGKNFRTLSVEETCIGLLALAIIIAFMRYVKRVPGYIVALVAGTAAVLLLHLDVQTIG
FT                   TRFGGIPSGLPKLEIPQFHANLLRPLISPALTVAMLGAIESLMSAVVSDRLSGDKHNPN
FT                   VELVGQGIANIFSPLFGGLPATGAIARTATNIRSGATSPVAGMIHSATLLAIVVFAAPA
FT                   AKFIPLAVLSAILFVVAYNMGEWREIPQILKLSKLEIGTWLASFLLTVFADLTTAVEAG
FT                   MIMAVLVFIRRVSLTTTVSMVTEEYVKAGHAHILQNKDIPGYVAIFRIHGPFLFGTTEK
FT                   MEEITSRIDELPPVVIVRLRNMTAIDATGIQALETAIEAIRRTGRKVLLCGARRQPKEL
FT                   IEQSGLGAHVGEENMLNSISDALERAKALQTSVVHA"
FT   gene            complement(235827..238550)
FT                   /locus_tag="Acid345_0224"
FT   CDS_pept        complement(235827..238550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0224"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39229"
FT                   /db_xref="GOA:Q1IV71"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV71"
FT                   /protein_id="ABF39229.1"
FT                   /translation="MNSFDSRAVLRVDGREYEIYRLDALDKQGFNVARLPFSLRILLEN
FT                   LLRREDGRNVKADEIRALAGWDPKAVPAQEIAFMPSRVLLQDFTGVPAVVDLAAMREAM
FT                   KALGGDATKINPLQPAELVIDHSVQVDEFGSAKAFDLNAELEFIRNKERYAFLRWGQTA
FT                   FKNFAIVPPDTGIVHQVNVEYLARVVFVAQQGSNGSSKAVAYPDTLVGTDSHTTMVNGL
FT                   GVLGWGVGGIEAEAAMLGQPVSMLIPQVVGVRLTGKLPEGATATDLVLTLTEMLRRHGV
FT                   VGKFVEYFGSGLRHLPLADRTTIANMAPEYGATCGIFPVDDETLRYLRLSGRSEEHIKL
FT                   VEAYCKEQGLFHTHDTPEAEYSEVLDLHLATVEPSVAGPKRPQDRVVLGHVGESFEKAL
FT                   PTLVKPGTKLEDNFKHNATPKGGETVAEGVNHGAVVIAAITSCTNTSNPSVMIGAGLVA
FT                   KKAVEKGLKTPAWVKTSLAPGSKVVTDYYIKSGLLTYLEQLGFNVVGYGCTTCIGNSGP
FT                   LPEEVSKHVGEKDLVVASVLSGNRNFEGRINSEVRANYLMSPPLVVAFALAGRIDFDPT
FT                   KDAIGIGNDGNEVFLKDIWPTSQEVDDVVNSCIEGSMFRKSYGDVFKGDQRWQGLNVPT
FT                   GETFAWEDTSTYVKNPPYFEGMTLTPKAVEEIKGARVLAVLGHSITTDHISPAGSIKKD
FT                   GPAGKYLTEHGVKIADFNSFGSRRGNHEVMMRGTFANTRLRNKMVPGTEGGYTKHLPSG
FT                   EQMSIFDASEKYRAEGVPTVILAGKEYGSGSSRDWAAKGPRLLGVRAVIAESFERIHRS
FT                   NLVGMGIIPLQFLEGEDVEKHGLTGDETIEIRGLNEALDNFAPGKTVEVLATHNNGKTE
FT                   TFRATLRIDTPQEVQYFRHGGILHYVVRQLAGAAKN"
FT   gene            complement(238863..240200)
FT                   /locus_tag="Acid345_0225"
FT   CDS_pept        complement(238863..240200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0225"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39230"
FT                   /db_xref="GOA:Q1IV70"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV70"
FT                   /protein_id="ABF39230.1"
FT                   /translation="MPNGTNPEAVGRFDRRHPSDRPPDNRLPAQRDRDRILFTSAFRRL
FT                   AGITQVVGSEEGHIFHNRLTHSLEVAQVGRRLAEKFLAADNSLSVRLDADVVEAACLAH
FT                   DLGHPPFGHVSEVLLDKLSTQQNLPDGFEGNAQSFRIITKLAFRSSNMEGLNLTRATLN
FT                   AVLKYPWARGNSGKKNRKWGAYEAELVDFKFARQLQNANDDEQALEASIMDWSDDITYS
FT                   VHDLEDFYRARLVPLHLLVTDAGERQRFYDGARKRLQRDELLPDQAFAELQEAFDKLAI
FT                   TIPLDVEYRATQKQRSALRSFTAGLINRYVSNSTVGVDGKKAFLSVPPGFRKEVKMLKQ
FT                   LTWHYVIENPALATQQYGQKRIVEDLFNIFHEEAKSLNAPHIFPTSDRENIEAIHMSSQ
FT                   SGTEKERSLVRAVVDLLSGMTERHAIEMHRRLTGASLGSALDFIAR"
FT   gene            complement(240500..241024)
FT                   /locus_tag="Acid345_0226"
FT   CDS_pept        complement(240500..241024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0226"
FT                   /product="protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39231"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV69"
FT                   /protein_id="ABF39231.1"
FT                   /translation="MRPPEIEQRVEQLLRKYNINDGPVPVERIAEAEGLPIIETAYAGE
FT                   VSGALIRSNGMTGIAVNSAHPQTRRRFTVAHELAHFALNHEGEYIDSRFTVIRRDGRSS
FT                   DATDKKEIEANAFAANLLMPTEFLYRDLKPSYRGEAHLSDNDLKMLARKYRVSPLAMQY
FT                   RLVNLGLLSPE"
FT   gene            complement(241021..241380)
FT                   /locus_tag="Acid345_0227"
FT   CDS_pept        complement(241021..241380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0227"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39232"
FT                   /db_xref="GOA:Q1IV68"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV68"
FT                   /protein_id="ABF39232.1"
FT                   /translation="MFCTENCTRCCANPVQIDPAIVNTLFGHRLGSARRARRISQTELG
FT                   RRIGVSRVTIANIERGGQNVQIAQAFVLAKALDIHPMELIPTEHDVEEAHQPTNEDRFV
FT                   RLAKIQLAEIVKGAE"
FT   gene            241631..241999
FT                   /locus_tag="Acid345_0228"
FT   CDS_pept        241631..241999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39233"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV67"
FT                   /protein_id="ABF39233.1"
FT                   /translation="MIRTQFNQEVPVMARFRITCTIHSEDHERIAEVGCDDGSRFTESE
FT                   AIARIENQGDEFVVDRPQGHTAKVIVEKTKEGRKFLKTEADGEKPNNLLSLPTCKKHVE
FT                   TPPPPRVVVPARSHGVRW"
FT   gene            241993..242841
FT                   /locus_tag="Acid345_0229"
FT   CDS_pept        241993..242841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39234"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV66"
FT                   /protein_id="ABF39234.1"
FT                   /translation="MVSTATWISTAPDLQYFYPDFTPAEVPSGTSARRAWIGRIQPFTD
FT                   DASARLAWRRMQRDLAISIDRGTILPPQSARKLDPHPLESLAVNTEMSFEVLLLEFDNP
FT                   QHPWVYCVAPEVSRDVFPALLHIREDRSIWFRGRYIPGLCVYSASIFKFESWPSKSVQV
FT                   LDQTATYLGKLVIWLRTRRLFHLNSGVVLYTPAPGEQVRDTEPRINRNFPGIAKQLLPI
FT                   TRAWRGVWPGGVAPFGPAGHFQTIAPQEECWCGSGETYGNCHRRQEASVLGNTGDGTSP
FT                   N"
FT   gene            complement(243224..244504)
FT                   /locus_tag="Acid345_0230"
FT   CDS_pept        complement(243224..244504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0230"
FT                   /product="NRAMP family Mn2+/Fe2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39235"
FT                   /db_xref="GOA:Q1IV65"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV65"
FT                   /protein_id="ABF39235.1"
FT                   /translation="MPEVHSSLPIPSGPSFLRKLVAFAGPGFLVAVGYMDPGNWATDLA
FT                   AGSQFNYALLSVVLISSLMAILLQSLSLKLGIVVERDLAQACRDAYSKPVSIGLWVLAE
FT                   IGIAACDLAEVIGSAIALQLLFHIPLTIGVCITAGDVLLMLLLQQRGFRYIEAIVVTLI
FT                   ATISICFGLEILYSRPELWPMLAGFLPHQELVTNHAMLYIAVGILGATVMPHNLYLHSA
FT                   IVQTRQYERTPEGKREAIKYCNIDSAIALSFAFLVNAAILIMAASVFYRSGHREVAEIS
FT                   DAYRLLSPLLGVTGASVIFAIALLASGQNSTLTGTLAGQIVMEGFLSIRLKPWLRRLVT
FT                   RLIAIIPAVIISFFYGASGTAKLLIFSQVVLSMQLSFAVFPLVAFTSSKEKMGEFANGA
FT                   LLKLVAWTVAIVIAGLNIWLLVEAVRG"
FT   gene            244702..245979
FT                   /locus_tag="Acid345_0231"
FT   CDS_pept        244702..245979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0231"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39236"
FT                   /db_xref="GOA:Q1IV64"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV64"
FT                   /protein_id="ABF39236.1"
FT                   /translation="MKVLVIGGGGREHALVWKLRQSPRVSKLYCVPGNGGIGDEAECLP
FT                   GDVKSVDAMLEIANRIRPDLTVVGPEIPLTNGLVDEFQKREYPVFGPTKAAAELEGSKS
FT                   FAKLFMQRHRIPTGHYAVVTDKVELQKALAHLHAPVVVKADGLAAGKGVVIAKTKDEAF
FT                   LVAMEMLSGKMLGDAGRRVVLEEFLQGEELSFLVMSDGERGVPLVAAQDHKRVGDNDTG
FT                   PNTGGMGAYSTDKIVDPQMREWLLKNVARPVIHGMAEEGSPFKGILYCGLMMTAKGPMV
FT                   LEFNARFGDPETQAILMRLDSDLVDAFEASVKGRISEGDFKWSSDAAVTVVMASQGYPG
FT                   SYEAGKKIHGLAEAATVPGVKVFHAGTTKRDGEYYTAGGRVLNVTAKGVTLGDAVNSAY
FT                   DAIMKIRFDGMIYRKDIAARGLKAAK"
FT   gene            246094..247134
FT                   /locus_tag="Acid345_0232"
FT   CDS_pept        246094..247134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0232"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39237"
FT                   /db_xref="GOA:Q1IV63"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV63"
FT                   /protein_id="ABF39237.1"
FT                   /translation="MSKPIRVAVIGAGAFGKNHARVYSELHRETQAGTLPQGTPGVELV
FT                   GIVDSDTARAAQIAATHETRAYASIRELLAHGGADAVSIAVPTKFHRNVAREALEAGFD
FT                   VLIEKPLAATLEEADEIIDLAAEHRRIAQVGHLERFNPAVRATIPLITKPMFFEIHRLS
FT                   LFGPRALDVDVVLDLMIHDIDIILSFVAGEVVEVRAVGLPVLSQKVDIASVRLQFANGC
FT                   IANLTASRVSTERVRKLRFFQPNQYVSIDYARQDVLVFTVNKMAQHTPNDGGLPQMPDV
FT                   MPSKPPVVPEEPLRSEILSFLQAVQTRETPVVSLEDGRRALAVALEIQKAIEEHAERAH
FT                   LDALTK"
FT   gene            247167..247634
FT                   /locus_tag="Acid345_0233"
FT   CDS_pept        247167..247634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39238"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV62"
FT                   /protein_id="ABF39238.1"
FT                   /translation="MNRILAAMLVVFAVCAPVLSQSSPSVVIADIAAKIKSKDVVQIEV
FT                   LYMDPNILTLVRVTPEDLKKRFEYKVLLTSASGRSLPESLMKSLENTRVTESKGGADVR
FT                   WGVIFERRDGSPVGEIYFDKWGKRGAVNGSTVSFENVELFKWLSERGHWMR"
FT   sig_peptide     247167..247229
FT                   /locus_tag="Acid345_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.854 at
FT                   residue 21"
FT   gene            247639..248199
FT                   /locus_tag="Acid345_0234"
FT   CDS_pept        247639..248199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39239"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV61"
FT                   /protein_id="ABF39239.1"
FT                   /translation="MTKLVIICRWLSLFQVAALLCALSFAQQPSVRKNTPSGQSTPEGV
FT                   AADYARAFIADDVSLMQQVLIRPYMGGATHDEYLRWKEGLLEHLRQEKASSAPDPQNPV
FT                   KIVRVFTSRHLSKNGPASTGYALSGFQDVMFVDVEVLLHSGEKHTERTLVIKDQDGKWY
FT                   VHPRPDLAPLLSAGLEEESPSQK"
FT   sig_peptide     247639..247719
FT                   /locus_tag="Acid345_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            complement(248259..249053)
FT                   /locus_tag="Acid345_0235"
FT   CDS_pept        complement(248259..249053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0235"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39240"
FT                   /db_xref="GOA:Q1IV60"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV60"
FT                   /protein_id="ABF39240.1"
FT                   /translation="MSTAAMANIHPTAVIDPSAKIPASCKIGPYCVVGPNVEMGEECEL
FT                   VAHVVLQGPTKLGSHNKIYPFAAIGIGPQDLTYSGQPTRLEIGDHNQIREYVTIHRGTV
FT                   KGGGLTTVGNHTLIMAYAHVAHDCHIGDHVILANAATLGGHVTVEEWASISALCPIHQF
FT                   VTIGKHSYVGGGTTITQDVLPFSKTSASREVHAYGVNAVGLQRRGFSDERIKRIQRFFR
FT                   VLLKSKLNTSQALEKLKSEGDLGEDVAMLIAFVEKSERGVLK"
FT   gene            complement(249050..249550)
FT                   /locus_tag="Acid345_0236"
FT   CDS_pept        complement(249050..249550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0236"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39241"
FT                   /db_xref="GOA:Q1IV59"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV59"
FT                   /protein_id="ABF39241.1"
FT                   /translation="MTDGRLITGEMAEAKQVLDVTDIQKILPHRYPLLLLDRIIEFKRK
FT                   ERIVAIKNVTINEQFFQGHFPGYPIMPGVLIVEAIAQAGGALLLTEIPDQNEKLMVFAG
FT                   IEKAKFRKPVVPGDQVRLEVDVIVWRNTAAKLMGKAFVGDKLACEATVSCQIVPRPAKP
FT                   ENS"
FT   gene            249625..250791
FT                   /locus_tag="Acid345_0237"
FT   CDS_pept        249625..250791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0237"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39242"
FT                   /db_xref="GOA:Q1IV58"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV58"
FT                   /protein_id="ABF39242.1"
FT                   /translation="MPQRPSSDPRTSHRDLFAHLKDQQSAMQSMLRRIVEHESPSDDKP
FT                   SCDAMAEMLAQDFGAIGGRTKLHRDKITGNHLQVDFGGPRGAKPVLIVGHYDTVYPLGT
FT                   LKQMPYRESKGRISGPGVLDMKGGIVQIHGAIAALQTQGGLPRPVTIILVSDEETGSES
FT                   SRSITEKLAKQSAAAFVCEPAAGTDGALKTARKGVGDYLLRITGVASHSGLDFEKGQSA
FT                   VLELARQIEKIAGFTDLKRGTTVNPGVIRGGTRSNVIAASAEAEIDVRVSTKRDVERVS
FT                   KLFARLKPINRRCSLALSGGVNRPPMERTPGTAALFAQAQLIAAELSFSLAERMVGGGS
FT                   DGNFTGAIVPTLDGLGAVGDGAHAVHEYIFATEMPKRAALLAGLIRAL"
FT   gene            250898..251080
FT                   /locus_tag="Acid345_0238"
FT   CDS_pept        250898..251080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0238"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39243"
FT                   /db_xref="GOA:Q1IV57"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV57"
FT                   /protein_id="ABF39243.1"
FT                   /translation="MFGGKLGMPELLLILGIALLIWGPSKLADLGKGMGEGIRNFKGAM
FT                   REGEQGPAPTEEKKS"
FT   gene            251166..251594
FT                   /locus_tag="Acid345_0239"
FT   CDS_pept        251166..251594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39244"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV56"
FT                   /protein_id="ABF39244.1"
FT                   /translation="MFMTRSKRTAVLLISCVFGMVLVVSSPALLLFGRLEYDSVKERRH
FT                   RLPFESRAWNDPAQIDGSDPVRIRMVDDLISSRRLDGLTRNEVEQLLGERTVSDTFAHH
FT                   SLTYWLGPERGFMGIDSEWLAIDFGTDGRVSKYQIVRD"
FT   sig_peptide     251166..251243
FT                   /locus_tag="Acid345_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.654 at
FT                   residue 26"
FT   gene            complement(251898..252479)
FT                   /locus_tag="Acid345_0240"
FT   CDS_pept        complement(251898..252479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0240"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39245"
FT                   /db_xref="GOA:Q1IV55"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV55"
FT                   /protein_id="ABF39245.1"
FT                   /translation="MLRYNLGMGLILASASPRRSELLRKARMVFRVEPAHVPEVHTAGE
FT                   DPKQYAQRLARDKARAVAAKYPNDFVIGADTIVVADAHVLEKPADEADAARMIRMLSGH
FT                   THEVTTGVCLCGPNVEIVETETTRVTVAEISDEEIADYIHTGEPMDKAGAYGIQGMFSR
FT                   WVTGIEGDYFNVVGLPIARVYRMMRRAGVL"
FT   sig_peptide     complement(252417..252479)
FT                   /locus_tag="Acid345_0240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.615) with cleavage site probability 0.603 at
FT                   residue 21"
FT   gene            252526..254271
FT                   /locus_tag="Acid345_0241"
FT   CDS_pept        252526..254271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0241"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39246"
FT                   /db_xref="GOA:Q1IV54"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV54"
FT                   /protein_id="ABF39246.1"
FT                   /translation="MKTSASQLQYGASLRDGRVHFRVWAPNAKSLSIRLIQGSSQNDQP
FT                   MQRDDRGEWTLEADAHAGDRYFCVINGEQAVPDPVSRFQPEGVHGPTEIVDPSQFQWSD
FT                   ENWEGVDYDDYVIYELHVGTFTPEGTLDAAIEKLPYLKALGITVVELMPVNAFPGKHNW
FT                   GYDGVGLYAVQESYGGPEALRRFVDAAHAHGLAVILDVVYNHLGNEGNYLRMFGPYFTD
FT                   HHKTPWGEAINYDTTPGCEHVRRFVIDNALYWIREYHLDGLRLDAVQTIKDDSSKHVLQ
FT                   ELQENVQTLAAELGRKVCVIAETDENISKYVRPFGSGYGLQGFWSDDFHHAIHAYFTGE
FT                   RQGYYQDFGDPEQIVTAIRDGYAFQGQPFKFWKGTKRGELPVNVQLPRNVICTQNHDQV
FT                   GNRAKGERLTTLVPRGARYVSAALLLLAPHTPLLFMGQEYDEEHPFQFFTDYGDPVLQN
FT                   AVSEGRRKEFEDFDFREVPDPQDPETFNRSRLDWSKAVDTNPMLRWYRELLRLRKRYVT
FT                   SGERTAYATYQDGVITMMAPGDTPDLILFATLEPGRQLPAEEDGWNLTLKYKSEDGYQV
FT                   RIFTR"
FT   gene            complement(254261..254746)
FT                   /locus_tag="Acid345_0242"
FT   CDS_pept        complement(254261..254746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0242"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39247"
FT                   /db_xref="GOA:Q1IV53"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV53"
FT                   /protein_id="ABF39247.1"
FT                   /translation="MIILLMGVQGSGKTTVGKALAARLGWDFRDADEFHPAANKAKMAA
FT                   GIPLTDEDREPWLQAIRAAMDRANAEHRNLVVTCSALKETYRQQLAAPNTTLVWLKGDQ
FT                   QLIASRLALREHHFAKSNLLASQFADLEEPQGAVAIDIHQTVEAIVDEIIRRLQINA"
FT   gene            254783..256015
FT                   /locus_tag="Acid345_0243"
FT   CDS_pept        254783..256015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0243"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39248"
FT                   /db_xref="GOA:Q1IV52"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV52"
FT                   /protein_id="ABF39248.1"
FT                   /translation="MPDRPHPHRWSIAILLGVGVLVNYFDRVNLSIAHDQITREFGLTT
FT                   VGFGYLLSAYSFTYALCQIPAGAILDRFGVRLVGRVSTVLWSIASFASAFSNGARQFFA
FT                   TRLLLGVGEAPTFPGNAKAVSKWFPENERGLATACFDCAAKFSSAIGVPIMGLLLVRVG
FT                   WRGTFLATGIASFAYFLLFTMVYRDPEEEAPTVLESPVLETGILDLLGDKKVAGLAIGS
FT                   AAYNYCFYLLLAWLPAYLSTSMHLNLLQSAWYTSIPWVVATATDLLVGGWLVDALIRRG
FT                   FDASRVRQSILIGGTSLGVAIFAAGSATTPGQAIFWISVSIGGLAAAAPVGWSVPGLIA
FT                   PPGSVGRVGGIMNFASQLAAISAPIVTGYVVAYTHSFEAAFWLAAIFLTIGIAAYALLL
FT                   GRIERVESQNL"
FT   gene            256207..258012
FT                   /locus_tag="Acid345_0244"
FT   CDS_pept        256207..258012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0244"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39249"
FT                   /db_xref="GOA:Q1IV51"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV51"
FT                   /protein_id="ABF39249.1"
FT                   /translation="MDRSFIRNFAIIAHIDHGKSTLSDRLLELTGSLTAREMQAQVLDA
FT                   MDLERERGITIKAHSVRMMYKAHDDVVYQLNLIDTPGHVDFSYEVSRSLASCEGALLVV
FT                   DASQGVEAQTLANAYLAINNGLEIIPVINKIDLPSADVERAKEMIEGAVGLDASHALPI
FT                   SAKTGMGVEDILESIVHLVPPPKGNPDHPLQALIFDSWFDSYRGVVILARIKEGTVRKG
FT                   DKIMLWSNKHQFLVEEMGVLTPKPVAIEQLEAGEVGFIVANIKTVADVGIGDTITHVER
FT                   PCLEALPGFEELKPMVFAGIYTVDAHEHTLLREALEKLRLNDSSFFFEPESSVALGFGF
FT                   RCGFLGLLHMEIIQERLEREYDLDLITTAPGVRYKITLTDNSVIEVDNPSKWPDSTLIE
FT                   KIEEPIITAMILTNEEYVGGILKLVEEKRGRQKNFEYVTGSRVMLTYELPLNEIVLDFY
FT                   DRLKSVSRGYASLDYHLAGAWESPMVKLDIMVAGESVDALSTIVHKDFAYDRGRALVSK
FT                   MRELIPRQMFEVPIQAAIGAKIIARETVAAMRKNVLAKCYGGDISRKRKLLEKQKEGKK
FT                   RMKRIGKVDIPQEAFLAVLKVGENS"
FT   gene            complement(258339..259106)
FT                   /locus_tag="Acid345_0245"
FT   CDS_pept        complement(258339..259106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0245"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39250"
FT                   /db_xref="GOA:Q1IV50"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV50"
FT                   /protein_id="ABF39250.1"
FT                   /translation="MRVEEKEHTMFEQSLVEISAETKRRKRWTQLISYSLEATAVVVLL
FT                   AFPLVHTEALPLDDSPKIFPPIYHAPPHVDVITEHAPAPRPVRDNHVMINPYLAPTSVG
FT                   KTIDRSHDADKYSAAEELVCVGCIPDPTGTDSSRHNPVLESVLRPGPVQPTHRAAPVTR
FT                   TSKSQESLLLRQVKPTYPRMAVMTRTQGVVQLHAIIGRDGSIQQLQVVSGSPFLVQAAL
FT                   EAVQQWKYRPYLLNGEPVEVETQITVNFTLNGN"
FT   gene            complement(259208..259666)
FT                   /locus_tag="Acid345_0246"
FT   CDS_pept        complement(259208..259666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39251"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV49"
FT                   /protein_id="ABF39251.1"
FT                   /translation="MSKTPSPAEHLKSFLEKFDPTMAAVIRSCRVAMRKRLPTANELVY
FT                   DNYNFFVIGYCTSERPSDCICSLAANRQGVGLAFYYGATLPDPNKILLGSGNQNRFVRL
FT                   SEGAKTLAQPEVQDLIAAAIAQAKTPLPKDGKGKLIIRSISAKQKPRK"
FT   gene            complement(259873..260523)
FT                   /locus_tag="Acid345_0247"
FT   CDS_pept        complement(259873..260523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0247"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39252"
FT                   /db_xref="GOA:Q1IV48"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV48"
FT                   /protein_id="ABF39252.1"
FT                   /translation="MNRKFVCLLATLMFALTLNLSAQTTPAAATTPGGAKVGIIDVQQV
FT                   IVATNEGQRDFEALQKKFDPKRTELQSLSKEVDSLKSQLNTQGDKMNEDAKAKLVKDIE
FT                   AKQKVLQRQAEDAQNEFQQEQNTIAQRILQKLGPVIDKYAKENGFGLLIDSSNPWPQGP
FT                   VLWANGSVDISKIVVDQYNTVSGVPAQPKPANAGAAKPAGTPAPGVGIKPPAK"
FT   sig_peptide     complement(260455..260523)
FT                   /locus_tag="Acid345_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.934 at
FT                   residue 23"
FT   gene            complement(260801..263581)
FT                   /locus_tag="Acid345_0248"
FT   CDS_pept        complement(260801..263581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0248"
FT                   /product="surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39253"
FT                   /db_xref="GOA:Q1IV47"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV47"
FT                   /protein_id="ABF39253.1"
FT                   /translation="MTLLFCGIAQAQEGVIVDIRVHGNRRIPADTVKSRMFTHAGDVYD
FT                   QSSLERDFNALWNAGYFDDLRLEREQTDKGWIIHVYVKEKPTIREIKYEGLNSVTQSDV
FT                   LDKFKERKVGLSQESQYDPTRVKRAEVVLKELLASHGRQFATIRTEVRPIPPAAVSITF
FT                   VVKEGPKVKVGKIIFEGNAHVKARELRAAMKNLKPIGIPKSIFLENLFARTFDSTKLEE
FT                   DAERVRYDYQTRGYFKAIVGDPKTKIRDVSGIKWYMPWKKTDGKVVDITMPIEEGDRYK
FT                   LKEITFSGNKAISNTRALREIFKMKDGDWFDAELVRKGLDDLKKAYGEFGYINATAVPD
FT                   TQFDDVNKSITLKVDLDEGKQFSVRRIEFVGNTTTRDKVIRRELALEEGGIYNSRLWEM
FT                   SLLRLNQLQYFEPLKAETDSETKQNNQDNTIDLTLKVREKGKNSIGLTGGVSGLAGSFI
FT                   GVNYTTNNLLGKGETLQLEANVGQFERNIQFGFTEPYAFDRPLQLGAVVFSSKYDYNYA
FT                   KQLALSTGQQLNLSQSVQDTLQNYSQSTTGFTLSSSYPLHRSFKRVGLSYTFSDSSVQT
FT                   FSTASTQYFQYLAFRSVTGPNALEGILTSKVTPSFTWNRIDNPQRPHRGSSFFLAADIS
FT                   GLGGNVQMIRPVTEYKRFIPVNKGRNVFGFRVQGSFVTGYGGNVAPPFERFYMGGENDL
FT                   RGFDIRSVSPTAFLTDFTSIALTNPDGTTVPIDPAHPNKGAYTIAIPVQRIIYPGGDTS
FT                   VVTNLEYRVPIAGPVTIAAFVDTGWDMVLRNDQLRISDQQYSTLTNTIFGCVYNPLIPL
FT                   TVGCTGGGDASHFLTGLSQNITPIDKTNYQTRMSTGLELQVIMPIVNAPFRIYYAYNPF
FT                   RLDTTTTTPSPITRSMFPDGAAGDYTYKQAISLYNPTYVLREPLKTFRFTVATTF"
FT   gene            263908..264450
FT                   /locus_tag="Acid345_0249"
FT   CDS_pept        263908..264450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39254"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV46"
FT                   /protein_id="ABF39254.1"
FT                   /translation="MKNFVIATLLVSGLASAAVASPRAASSPKERVKLVRIARNLEINP
FT                   LAFEAVQQRQWAAEFIVKAPDLHLELCEPVLHPLERGNPNYNSQLSMQFMVSSAAFMVK
FT                   HPKVKDPVKIQTAGVEGTLKAYQSILKVDKDAHFDFLDGLMQQKQDGQLENYVASISST
FT                   CGEMAEQAPRHKRKLIP"
FT   sig_peptide     263908..263970
FT                   /locus_tag="Acid345_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.499 at
FT                   residue 21"
FT   gene            264914..265204
FT                   /locus_tag="Acid345_0250"
FT   CDS_pept        264914..265204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39255"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV45"
FT                   /protein_id="ABF39255.1"
FT                   /translation="MQTYSPNKYHLVDLHKEISLYDRKIAYCQQFEKFDSDRERSSALG
FT                   KLQKKRSTLVKLAMSFSSQGIEHDPKFFPRSLSIGEDGTISEIPWSPAQAS"
FT   gene            265215..265538
FT                   /locus_tag="Acid345_0251"
FT   CDS_pept        265215..265538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0251"
FT                   /product="RNA-binding protein, RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39256"
FT                   /db_xref="GOA:Q1IV44"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV44"
FT                   /protein_id="ABF39256.1"
FT                   /translation="MKKIFVGNFAFTATEDDIRQLFTPYGKVDSVSLVTDRDTGRARGF
FT                   GFVEMPNDTEAAAAIEGLNGRDSGGRALNVNEARPKTERGNSGGGGGRGNFRDKGRKRE
FT                   PRW"
FT   gene            265532..265813
FT                   /locus_tag="Acid345_0252"
FT   CDS_pept        265532..265813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV43"
FT                   /protein_id="ABF39257.1"
FT                   /translation="MVGATAQTFGNAKRLRNAHGSLNGIVTMTTVCCETCGFHYAIEHP
FT                   AGAGDEALAQRQAAWLADRFVWDHIQENKHSGSVRLPLLPAPATAAAH"
FT   gene            complement(265861..266247)
FT                   /locus_tag="Acid345_0253"
FT   CDS_pept        complement(265861..266247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39258"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV42"
FT                   /protein_id="ABF39258.1"
FT                   /translation="MNDRGPSTARALHAPLRMTGLRWSAIRELSMPWDVRLEDEQGRPL
FT                   IPSDVYVEFSMIPEDESLAATKILRIIDRYADTVLNHLQMDDFLREWSQLQPNPMDHIE
FT                   WELVRRMAEQCKAEPHTYLRFIGD"
FT   gene            complement(266296..266754)
FT                   /locus_tag="Acid345_0254"
FT   CDS_pept        complement(266296..266754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39259"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV41"
FT                   /protein_id="ABF39259.1"
FT                   /translation="MKRLTLGVLLLLFLSVWGRSQECTSKVQGFLDHSGYAIKVLTPCQ
FT                   SWMATDVLSVPKGDGLSGVMLFAEGDDFVIVGTVIRTKAKLNLSSDLLDKLMHFNDDLT
FT                   FVKVGIDRKGDLFIREELRADTVTAEQFKDSVKRIIAGSNKVYATLSE"
FT   sig_peptide     complement(266698..266754)
FT                   /locus_tag="Acid345_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.992) with cleavage site probability 0.781 at
FT                   residue 19"
FT   gene            complement(266927..268123)
FT                   /locus_tag="Acid345_0255"
FT   CDS_pept        complement(266927..268123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0255"
FT                   /product="transporter, CPA2 family (2.A.37)"
FT                   /note="2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39260"
FT                   /db_xref="GOA:Q1IV40"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV40"
FT                   /protein_id="ABF39260.1"
FT                   /translation="MPHGTETLLLQLFTIFVWAKAFGEIFERLRLPAVLGEILAGVILG
FT                   PFAAKLIEPSDTIVSMAEIGAIFLLFSVGLETSPKDLIKVGRTSLNVALAGIAAPFLLG
FT                   FIYLKARGEVTHEAAFVAAAMVATSVGITARVLSDLHVIKSYTSQVILGAAVFDDILGM
FT                   ILLTIVVSLAEGSGIQYIHLGIVAAEAVGFALIMIFVAPRVVGRMEPGLQKMSSGNAPL
FT                   ILALAICLGFSVLATKIGMAAIIGAFFAGLIFADHAPRWELESPVRGITEFLTPFFFFT
FT                   MGARLDLHIFTPDLIVAASIVGFLALVSKVVGCGLPVLHEGWKTALKIGVGMTPRGEVA
FT                   LIVALIGLQMNMVSQRAYAIVILMTAITTILPPPFLRMLYRDEIVDSEEEPQSVAADV"
FT   gene            268334..268711
FT                   /locus_tag="Acid345_0256"
FT   CDS_pept        268334..268711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39261"
FT                   /db_xref="GOA:Q1IV39"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV39"
FT                   /protein_id="ABF39261.1"
FT                   /translation="MERRAEGRIWLETLKWTARTVWGLLICTTLAIGCSYLFSAQPWII
FT                   FLPIGFVVVIVAVAARYGVMVGILGSILTAAIFAHLLFTPLHSFRVEDDAARASLAWML
FT                   LGGIAIPYLLLPDLRSRNDKK"
FT   sig_peptide     268334..268453
FT                   /locus_tag="Acid345_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.713) with cleavage site probability 0.713 at
FT                   residue 40"
FT   gene            268766..269194
FT                   /locus_tag="Acid345_0257"
FT   CDS_pept        268766..269194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0257"
FT                   /product="thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39262"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV38"
FT                   /protein_id="ABF39262.1"
FT                   /translation="MPLSDFRSVGHFQVPFCDIDMFQHVNNASYVVWAETSRCVYFDEV
FT                   LGVPLTGARSIILAKLEITYERPLEYREHVAVASRVTRIGNKSYDLLTEYWSEDSGQRA
FT                   AFCTAILVGYNYETKQTIVIPQEWRERIAAYEVVKPQL"
FT   gene            269449..270534
FT                   /locus_tag="Acid345_0258"
FT   CDS_pept        269449..270534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0258"
FT                   /product="recA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39263"
FT                   /db_xref="GOA:Q1IV37"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV37"
FT                   /protein_id="ABF39263.1"
FT                   /translation="MSDERTERGRSLELALSQIEKQFGKGSIMKLGAKGAIVPISVIST
FT                   GAISFDAALGTGGFPRGRVVEIFGPESSGKTTIALQVIAEAQKAGGMAAFVDAEHALDP
FT                   TYARKLGVDVENLLVSQPDYGEQALEITEALVSSKAIDILVVDSVAALVPKAELDGEMG
FT                   DSHMGLQARLMSQALRKLTGTVSKSGTCLIFINQIREKIGVMFGNPETTTGGRALKFYS
FT                   SVRVDIRRIAAIKDGDTVIGSRTKVKVVKNKTAAPFREAEFDIVYGEGISKEGDMLDLA
FT                   VEANIVEKSGSWFSYKTERIGQGRENAKQFLKDNKDIAARVEAEVRKHVGLVKEPAAPA
FT                   PNAAPPVPPNGHAEKAAVARK"
FT   gene            270643..271362
FT                   /locus_tag="Acid345_0259"
FT   CDS_pept        270643..271362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0259"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39264"
FT                   /db_xref="GOA:Q1IV36"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV36"
FT                   /protein_id="ABF39264.1"
FT                   /translation="MSEPKYKRILLKLSGEALAQGEQGFGVDPTRVHEIAAEIAEVHRL
FT                   GVDIGVVVGGGNFFRGVAEQAKDMDRVSADHMGMLATVMNSLAVQDALEKQNVQCRVMS
FT                   AIEIFQVAEPFIRRRAMRHLEKGRVVIFAAGTGNPYFSTDTAASLRAAEIKADVIMKAT
FT                   KVDGIYDADPHKVADATMFAQITYMDVLKKGLRVMDATAISLCQENRLPIVVFNLNERG
FT                   NIQRVVMGEAVGSLVSA"
FT   gene            271907..272236
FT                   /locus_tag="Acid345_0260"
FT   CDS_pept        271907..272236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV35"
FT                   /protein_id="ABF39265.1"
FT                   /translation="MRTPSPKASFRLRTYSREAIRVHSGGTKGSGKSSRGSSSPKNSKP
FT                   GDVVRQSGIYEVVHDGEHRAAHEVVMIAGDAFPNCETCDQNVRFRLVRTAPYIFQDQDF
FT                   EEDDK"
FT   gene            272346..272933
FT                   /locus_tag="Acid345_0261"
FT   CDS_pept        272346..272933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0261"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39266"
FT                   /db_xref="GOA:Q1IV34"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV34"
FT                   /protein_id="ABF39266.1"
FT                   /translation="MAQISMAAVPALKDQFGQLKTRMEKAVDDFRKELSATRTGRASVH
FT                   MLDTVQAEYYGSMMPLNQVATITVPEPQLILVTPFDPSALGAIEKAIRSGDLGMNPMND
FT                   GKIIRIPVPPLTEDRRKEMVKHLHKALEEHRTAIRNIRRDGNDFIKKTLKDKKITEDEE
FT                   RGTMEHLQKLTDDEIKKMEEMCKTKEKEVMTV"
FT   gene            complement(273000..274865)
FT                   /locus_tag="Acid345_0262"
FT   CDS_pept        complement(273000..274865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0262"
FT                   /product="protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39267"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV33"
FT                   /protein_id="ABF39267.1"
FT                   /translation="MKKPMSPQLQPAFPACFTRRLSVGGPLRRFALLLSLVFTLASIAF
FT                   AQSPEKAPAPPAWIAESNRYANMLIEISFKHSPEFGSGQGLAEFDTKVAQPTLADENAE
FT                   RQETEAVVAKLEAAEKSEKDPKVKEDLEIMIRRMQLRFRDQDYARAREVPFYNASQRVF
FT                   SGVRLLLDDQTPDDRRPAAVTRVREYAGLEAGYTPLTEILKKRTEEQMAKAGVIYPAKT
FT                   EIETEMSRNANYTEGMAALLKKHKLTGWEEPLAKLKQQLTDYDAWVRANVLPKARSDFR
FT                   EAPERYALDLEGYGIDIPPAQLTKMAHDSFVEIQGEMKSVAAQIAKQRNLPSSDYRDVI
FT                   HELKKQQIVGDAILPFYENRLKQIEQIIVDQQIVSLPSRPAKIRIATAAETAQQPAPHM
FT                   VPPPFIHNTGQRGEFVLPLNIPAGPGQPASEKYDDFTFDAAAWTLTAHEARPGHELQFD
FT                   SMLEHGVSLARARYAFNSTNAEGWGLYSEYLIKPYMPLEGQLISLQLRLQRAARAFLDP
FT                   ELQSGKVTPEDAYRVLEHDVCLSHAFAQEEVERFTYRAPGQANSYFYGYTRLLSLREET
FT                   EKALAAKGVKFDQKKFHDFILAQGLLPPDLMRKAVLEEFVPAQAK"
FT   sig_peptide     complement(274725..274865)
FT                   /locus_tag="Acid345_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.997 at
FT                   residue 47"
FT   gene            274892..277576
FT                   /locus_tag="Acid345_0263"
FT   CDS_pept        274892..277576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0263"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39268"
FT                   /db_xref="GOA:Q1IV32"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV32"
FT                   /protein_id="ABF39268.1"
FT                   /translation="MAHHMAVAPGTKLGPYEIQSQLGAGGMGEVYRAKDLRLDRSVAIK
FT                   VLPGHLSSNPELKERFVREARAISSLNHPRICTLHDVGQQEGVDFLVMEFLEGESLAQR
FT                   LQKGALPIKEVLKIGVEVSEALEVAHRAGIVHRDLKPGNIMLTKTGAKLMDFGLAKAVE
FT                   STMAAGTSSAPLLSGAPTMSGLSPLSPLTMAGAVVGTVQYMAPEQVEGKLADARSDIFA
FT                   LGATLYEAATGKRAFDGKSQIAVANSILEKDPEPASTLNPQVPRGVDHVIARCLAKDPE
FT                   QRWQTARDLGLELGWSAQASPSSTQITPVKRRSQSLPWIVSGALALLLLVALFSWLNRS
FT                   SPATQAQYFAAPFTFTARDLTIAPNGHTVAVVGYRSEAHKNGIFLYELGSQNVRLVPDT
FT                   DGASFPFWSADGLSLGFFADGKLRRVDIAGGPAQTLCDAPGGRGGTWNKDGVIVFTPSG
FT                   ALRTGLWRISAAGGKPEQLTTPDASKGEDGHRWPVFLPDGQHYIYTIFNNTVHTEFAGL
FT                   AVGALGSKEQHFLLHAISNGSYAAPGYLLYYRDNTLFAQRFNATKLQLEGEPAALLSDL
FT                   QYMPRIQRATFSSTGTGAVLAQLRTGNAVSQLTWFDRSGKSLGDVADPDYFGALSLSPN
FT                   GQSLAVDKVDSGSQNTDVWLLDLHGGAPRRITFDPSIDALPVWSPAASEIAFVTNRELH
FT                   FSVYRKSVDGHATESVLINDLPDNYPNDWSRDGKYFLYVHGTGLWYLTFSDMTKKEFLN
FT                   AGTSALKTGHFSPDGKWIAYASNESGKWEIYVTSFPDAKGKWEISSGGGEQPHWRGDGK
FT                   ELYYLSSSAKMMAVPVTTGANFSAGTPAALFQADPRELVATTEQVGYDVSSDGQKFLIN
FT                   SAIRNGESQQVTVILNWNEKLNK"
FT   gene            complement(277624..278145)
FT                   /locus_tag="Acid345_0264"
FT   CDS_pept        complement(277624..278145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0264"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39269"
FT                   /db_xref="GOA:Q1IV31"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV31"
FT                   /protein_id="ABF39269.1"
FT                   /translation="MHTVSQLAKHCQLSRSTVLYYESIGLLQPAVRTESNYRLYGEREL
FT                   QRLEQIKLYRSVGVSVKDIRAVLNAPRGEFSGVLKRRLSQLEKEIEALQAHQRVILKLL
FT                   NMKTLRRKKDMTKDKWVAVMKDAGFTEDDMHRWHRQFEKSAPTDHQEFLQFLNIPTDEI
FT                   SRIREWSKKN"
FT   gene            278243..278989
FT                   /locus_tag="Acid345_0265"
FT   CDS_pept        278243..278989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0265"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39270"
FT                   /db_xref="GOA:Q1IV30"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV30"
FT                   /protein_id="ABF39270.1"
FT                   /translation="MSGVQGRVALITGASQGIGRACALALGEAGATVALAARNREKLDE
FT                   VAAQITNAGGQASVFPLDVTDEEQIKATVKEVLAKHGHVDILVNNAGVTKDQLFMRMKR
FT                   ADWETVMNTNLTSAFLLSQAVIGSMMKQRWGRIVNITSIVGQTGQAGQVNYASSKAGLI
FT                   GLTMSVAREVASRNITCNAVAPGFIETAMTAVLGDDVKAKINEQIPLGRQGSDSDIAQA
FT                   VKFLASEEAGYITGHVLNVNGGMLMG"
FT   gene            complement(278990..279439)
FT                   /locus_tag="Acid345_0266"
FT   CDS_pept        complement(278990..279439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39271"
FT                   /db_xref="GOA:Q1IV29"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV29"
FT                   /protein_id="ABF39271.1"
FT                   /translation="MCYRRAEPRTMETPKKSAPWLVVVILVVAFGLPIAIGTMEVRIAR
FT                   NAQAETAAVDYLNAVAKAENDYRKANDTFAAKLDDLKGLPASVGPYKIGYKKVTPDSYL
FT                   AMAWPLQPGNHGRRYFFLDQTGVVRYELMKPAGPGSEPVPTAEKK"
FT   gene            279800..280156
FT                   /locus_tag="Acid345_0267"
FT   CDS_pept        279800..280156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0267"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39272"
FT                   /db_xref="GOA:Q1IV28"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV28"
FT                   /protein_id="ABF39272.1"
FT                   /translation="MNIGETIRNFRLQKGMSQGDIEKRTGLLRCYLSRVENGHTIPSLD
FT                   TLAKIASAMDVALATFFSDAPADNGTKSSPQVSDEVLRFLNQIRRYSSGLNDSDRRLVL
FT                   TMVKKMAASAGNGK"
FT   gene            complement(280224..280877)
FT                   /locus_tag="Acid345_0268"
FT   CDS_pept        complement(280224..280877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0268"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39273"
FT                   /db_xref="GOA:Q1IV27"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV27"
FT                   /protein_id="ABF39273.1"
FT                   /translation="MAELIRVVIADDHAVLRESLVALLNSQPDIEVMGSASNGTEALEI
FT                   VQKVHPDVLVLDLAMPAGDGFDVLRTLDRAGTRVASVVLTGSESQQDYVQVVRLGARGL
FT                   VLKGDDPSKLFAAIRAVADGELAFSDEVARGVLNAMAAEPQPAPTNLARLSERERQISF
FT                   LVARGYKNKDIANELTISENTVKRHLQSIFSKTGARDRLELAVLALNEISAKAA"
FT   gene            281102..281710
FT                   /locus_tag="Acid345_0269"
FT   CDS_pept        281102..281710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39274"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV26"
FT                   /protein_id="ABF39274.1"
FT                   /translation="MTIDEELDLLDTSLRRLKIEYDVYFGGGSKRPPNDTLWRVQSLIK
FT                   KFSDSQKLNFSQRFKFNTLTQKYAIFSDLWRQKLKIKEEGFRRPQDALLAIAGMRTDEE
FT                   KAAQAALGGRSAEDEADSSRIACSDVEQQGDMVRAFYDRMMSEKQKVGEQAGAPYESFA
FT                   SFLKKKTEQIRRDFKCDAVEYSLEVQGNQVKLKAKPKTA"
FT   gene            281732..282067
FT                   /locus_tag="Acid345_0270"
FT   CDS_pept        281732..282067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39275"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV25"
FT                   /protein_id="ABF39275.1"
FT                   /translation="MNTRKAAIREFKERAVPRGIFAVRCKATGSVWVDSSPNLTAAKNG
FT                   LWFMLRTGSHRDKQLQAEWKERSEEQFAFEVLEELDPDTPALAVDDELKAKKAAWIEEL
FT                   KAKAIQK"
FT   gene            282306..283292
FT                   /locus_tag="Acid345_0271"
FT   CDS_pept        282306..283292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0271"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39276"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV24"
FT                   /protein_id="ABF39276.1"
FT                   /translation="MKSHFLIALPLAATLALPALAQNTASTPSDNQKPAATAPAAQDSS
FT                   SQAAQNNNGVTPAQEQGMAAHQPLQPDTHEGFWGHLNPFARKKYVQRQMSPIRDRVNEL
FT                   DELTAKNSKDIKDVDARAQEGIRIASAKANEADQHALDAGNRAQQANTTATQASQHLQT
FT                   VQTTVENIDQYKEASNIEIRFRPGQSVLSKKAKESLDDMSKGLADQKGYIVEVQGFAPG
FT                   HGRVAVENSQRIADEVVRYLVINSNVPVYRIYTMGMGNAKVQATSATADSKPKYTKGGR
FT                   VEISLLQNSLGQMASASTMPQSDANSTAAPAAPAQQSAPQQPATPQQ"
FT   sig_peptide     282306..282371
FT                   /locus_tag="Acid345_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            283532..284470
FT                   /locus_tag="Acid345_0272"
FT   CDS_pept        283532..284470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39277"
FT                   /db_xref="GOA:Q1IV23"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV23"
FT                   /protein_id="ABF39277.1"
FT                   /translation="MFAAPRAAIPSTPGAPQLPMSALMAIVFVMYLVPAIWGLASSIGL
FT                   WRLKNWARISTIVFAVLLCMFGVFGGLGALAVPAIMKSQPSQPPNASQITIVVIASMLV
FT                   FSIGELAVGVWWAIYFTRRSVTAQFIPAGSAYVLSPTSDLSAGPAAIPATLPAGRPISI
FT                   SIIAWFLLVCSIFFPFTFLLHTPQLLFGVLINGPAAMILMTAYLFVVLYVGIGLLKLWP
FT                   SARLVGIGYFVFGMVNMAATWLRPGAADLFQRMMASQPKMFGPTPDFAFTDTFLKLIMI
FT                   STAITMAIPIYFLVTRKAAFYRKESFSGPAS"
FT   gene            284564..285115
FT                   /locus_tag="Acid345_0273"
FT   CDS_pept        284564..285115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0273"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39278"
FT                   /db_xref="GOA:Q1IV22"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV22"
FT                   /protein_id="ABF39278.1"
FT                   /translation="METLYYSQMKSPIGQLWIAVSKNGLVMIEFEGREFPPVKFDKNVS
FT                   WVISEEKTAKVKKQLQQYFDGHRTEFDLPLDPRIGTDFQRKCWDLVAKIPYGETRSYQE
FT                   LAKELKSPNASRAVGGANGANPIPIVVPCHRVINSDGHLGGYGGGLDKKEQLLSLERAL
FT                   PGTGPLFFKAPKSKSAKVGV"
FT   gene            285225..285497
FT                   /locus_tag="Acid345_0274"
FT   CDS_pept        285225..285497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV21"
FT                   /protein_id="ABF39279.1"
FT                   /translation="MANYLLRHTTVKCEICTTLGLHYQKAVDALHVANQHLRMVKLGTL
FT                   QSALCRREVHDSLNGLIAADAELKAHRAWHIECLTALPQPHHASL"
FT   gene            285560..286204
FT                   /locus_tag="Acid345_0275"
FT   CDS_pept        285560..286204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0275"
FT                   /product="negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39280"
FT                   /db_xref="GOA:Q1IV20"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV20"
FT                   /protein_id="ABF39280.1"
FT                   /translation="MYTPSHFKQEDLTAIHEMMRHIGLVSLVTTTPHGLVATQAPVLFD
FT                   ADADHGVLRGHIARANSQWKDTPAGTEALAIFTGPNAYISPNWYAAKREHGKVVPTWNY
FT                   IAIHAYGEIHFSEDRDKLLDIVTRLTEAHESSLEHPWKVGDAPADYIEAMLKAIIAFEV
FT                   KITRIESSWKLSQNRSEADRAGAMAGLQQRGEEVAKEMERLDAPPSPKEKS"
FT   gene            complement(286201..287592)
FT                   /locus_tag="Acid345_0276"
FT   CDS_pept        complement(286201..287592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0276"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39281"
FT                   /db_xref="GOA:Q1IV19"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV19"
FT                   /protein_id="ABF39281.1"
FT                   /translation="MSLPTMDKPVRQLFGTDGIRGVAGEYPLDPHTVFAIGRALGARLV
FT                   EKYQTARVLIGQDTRESSDWISRALARGLESANCGVASAGVITTPGVAYLTRTHGFSAG
FT                   IVVSASHNPWTDNGIKVFGANGYKLSDDIEHEIEAQIFYHLEELERAESEGEGPAMLPG
FT                   DDKLREDYAEWLRSQVEGTDFSKFRVLLDCANGAASSIAHLVFPKVGVFSEFTHICPTG
FT                   RNINANCGALHPEEAAKHVGQSRGRFDLGITFDGDADRALFSDGDGNIVNGDAVLLLAA
FT                   RDMKARGHLKEDTVVATTMSNMGLEAALKRSGIRMLRAAVGDKYVLEEMKKTGATLGGE
FT                   QSGHILFMDSDATTGDGILTALRVLEVLARSGKSLAELIADLKVFPQVIRNVKVNAKIP
FT                   MKELPAVMSAIEAAEQDLGDSGRVVVRYSGTEKLARVMIEAESEAKMNQHATAIAEAIQ
FT                   EAIGI"
FT   gene            complement(287596..288270)
FT                   /locus_tag="Acid345_0277"
FT   CDS_pept        complement(287596..288270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0277"
FT                   /product="YbbR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39282"
FT                   /db_xref="GOA:Q1IV18"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV18"
FT                   /protein_id="ABF39282.1"
FT                   /translation="MIHWLRTHVFGHIWLKIVSILIALLLWWAVAHDQPAEIALSVPIE
FT                   FYNTPEHLEISSERIQRAEIRVQGPARILRQMTNADIDAVIDLAGAHVGEHTFDLTPKQ
FT                   IRHLPHNVNIVQVVPSQIRLDLDRSASKVVDVTPRVIGTFAAGYRLGDVEVNPAKITIV
FT                   GPQSRLNNIDAAITDPVDATGLVGRGTFTTQAFVGDPLVQQLNPEPIHVTVSTTKTKPG
FT                   EK"
FT   gene            complement(288267..289145)
FT                   /locus_tag="Acid345_0278"
FT   CDS_pept        complement(288267..289145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0278"
FT                   /product="protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39283"
FT                   /db_xref="GOA:Q1IV17"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV17"
FT                   /protein_id="ABF39283.1"
FT                   /translation="MGQWLARGRAPQATDMATAVLDVLIVALLIYEFLKLIRGTRATPM
FT                   LMGVFVLALAFVAAQFAELRTLDWLMTTLLPYGIFAMIVVFAAEIRHALARLGRKLASS
FT                   RSSAANSESYDDVVLAANLFSQNQTGALMVIEREIGLRTYIESGVALDAHISYDLLATI
FT                   FRPSAPLHDGAVIIQKDRVAAAACFLPLSMNPILSTQLGTRHRAGIGITEESDAIAVIV
FT                   SEETGAISVAVAGQIERDITPDELRERLSVLLRRHVPATTLPTHQDPDLDAATYPSGVR
FT                   ESDDDATELQR"
FT   gene            complement(289200..290567)
FT                   /locus_tag="Acid345_0279"
FT   CDS_pept        complement(289200..290567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0279"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39284"
FT                   /db_xref="GOA:Q1IV16"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IV16"
FT                   /protein_id="ABF39284.1"
FT                   /translation="MSFSDQLGFTFSAPQRRIWQVRDIVSAVRAALEREYADVWVEGEI
FT                   SNFRPADSGHLYFSLKDESTQLRIVMFRSQARLLKFRPENGLKVIARGKVTLYEGRGEL
FT                   QLMAEYLEPQGAGALQIAFEQLKAKLQAEGLFARERKKPIPALPKKIGVVTSPRGAVIQ
FT                   DILNVLRRRHNSVHVLIFPAQVQGETAASEVASGVRYFNKAANVEVIIVARGGGSIEDL
FT                   AAFNDEGLARSIATSTIPVISAVGHETDFTICDFVADLRAPTPSAAAELVIRSKQEVDE
FT                   RLTALSTHLARALRVRLLEYEKKLDRLARHGAFGGMQTAIARRQQRVDDLAFRLSVAQT
FT                   NVFRQLHRRLDVASTRVRHHDLRSRFAAEHRELSARVEKLAATLRANLMRRRTRIERLA
FT                   GQLQGLSPISILERGYALVFDAEGRLLKDARQVREGNTIRAQLALGQISAVVKKPE"
FT   gene            290737..293724
FT                   /locus_tag="Acid345_0280"
FT   CDS_pept        290737..293724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0280"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39285"
FT                   /db_xref="GOA:Q1IV15"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV15"
FT                   /protein_id="ABF39285.1"
FT                   /translation="MATTRSTAPLRDAEETLESFDSLMPFRVQDILLVSSLYDSFILRE
FT                   DGRLNELLIGESRELDLQHIPGITHVSNCAQALEIMRSQPRFNLIVTNLAVGEMNAAQL
FT                   AREIRKSGSDVPVLVLAYDYREVKNFIARNPVTDIDRIFLWQGNARVLVAMVKYIEDKR
FT                   NALHDTKTVGVPVLLVVEDNIRYYSSVLPVIYTELITQSKRVIREGINVAHKLVRQRAR
FT                   PKILLCSDFEEAEKYAQQYRENLLAVVSDVQFPRAGAPEAEAGFELAHYIRDLVPDVPI
FT                   VLHSSHTEYKTRAHDEGFAFLQKRSPTFLRDFRRLLTQQCAFGDFVFRLPSGEEVGRAS
FT                   DMNQLEAHLHRVPPESIAYHSQRNHFSRWLTARTEFAVAQKLRPRKVSDFATLEDLRND
FT                   LIDSINEYRREQTEVSIGDFDAANFKIGDAFFLRIGSGSLGGKARGLAFMRHLLYKQRF
FT                   SRRFPGVKVSVPPAVVVSTEYFDRFLTENNLLEFAIRCTDDADIRRRFLEAELPATLIR
FT                   DLTAFLEEAKYPLAVRSSSLLEDSHYQPFTGVYETFMLGNQQPTEEERLAQLGRAIKLI
FT                   YASTFSQHAKAYVRATPYRLEEEKMAVIVQQVVGSQHDTRFYPDFSGVVRSHNFYPTAP
FT                   MAAGDGIAAVALGMGRAVVEGGRCLSFCPRYPRHPIQFSEVKEILSTSQSEFWAMDLDQ
FT                   RHNDNPVSSLRETRFQLNVAEEDGTLAPVASTYSPDNDRVYDGMGRSGARIVSFAPILK
FT                   QEIFPLARILDDLSKVGEAALGQPVEIEFAVRLPRVEGEPANFGFLQVRPLVLSGENEN
FT                   LHMGDVDDATLICKSTSVLGNGRVQNLRDVVVVDFHRFERGRSQQVAEAVAHFNANLMD
FT                   EDRPYLLIGVGRWGSNDPWLGIPIEWDEIAGARVIVETGFKDMAVTPSQGSHFFQNLMA
FT                   FQVGYFTVNPENGHGLLDWDWLGAQNAREEIDCVRHLRFDQPATVVMNGMTREGMIFKP
FT                   GQETRP"
FT   gene            complement(293829..294884)
FT                   /locus_tag="Acid345_0281"
FT   CDS_pept        complement(293829..294884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0281"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39286"
FT                   /db_xref="GOA:Q1IV14"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV14"
FT                   /protein_id="ABF39286.1"
FT                   /translation="MIRPTEDLRIQWTKVVLPPAFLDEELPTTENASATVANARNTVRD
FT                   IIRGEDSRLLVVLGPCSIHDVKAAREYAALLKDAITELSNDLFLVMRVYFEKPRTTIGW
FT                   KGLINDPHLDESFNINDGLRISRHLLLDLAEMGVPAGTEFLDMITPQYLAGLVCWGAIG
FT                   ARTTESQIHRELVSGLSCPVGFKNGTSGNVGIAIEAVQSAAHPHTFLGHTKYGQSAIFA
FT                   TTGNPDCHVILRGGRKLANYDAASVKEACGLLEKAGLPQRLMIDCSHANSNKDHTRQGA
FT                   VARDVAGQIAGGNKAIIGVMIESNLVGGAQKFVKGKPLVYGQSITDACIDWKETRGLLG
FT                   ELAAAVRSRRK"
FT   gene            complement(294926..295933)
FT                   /locus_tag="Acid345_0282"
FT   CDS_pept        complement(294926..295933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0282"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39287"
FT                   /db_xref="GOA:Q1IV13"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV13"
FT                   /protein_id="ABF39287.1"
FT                   /translation="MGARGEAFLGVDIGGTKVAAGLVNDNGELLYKTRNPMNCSRGADE
FT                   AVNAVREAIDRTIRENPEAEVRAIGLSSPGSVDPRTGTVVMATNLPCWKNFGLAEIIAK
FT                   QYGLPTELHNDANAAGLAEAVWGNGVGYDSVFYATVGTGIGTAILFDRQVYLGRTGSAG
FT                   EGGHMSINFDHRGPRCACGKPGCIEYLAAGPGIATRARRRIESASGNEGAKLIELAGGD
FT                   VSKITGETVEAAWKAGDRLATEVFEETADYIAIWLGNIVDFLEPDVIVMGGGVGNMLSP
FT                   WYPRIREYLRSWSVNPRAGEIPFVQAKYGPDSGIVGAAALVVHPGQYIMHAPTH"
FT   gene            complement(295942..296664)
FT                   /locus_tag="Acid345_0283"
FT   CDS_pept        complement(295942..296664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0283"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39288"
FT                   /db_xref="GOA:Q1IV12"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV12"
FT                   /protein_id="ABF39288.1"
FT                   /translation="MPTIRKNGTPAYKRIQDTILKRIERGELKPGDAVESERSLARLHD
FT                   VSLMTARHALVGLEREGLVERRHGAGTFVAAPKIHFNKLTSFSEQLAARSLDSASRVVA
FT                   LKVVDDEDEIAARLSLPGASRLLRIERVRLGSGEPFAVESCYLSAEDFRGVSRQALERG
FT                   SLFTLMEKEYGITIAHADEEIDATGADPDLARLLAVPKGYPVLRIRQTIYSTQGKPILY
FT                   VLGMYRADRHVLRIRRYR"
FT   gene            297224..298156
FT                   /locus_tag="Acid345_0284"
FT   CDS_pept        297224..298156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0284"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39289"
FT                   /db_xref="GOA:Q1IV11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV11"
FT                   /protein_id="ABF39289.1"
FT                   /translation="MPEQVVVRCKDLRKTYEGKVEAVRGLDLTIYAGQCFGLLGPNGAG
FT                   KTTTIEILEGLLDATSGEVQILGHTWTKNSRELRELIGISLQETRLGEKLTVRETVELF
FT                   AGFYKVSRPVNTVLEELSLTEKADARVGKLSGGQKQRLAIATALVANPKILFLDEPTTG
FT                   LDPQSRRQVWDIVRRFQQAGGTVLLTTHYMDEAERLCDYISIIDHGKVIAAGTPAELIS
FT                   GVGGHHRVEFALEAENVDDALWRSLPGVGGVHRDAEITALTVEEPHLTIPALLAMVNER
FT                   GWKLSQLTTRQSSLEDVFVNLTGRHLREE"
FT   gene            298156..299226
FT                   /locus_tag="Acid345_0285"
FT   CDS_pept        298156..299226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0285"
FT                   /product="ABC multidrug efflux pump, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39290"
FT                   /db_xref="GOA:Q1IV10"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV10"
FT                   /protein_id="ABF39290.1"
FT                   /translation="MSEPLTTHGRWSGYAGLLGARMKELFREPEVIFWIFMFPILLAFG
FT                   LGIAFRNKPVEKANVVFAQQEGSDALQTLLKSAPDAQRFNIQVQPPEQAANSFRLGKVD
FT                   LEILPDGKGGAEYVYDPARPESVLARNVVDDALQIAAGRKPVLSSSSRVNSEPGSRYID
FT                   FLIPGLLGMNLMGSGMWGIGFALVDMRQRKLLKRFIATPMRRSDFLLALASSRLILMII
FT                   ELFLVLGFGILMFHMRVMGSWPAIILVSVLGAMTFAGLGLLTASRAQKIETASGIMNLI
FT                   MMPMWIFSGIFFSYERFPAKVLPIIRLLPLTALNDSLRAVILEGKTLASLSEPLIVLCL
FT                   WGGLSFLVAVRLFRWT"
FT   gene            299310..299882
FT                   /locus_tag="Acid345_0286"
FT   CDS_pept        299310..299882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV09"
FT                   /protein_id="ABF39291.1"
FT                   /translation="MRKQVATFVVLVFVAAAVLGGVCAWAQEPQDQQGPPPQSAGGRWS
FT                   VFQSEDRMTGAKLVQFELESDNTMPDSDRRSRVVLFCKNGHYENAEFQPSIRMAGPNRP
FT                   GFWGQPQMQVRVRADAWHDDKGWNWLGKALSMDKGSVQRAMGARVFRVEFLAARKKASA
FT                   QPYIAEFSPEGLNFSQVKASCDLGPKH"
FT   sig_peptide     299310..299390
FT                   /locus_tag="Acid345_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(299988..302603)
FT                   /locus_tag="Acid345_0287"
FT   CDS_pept        complement(299988..302603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0287"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39292"
FT                   /db_xref="GOA:Q1IV08"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV08"
FT                   /protein_id="ABF39292.1"
FT                   /translation="MKLLRLLCLALLLAAPVFAQAPVAQQMDTIVAAYRQIIVLTDGEA
FT                   SLDQINRDRVAIIGEAMFEENHLRIAALNGSLIGSDGKPASVPITEFLTRVESNGDYRD
FT                   ADKLVFRDTFDELQDIVGQLPPELKKRVTDDIAALDQIQALYQKEISATFGKFATRAMP
FT                   VRREAWTKYVEFLKTKYARERILKEHDATLPPTETRGAIKAKRRDEIFGTELPPKTILL
FT                   TFDDGPHPKYTDQVLEILKAHNIQGVFFEVGKNLGTVDDKGEVKLTPTAKAAYRVLEHG
FT                   SAIGNHSYSHPVLPKLDAAKQTEEIQSTNKLIAYVQKSDPTVFRPPYGAVNDAVLKVSE
FT                   GDKLKAMIWNIDSMDWADPVPSSIVQRVLDEVKKQGRGIILFHDIHKQVISVLPTLIDE
FT                   LEKDGYTFASWNGTEVTTGMRGTQVASEPPPVQSMYHDSWAAVIGIDDYKNWPKLRYAA
FT                   NDATAVRDVLVDKYKFKPDHVFLLTNEQATRQNILSLLGDKLGNPDMVNKDDRVFVFFA
FT                   GHGATRKLASGRELGYIIPVEADLSSYEGQAISMTNFQDIAEAIPAKHLLFVMDSCYSG
FT                   LALTRGAPMANSQNYLQEIARREARQMFTAGGADQQVADGGPNGHSVFTWTLLQALDGR
FT                   ADLNGDGVITASELATYVSPAVSALSQQTPSFGNLPGSQGGDFIFELKHESEFLESNST
FT                   QLNDDAIRLNSEIEKLRVANDEKERQNEQLRQEIAALKAGKETVAMVTRGAAEPSSPKS
FT                   AFALNDEGMRLYKEKKYEEALAKFKEAAELAPTNALFANNTGFAFFRLAKYAEAAEWYQ
FT                   KSITIDPSRAIAYVNLGDADLKVDKRDDALKAFQKYLELMPNGKSAEYVRAKVSELQGK
FT                   "
FT   sig_peptide     complement(302544..302603)
FT                   /locus_tag="Acid345_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.871 at
FT                   residue 20"
FT   gene            complement(302759..303319)
FT                   /locus_tag="Acid345_0288"
FT   CDS_pept        complement(302759..303319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39293"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV07"
FT                   /protein_id="ABF39293.1"
FT                   /translation="MILAAAAAIMGAAVGAAITWRLGRPSRELAAQVSHTQQHLAKLED
FT                   EYSRWEMVRHLAPRTFLQGEPPETQEVVLESEDEFRITSVAYLTGSGRPVVTQPIDLRG
FT                   RRVAHAVDDQYVRAVLRMESNPWDGSGTVQLRFRAILGDLEKDIVFVASVLPEFRLGPA
FT                   GRMMEYRRVVDPRAVPSASAMVN"
FT   sig_peptide     complement(303269..303319)
FT                   /locus_tag="Acid345_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.958) with cleavage site probability 0.644 at
FT                   residue 17"
FT   gene            303445..305862
FT                   /locus_tag="Acid345_0289"
FT   CDS_pept        303445..305862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0289"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39294"
FT                   /db_xref="GOA:Q1IV06"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV06"
FT                   /protein_id="ABF39294.1"
FT                   /translation="MNNLLQDIKFGVRTLLRSPSFTVVAVLTIALAIGANTAMFSVINA
FT                   VLLRPLPYNQPDRVMAVWQYDANQQINAFTTPNFVEWKRQGGIVAQLSAFTSTAFNIAD
FT                   QDVPERVAGGNMQYELLPNFGVQPVLGRNFTPEEDSLNGPPVAILSNAMWRTRFNSDPN
FT                   ILNQTIKLDSVAYTIIGVMPANFYVLNRNELLWTPLKLNPTDPSKSRRIHWMWGFLRLP
FT                   DGMTKKQGDAEVNAITARLKAQDPSGDASRGLQLQSMPEFVYGDVKPALLLLMGSVGLV
FT                   LLIACANVINLLLARGAARRSELSVRSALGAPRARLIRQLLTESLVLSICAGALGLGLG
FT                   ALALKSLLAMHPTNIPRVEEVRIDGWVLGFTFLVSLLVGVIFGLAPAVTASRANVAEVL
FT                   KDSMRTSSGRIGRQRSVFVFAETALACMLLIGAGLASKSIWKLQKVDPGFNPHNVSVLR
FT                   VSAPRSLLPAQLPEFYRRIFERVSTLPGVEAAALGRDLPMSGAADPSMPITIDGNTPAL
FT                   AEGEVITRFRSITPNYFRTLQTPVLRGREFADTDTSTSQPVAIVSKSLADRYWPNEDPV
FT                   GKRLKPEIPDAPYYTVVGEVADVRHWSLDIQVEPTAYYPYTQLPPSIVALFQKNMSIAV
FT                   RGTAGGIVPSVRAAVGEIDKTVPVFNVHTMDELFSDSGSLRRFDMALLLSFAGLALVLS
FT                   AIGVYGVIAYSVAQRTREIAIRMAVGAQRKDVFELVIAQGAKVAGVGVVAGVIGALLLA
FT                   KVMSSLLYEVNPRDLLTFCTVPFILMVVILLACYIPAHRAASVEPNTALRYE"
FT   sig_peptide     303445..303558
FT                   /locus_tag="Acid345_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.694) with cleavage site probability 0.286 at
FT                   residue 38"
FT   gene            complement(305864..306547)
FT                   /locus_tag="Acid345_0290"
FT   CDS_pept        complement(305864..306547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0290"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39295"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV05"
FT                   /protein_id="ABF39295.1"
FT                   /translation="MRLNLSSSAPHIHPAFDWNPDVGTDELVMYRNPEFRVEGGLRECK
FT                   RGKRSFKFVEDELWLVMHGFAQFRRDSGEVIDAEPYVAVHFKEGWTGEAEIGEDMRMSY
FT                   MRCLGEPGEITPVLRDVANVGPLADWGAVSTRIIGISEKYGIQMSRAVAPRRAETGIWS
FT                   CTPGTWRCEVKSDEFCHFLAGNSLYTNDNGEQIEIVPDTLAFFPAGWKGICEVRETVRK
FT                   VYMIR"
FT   gene            complement(306628..308268)
FT                   /locus_tag="Acid345_0291"
FT   CDS_pept        complement(306628..308268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0291"
FT                   /product="cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39296"
FT                   /db_xref="GOA:Q1IV04"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV04"
FT                   /protein_id="ABF39296.1"
FT                   /translation="MQVSRTRSISVIGISLLLAVFAIAQNKAFHNAPASAAATKNPVAG
FT                   DAAAIKAGKNIYSQNCAACHGPDGAGTGNVPSLKTGKAQEAKDGELFWFITNGDENNGM
FT                   PSWKGLPQRQRWQVVRYIRAMKTAGAAAPASAAASTTTASLPKASGNGPFIDYRDEKPG
FT                   TVRKITAKDLPPPYATKSAGNGPHVVPRPQNAWPQVLPDFKIDVFASNLNNPREIVTAP
FT                   NGDIFVAETEPGNIKIFRGMTADGKPQQTSVFLSGLKEPFGIAFYPPGPNPEWIYIGNT
FT                   NAVVRYHYTNGDLKARGEAQKLVDLPTGGHSTRNVRFSNDGKTMFIAVGSESNVDDPEE
FT                   NTGEKNRANILAANPDGSNVHVFAAGIRNPVGLAVNAQTGELWTSINERDALGDNLVPD
FT                   YITHVQEGGFYGWPYYYIGGNQDPRHKGKHPELKNKVIVPDVLIQPHSASLGMTFYNGK
FT                   QFPAEYQGDIFACEHGSWNKAVRVGYEVVRVPLHQTNHATGEYEDFVTGFVTPDGNVWG
FT                   RPVGVTVAPDGSLLITDDGSNAIWRVSHK"
FT   sig_peptide     complement(308194..308268)
FT                   /locus_tag="Acid345_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.941 at
FT                   residue 25"
FT   gene            complement(308620..311331)
FT                   /locus_tag="Acid345_0292"
FT   CDS_pept        complement(308620..311331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39297"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV03"
FT                   /protein_id="ABF39297.1"
FT                   /translation="MLLGFLRRLVFIGLFVPVIAAAQPDAAGCDLAFDPKTKPNLTFSD
FT                   PNNADVSALLTTGYVDPAKNADAFTSALALAKEKQDKCGEALAEYGIAAATDRAKNADI
FT                   QQHLKNAVDRFAEIGATHALAQSRYMLAQSLRRSSKPEEAAALAMQSSKDFAATGNQGR
FT                   ALEVQVSAILMNQASPPEAEIKALIDQAHALHLPGSESAILHLWGDNDFQAGHFADAFA
FT                   HYEGARKILKECGCDNQVLGTLLVSMGRLERMQGQPKIALKHYDEALRIQNAIGDHEYA
FT                   IQTMNAIAVAYEAMEEHPKALAQYEKALAQAKAIGAEQFIPFLEGNIGGELLRLKQYDR
FT                   AAKQLQMVIAKKPSEYQLCFRENQLAGAFFHLGRKEEAYDAAEAAVNVCRKNKNQDNLA
FT                   DALETRAGVATEKQGYEHALADIREAMAIREEIRSHLVPDDARKQGYNERIQDLYDVSI
FT                   EVLTKMDRQREALETAEKGRARAFLDLMGTQQAGDSHEVKNVVINDPSFASYVSAAPFS
FT                   TQQMVEAAKRYKSTIVSYWATNDALYIWIVSQNDDVHEVRVPVERKRLAALVARTLKNE
FT                   PVKEKAEVPVQSAAARGAKEVGTEAQGSSAWRTLYKLLVTPVERYLPREQGALLTIIPH
FT                   HELFRLSFAALTDAKGQYLLERYALHTVPASALLQYTRENEQRAEKQTQHYLLVANASG
FT                   VKLSNGVTLPELPATLREVKAIEKLLPPDAVTAFANAGSSDAAVNDALRGATVVHFATH
FT                   AVLDDADPRQSFLLLYPSATTHEPTRLTSGDIYKLKLHTKLVVLSACRTGLGKITGDGI
FT                   DGFSRAFFYAGTASFVATLWDVADEPTSALLPHFYRELNAGRTRAVALRNAQLAVMRDL
FT                   RAGKLKAKTALGPVTLPESPLLWAAFSLSGEP"
FT   sig_peptide     complement(311263..311331)
FT                   /locus_tag="Acid345_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.953) with cleavage site probability 0.717 at
FT                   residue 23"
FT   gene            complement(311354..312193)
FT                   /locus_tag="Acid345_0293"
FT   CDS_pept        complement(311354..312193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39298"
FT                   /db_xref="GOA:Q1IV02"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV02"
FT                   /protein_id="ABF39298.1"
FT                   /translation="MRQRMNDFDSDEKDFVSRVTLPACPEVGMLHAAHEGVLADAETKQ
FT                   IQEHLSSCEVCRTLFDDLDAIEYGELSPAESASIRVRIARNAPRAFEPARKWWVPALAV
FT                   AAAAAIAFVLIRVPKPETPAQGPLIVYVKPPQEIKVEKLPIRVDPTSLLATRGGNGSQP
FT                   SGPELAKALAKYQGDDYASAVQQLKALAQKYPKDGTVRLYLGISELLLNQNKEASADLS
FT                   AAANELEGGRQSDAQWYLAAASLRLKDHEAAQPLLQQLCEGKSTYTERACKLESELK"
FT   gene            complement(312174..312671)
FT                   /locus_tag="Acid345_0294"
FT   CDS_pept        complement(312174..312671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0294"
FT                   /product="sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39299"
FT                   /db_xref="GOA:Q1IV01"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV01"
FT                   /protein_id="ABF39299.1"
FT                   /translation="MIEDFEQVYKKHSASVFRLALRCVGRRDIAEEITSEAFLALYKNF
FT                   AKIDTTQLPAWLFTVAKRRAADYWRRMPHDQTSLDDIDPAAPHKEPQLGLNDLFRKCSS
FT                   LTPLHRVCVTLRYVHGLTRAEIAAKLGLSETQVKGHLQYALHLLRTALTGGKEPAHATT
FT                   DE"
FT   gene            312948..313667
FT                   /locus_tag="Acid345_0295"
FT   CDS_pept        312948..313667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39300"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IV00"
FT                   /protein_id="ABF39300.1"
FT                   /translation="MKLSRGLLLVPVCALLVIGGCKKKEAQVETSQPNTRTSGTPTLAA
FT                   RPAVPNEAATASSATSTVAAPGLSAETTAKLEGAAWAMKQDEILHDANGQWAASAEASS
FT                   TFHDAKDQESFSSWQASGAPNVEHESDDPHSWASKTEDGGIEWLDLKYGKPVFATAVRI
FT                   RESNAPGAIIKVDLYDEAGAAHSIWQGTDPTKGLNYFMLNFPKTSFKVARVRVTLATNI
FT                   VPGWNEIDAVQLVGTEQ"
FT   sig_peptide     312948..313019
FT                   /locus_tag="Acid345_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.622) with cleavage site probability 0.607 at
FT                   residue 24"
FT   gene            313689..315869
FT                   /locus_tag="Acid345_0296"
FT   CDS_pept        313689..315869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39301"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ9"
FT                   /protein_id="ABF39301.1"
FT                   /translation="MNDRSFSFRNARWAFLLFAALFVCVLAAAQNAPRGSYVFQRDSDG
FT                   GKADAGNSLTITFDESGNIQLSGSGAQSLSVTGEYQVFGETITLSIPAVSKSVSRRPFS
FT                   LSGDTLTLPFKIFSDGPGTSTWKATTQTAHNGGTGKSGGSGGGSGAGSGSGSGSGGSGS
FT                   GSGGGSGSGGGSGGSGGSGGGGGAGGGGGSGGSGGSGGSGGSGGNGGSGGSGGSGSGGS
FT                   GGSGGSGGGKGGGKSGGKGGRPAVTAPWQDSPYAKWMGDWVGTGWGWETRFKSSDVGTN
FT                   PGGGHDMMTLTVRHLTRFHYTVDKNGQIEGDGAITYDLDPNLCGVYRAAQQVNMAIDVM
FT                   KSINEAPSKMRKLVEQANNLFTMKTVREYTDFQGQIEKMANSVKDEGKKRATDTVKNYV
FT                   MEGLGAKAEDTQDLAKNVIYQRCMQNVPVVVFDSMVCESVKDPKAKGPSNAGEFVFKAL
FT                   ADKAAGNPQPDYWNQAVTAISDPGPLVDEAKEALKKKTIKALNVFDVKQKPGKDECSGV
FT                   PSTQKAGTSMNNVTMNDLMQSWAETMEGMATAGASGDVGGVMGSATDLIMNAPGVTKVQ
FT                   YDYKGLKNGPESRRFKITGYIEGDKAYLRMDGDTYGGDKELYVEYTVNWQKGGGKFPTW
FT                   SPFIDEEGGDVQAKGKMKGLSRKTVACSADDLKKDPKCQPKEELVTVEENSSTPFAIYH
FT                   KTGEHRGGVKPWHEYEYYWRAQRVTAPLPPSK"
FT   sig_peptide     313689..313778
FT                   /locus_tag="Acid345_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.864 at
FT                   residue 30"
FT   gene            316370..318811
FT                   /locus_tag="Acid345_0297"
FT   CDS_pept        316370..318811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0297"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39302"
FT                   /db_xref="GOA:Q1IUZ8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ8"
FT                   /protein_id="ABF39302.1"
FT                   /translation="MRAALQDLKFALRTLKKSPGYVIAALVVMALGIGANTSLFTVVNA
FT                   VLLRALPFGHPEQLVVLWHTPPQSSFPGVKIFPLSAANYLDWEKQNTVFTQMAVSSYRT
FT                   MNLTGNGEPLSLPDEAVSKNYFSTLEALPMLGRTFVPEEDADGKNKSVILSYPLWKDTF
FT                   GGDPKIVGKQITLNNQAYDVVGVMGPEFRYPSFARIWTPLGMTPKEAVVRGEHHYRVIA
FT                   RLKPGVSLHQAQADLSTIAKQLEQQYPADDKGWGAAVVPLREQMVGDVRPTLLVLLGAV
FT                   VFVLLIACANVANLTLVRTLGRSKEMAIRTALGAGRNRIIQQVLAESMLLAIAGGAIGV
FT                   ALSQFGTKLITNVLADQLPRTFQVHMDVTVLFFTLGLVLLTGLAAGFVPAWKATHSNPN
FT                   DALKQGLGRTDSDGGGKTRNVLVVVEVALSLVLLFGAGLMIRTLWALHAVNAGFDPENA
FT                   LSMSVIVGPNKLPNEVAQAQYYQRIVERLRAMPGVQNAGTVDSLPTQGGSMQPVGLEGH
FT                   PVVAMADQPEVNVRMVSPGYLATMRIPLLQGRMIADADNEHTHPVAIISQAMAKRFWPG
FT                   QDVIGKHLTLTFQGDTQLEIVGLVGDVRQSGLDSNEDDATVYYPSAQLIFPPAYTWHSF
FT                   PLSLVVRTAGNPEAMQPAILAAIHEIDSEVPVTEVMTLNQVLGESIAQQRFTMILLEAF
FT                   AGLALLLAAVGIYSVLAYSVRRRMRDIGIRMALGALPSQVLRMVVMEGMRPTIIGVVIG
FT                   LASAMAIGRLLKSVVFGVKTTDFATFVAVSVVLLFIAVMASLLPGYRAMKVEPMKTLRE
FT                   E"
FT   gene            318924..320195
FT                   /locus_tag="Acid345_0298"
FT   CDS_pept        318924..320195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ7"
FT                   /protein_id="ABF39303.1"
FT                   /translation="MACLSVLARISAALIFLTLVVPSVAQSANRTAAAGTVTVQSLSLL
FT                   DVVDNLDETSCSAAPRLGTAAFECVGLAGRSHGQSCLIDHILIGDRLDGPKELACVKSC
FT                   PGGERNSDACENFPCINRLAGRPYFKTFAALPADVKTRLAADYNTLIQLVRAEGTPQYA
FT                   ALGGDSKRGAVKRDILGIVLKGLLDVDSGKDIGPGEMLPFGECILERASTREKVNGLEL
FT                   HPSKRYGQAPRVNTGNPADASPMDTSANGNLNVYESAFLRCSRVSPDLSKCLAGQITAE
FT                   FPDLLAGEILHELVHFNQFKFGHEMIAKDNVPDDAKSILDEIMAYGVSREHLYYRQGLS
FT                   PANVALLTGAGMKGQVAEFQNAWRDLGEDRQEEVALWAHHTYAWMRARLTSPNRPADEG
FT                   RTWSLMCSAIARHNQKKHTIIPCY"
FT   sig_peptide     318924..319007
FT                   /locus_tag="Acid345_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.652 at
FT                   residue 28"
FT   gene            complement(320199..321077)
FT                   /locus_tag="Acid345_0299"
FT   CDS_pept        complement(320199..321077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0299"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39304"
FT                   /db_xref="GOA:Q1IUZ6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ6"
FT                   /protein_id="ABF39304.1"
FT                   /translation="MSTDKLGGTFTLPGTDITLHRMGYGAMQLAGPHVFGPPKDRAACV
FT                   AVLREAIAAGVDHIDTSDYYGPHVTNQIIKEALHPYPKNLTIVTKVGGRRGDDASWLPA
FT                   NSPDELRQAVHDNLRNLSLDVLDVVNFRAWGFGEKPGEDSIAQQITVLAELQQKGLIRH
FT                   IGVSHVSPKQLEEAQAIVPIVGVQNLYNLAIRHDDKFIDDLAANGIAYVPYFPLGGFTP
FT                   LQSSTLNEVAASLNATPMQVALAWLLHRAPNVLLIPGTSSIGHLHENLAAAELQLSPEA
FT                   LDKLNSIAVAA"
FT   gene            321148..321792
FT                   /locus_tag="Acid345_0300"
FT   CDS_pept        321148..321792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0300"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39305"
FT                   /db_xref="GOA:Q1IUZ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ5"
FT                   /protein_id="ABF39305.1"
FT                   /translation="MPRLVRTALQPRKTPVQARSAVTVDAILEAAIQVLVDAGKERLTT
FT                   TQVAYHAGVSVGTLYQYFPNKSALLQAALRRHLESVSAEVLKVCEEYRSMGLLEMGAAV
FT                   VDVYIDAKMRHVKESAALYAVSSDVDGMAIAKAAAARARRSLVELFVTAKEGLRKDPEL
FT                   IATSVSAAMNGFARALLESKSPEREVETLRGELLALVQAYLRTCVKSPITI"
FT   gene            complement(321964..322040)
FT                   /locus_tag="Acid345_R0002"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(321964..322040)
FT                   /locus_tag="Acid345_R0002"
FT                   /product="tRNA-Pro"
FT   gene            322143..322697
FT                   /locus_tag="Acid345_0301"
FT   CDS_pept        322143..322697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39306"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ4"
FT                   /protein_id="ABF39306.1"
FT                   /translation="MCCMQSLQYALVAYVRSPIGIFVEQLRREIHPEHAHLAAHVTVLP
FT                   PRPLRGTEADALAEVQRMAEAHPAFEIGMGEVETFAPSTPTIFIRVARAAYRMRELHDA
FT                   LNTGVLQYDEPWPYMPHMTIAKLNCLPDAESLVDTARARWRDYKGSKEVVIDNLAFVRG
FT                   SGHTWFDIAEFSLQAAAKMPR"
FT   gene            322804..324072
FT                   /locus_tag="Acid345_0302"
FT   CDS_pept        322804..324072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0302"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39307"
FT                   /db_xref="GOA:Q1IUZ3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ3"
FT                   /protein_id="ABF39307.1"
FT                   /translation="MNVGVYGSGYLGTVVSACLADLGMPVTCYDADTTLVMDSAQGTLR
FT                   FHEKNLKEIVRRNVRADRLMYTTELESVARRAGAIFIAEDTPDEIEHIVPELAAVAQPH
FT                   AVFVIVTPTPVGTTRRIETELRMRSYKQHVVVQPMFLTDGCAVEDFNWPDRLVLGTTSH
FT                   DAVDVMKQIYRPIVMRGVPLIVTSYETAELVREASTAFVATKLSFINELASLCDHVKAD
FT                   ATDLALAMGLDKKIGPRCLQPGARIGGAFVENEMNALASLAEEFGVSLKVLTAAREVNH
FT                   DFSDQVMEKLTSLMPSVVGREVGILGLAFKPNTNCVAGSVSLSLARGLISRGARVRAYD
FT                   PVAIPEAQRELNDVVHFCQTAYEAAEGSDALVVGTGWPEFRALDWQRVKKLLKTPVVFD
FT                   TKNMLDAGRLRNMGFRYLGIGRS"
FT   gene            324176..324598
FT                   /locus_tag="Acid345_0303"
FT   CDS_pept        324176..324598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0303"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39308"
FT                   /db_xref="GOA:Q1IUZ2"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ2"
FT                   /protein_id="ABF39308.1"
FT                   /translation="MQRTASAHWEGGLKDGKGSVSTASGVLKQTQYSFATRFENGAGTN
FT                   PEELIAAAHAGCFSMAFSAELGKAGFTPTSIDTSATLTLDKTDAGFTITAIHLDVHAKI
FT                   PNIDQAKFEEIANGAKKGCPVSRVLNATITMTAHLS"
FT   gene            324729..325814
FT                   /locus_tag="Acid345_0304"
FT   CDS_pept        324729..325814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39309"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ1"
FT                   /protein_id="ABF39309.1"
FT                   /translation="MQITIFGLTISSSWGNGHATPYRALVRALHHLGHSVTFYEKDVPY
FT                   YACHRDMAELPYCELVLYPEWSIVRHFALKQAAESDVVIVASYCPEGARIADEVLGLRR
FT                   PLKVFYDLDTPVTLANFQSQGKTEYLEPRQITEFDLVLSFTGGKALRRLETEFHAQLAR
FT                   PLYGCVDADSYHRVPASPALLCDLSYMGTYAPDRQEKLDALFLEPSRRSLGMHFLLAGS
FT                   LYPWGWSWGENVKKLDHVAPSDHPALYSSSCATLNITRRDMAESGYCPSGRFFEAAACE
FT                   CPILTDTWEGLETFFTDDEIVRVHNADEVLTAMRADLREHARRARQRTLDGHSGMRRAQ
FT                   QMLAYFDEAVARGRRARTEVA"
FT   gene            325811..326569
FT                   /locus_tag="Acid345_0305"
FT   CDS_pept        325811..326569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0305"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39310"
FT                   /db_xref="GOA:Q1IUZ0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUZ0"
FT                   /protein_id="ABF39310.1"
FT                   /translation="MIGIIPAAGAGQRIQPLGCSKELLPVGSRMIDGVERPKAVAEYLV
FT                   ERMIAAGAEQICMVISAEKSDIVRYFAERNYAAEIFYVVQQKPAGLCDALFRAEPFART
FT                   HRNVLIGLPDTIWFPENAYRPAVEDQKADVNLVLFPVDDPTVFDAVVCDAQNFVEKVEV
FT                   KQKDAHSQWVWGAVTCTGESFHALKLLWESRHREDEYLGHLLNAYIAAGDAVRATHCGE
FT                   LYMDVGTLDGYHRALDYLRAKRQARVEPAA"
FT   gene            complement(326582..326830)
FT                   /locus_tag="Acid345_0306"
FT   CDS_pept        complement(326582..326830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39311"
FT                   /db_xref="GOA:Q1IUY9"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY9"
FT                   /protein_id="ABF39311.1"
FT                   /translation="MSSQPAQPSMTEKAIQGETIAQMRTLAHDLSNSIETVMQASYLLA
FT                   QATLDDTNKRWVELIDKASRDAARINREIRDILRAHS"
FT   gene            327098..327184
FT                   /locus_tag="Acid345_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            327098..327184
FT                   /locus_tag="Acid345_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(327364..330534)
FT                   /locus_tag="Acid345_0307"
FT   CDS_pept        complement(327364..330534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0307"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39312"
FT                   /db_xref="GOA:Q1IUY8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY8"
FT                   /protein_id="ABF39312.1"
FT                   /translation="MPGFFENLRERWNRSTAPSQQNAEASPTAKQEENHIWISRNLSTI
FT                   LFVTIVLCVAGIYSTFSVPISVFPETDFPRVVIGVDNGVMPVEQMQVTITKPIEDAVNS
FT                   VPGLQTVRSTTSRGQAEVSLFFDWNEDMFHTLQLVDAALGKVQQELPPTARLTTNRLTF
FT                   ATFPILGYSLTSNTVSQERLWEIATYDLKPPLNRLPGVSTVVVQGGDVPEFHIVPDPAK
FT                   LISTGVTITDLSDAVKKSNVIDSPGLYEANHQLVLGLVGGQVHDAAGLAAVAVKITTAG
FT                   VPVHIGDVASVQQAAQPKYTIVTANGKSAVLINIARQPSSNTVAVADEVAAEMAVLKRN
FT                   LPRGVDVQPFYDQSSLVREAIKSVRDAIVIGLVLATIIIVLFLRDWRSSLVAGLVIPVT
FT                   LLVTILFLRFTGQSFNLMTLGGLAAAIGLVIDDAIVVVENIVLHRDSGQGRIEAVRSAI
FT                   REITVPLIGSTITPIVVFLPLIGVTGVTGSFFRALALTMTVSLLTSLALALTWTPSLSL
FT                   IILRARPQRKDVSSDEDPHGHGPWMGKVIAWHRRALELALRFPARLLLICGGMVLLGII
FT                   GYAKLGTDQLPEMDEGGFILDYTMPAGSSLSETDRVLRHVEEILKAAPEVESTSRRTGL
FT                   QMGLAAVTEANYGDFTVKLKDKRSRGIDEIMADIREEILKTEPELDVEFTQVLQDMIND
FT                   LANAPEPIYIKVFNPDPAILSQVAPRIADTIKAVPGVVDVLNGVDNTISGPATNFQVNP
FT                   AAAARMGFTAEEVSTDAAAIIEGVNTETPIIQNARPYAVRIRYAAEHRANFDAITNTII
FT                   NSSTGKIATLGSVATVQQLPPQNEIRRENLQREVNVTAKLEGSDLGGAIKRVQTAVAGL
FT                   HLPPNIRLQYGGTYEEQQKSFRELFQVLLLSLALVFAVLLTEFRDFWAPTAILMSSALS
FT                   VIGVIVALLITGTTFNVSSFMGLIMVIGIVAKNGILLIDADQRFRREGMSPYDAMVNAS
FT                   KRRLRPIAMTALAATTGMLPLAFALGAGSQMLQPLAIAVIGGITISLFLSLIVTPTMYF
FT                   LLTRHKAH"
FT   gene            complement(330534..331799)
FT                   /locus_tag="Acid345_0308"
FT   CDS_pept        complement(330534..331799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0308"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39313"
FT                   /db_xref="GOA:Q1IUY7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY7"
FT                   /protein_id="ABF39313.1"
FT                   /translation="MKTLLLFATTSLFLLAGCSKQEKAPTPEVEVQAEAVAAHEITLHV
FT                   QGDAVLFALQQAAITPKVSAPVRKFFVQRGARVHRGQLLARLESRDVSAAAEDARGGFQ
FT                   QAESSYKTATQAAVPEEYQKAELDYEQAKTNLDVQQKIFDARQKLFQEGAIPGRDLDTA
FT                   RLNLVQAQSQFNEASKHLESAKAVTREQSMRNAEGQLQSARGKLQVAEASVSYTEIRSP
FT                   IDGVVTDRPFFDGEMTTPGTPLITVMETSSLLAKAHLPQAEAQQLKPGDDATVTVQGLE
FT                   KPVPGKVTMVSPALDPGSTTVEVWVKVENKEGALKPGTAARVAIAARTLKDALTIPSSA
FT                   VLKDDSGKAFVMVVENAMARKRDVQIGITDGDDVQIVEGLKAGEQVITTGSFGLDDKTK
FT                   VKVVAAEKASDSADDKKSEGKD"
FT   sig_peptide     complement(331728..331799)
FT                   /locus_tag="Acid345_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.970) with cleavage site probability 0.527 at
FT                   residue 24"
FT   gene            complement(331796..333172)
FT                   /locus_tag="Acid345_0309"
FT   CDS_pept        complement(331796..333172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0309"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39314"
FT                   /db_xref="GOA:Q1IUY6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY6"
FT                   /protein_id="ABF39314.1"
FT                   /translation="MFKLNSQLITGLTLALCALVEASAQTNPAQSPMPTQSTDPPTITL
FT                   QDAIALAQKSEPGYATAVADHVVAAADRTIARSALLPQVQYNNQMIYTQPARLAHSSEI
FT                   PPGAGQLPRFIANNAVHEYVSQGLVSETIGLSGIAAYEKSNAAAALAAAKLEVARRGLV
FT                   VTVVRRYYDALAADRKLIVAADAAKEGNRFYELTTKLEQGREVAHADVVKAHIEQQQRQ
FT                   RELADVKAEAERARLELGVLLFPDPRSPYLLEQKLNNVPALPDRAEFQAQAEKNNVDLR
FT                   AAMASLRVAEHDVTAAKAGFLPDLSVEYGYGIDAEQFAVNSPDGFRNLGYAISGTVKIP
FT                   VWDWFATPARVKQSKIRRTQAHVELTAAQRQLIADIEESYTEAQTAHASLDSLEQSSND
FT                   TAESLRLTDLRYRAGESTVLEVVDAENTFVQAQNAHVDGAVRYAVALSNLQTLTGSLPQ
FT                   "
FT   sig_peptide     complement(333098..333172)
FT                   /locus_tag="Acid345_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.644 at
FT                   residue 25"
FT   gene            complement(333176..334630)
FT                   /locus_tag="Acid345_0310"
FT   CDS_pept        complement(333176..334630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0310"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39315"
FT                   /db_xref="GOA:Q1IUY5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY5"
FT                   /protein_id="ABF39315.1"
FT                   /translation="MKQLPIRIRLTLWYAGIFTLALVAFGSSVWVLVRERLNDEVQDQL
FT                   ELRVAGVQRFMAAQSSGATLEDMRRALEEEYETEDHAVWLQVLDQDGNWMFRARGMADT
FT                   FPSPSLPRELSPKGRISTGRDGRFHVLMLQKAVSVQDRLYTIEAGASTNGIHHTLEQLR
FT                   NVFLFLVPCFVLIAAVGSYYFSRRALRSVDEITAMARSIHERNLNQRLPPLQTNDELQR
FT                   LSDTLNEMLSRIEAAFTRTRQFTADASHELRTPLSLIRTEAELALRKTRTEEEYRNALG
FT                   HVLAESERTTELIESLLTLARTDSGAEIIQLVPLQTNTFLRHCTEEWAQVMGEARLRLE
FT                   VALPSEETWVSADERLLRRLMVVLLDNARKYTPESGYVRVFAELTDREVTVGVQDNGCG
FT                   IQAEHLPRIFDRFYRVDKARSRGEGGAGLGLSLAKWIAGQHKTEIHVESTPGAGSTFSF
FT                   RLARVANNTANSASPSLDIENSRVIG"
FT   sig_peptide     complement(334550..334630)
FT                   /locus_tag="Acid345_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.962) with cleavage site probability 0.596 at
FT                   residue 27"
FT   gene            complement(334627..335325)
FT                   /locus_tag="Acid345_0311"
FT   CDS_pept        complement(334627..335325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0311"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39316"
FT                   /db_xref="GOA:Q1IUY4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY4"
FT                   /protein_id="ABF39316.1"
FT                   /translation="MRILVAEDEKRLLELLRNGLAEEGHSVITSMNGVDALDIAMSGEF
FT                   DALLLDVMLPGMDGFEVARRLRHKGRQVPILMLTARDAESDIIRGLDNGADDYVTKPFS
FT                   FSELLARLRAVTRRTGPHRSSTLVCEDLTLDSASHEVFRGDRPIHLTRTEFLLLQKLMQ
FT                   NAGRPVSRQSLIGNVWGYDRAIENNTLDAFIRLLRQKVDTQGHPKLIQTVRGFGYSARK
FT                   LSGDDQEFES"
FT   gene            335466..336464
FT                   /locus_tag="Acid345_0312"
FT   CDS_pept        335466..336464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39317"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY3"
FT                   /protein_id="ABF39317.1"
FT                   /translation="MLIPMWRALAAAALLSTLSFGQNVYKQLATYSLPGDTGWDYLTYD
FT                   ESSDRLFVAHGTSILVVSPDGQKLGEFPANGAHGVAIVTDKGLGFSSNGRAGTVTVFDL
FT                   KELKPIQEIKAGENPDAIIYDPYSKHVIVMNGRSKDIMAINPDTKKVDATVPLGGKLEF
FT                   AVAMPGKVYVNVEDTGEIATVDSSTWKAVARWKLPDCEEPSGLAVDRKNNTLFTVCGNS
FT                   KMLVIDAASGKVLATVKTGDGTDAAGFDPGTGYAFASNGEGTLTVVGKKADKWDVIENV
FT                   PTQKSARTMTLDPKTHKVFTVAAEFNPPAPGERRGTVKPGSFKLIVLGPAK"
FT   sig_peptide     335466..335531
FT                   /locus_tag="Acid345_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.578 at
FT                   residue 22"
FT   gene            complement(336532..337449)
FT                   /locus_tag="Acid345_0313"
FT   CDS_pept        complement(336532..337449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0313"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39318"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY2"
FT                   /protein_id="ABF39318.1"
FT                   /translation="MNSPVRFLLSLQPRNLQPNGVPKVVLILLMAIFGIVHISAQEAVT
FT                   SSDANVEARLPDAPSASKPSSSAAFGETVGRAAKTVAQDEVRIIGAPFQKKALVLDAIA
FT                   LGATGALIATDETVAQQVPVSWHQSGLHISDGCTYGTAAVAGGILITGLATHDEHAQRT
FT                   GLLSAEATVDTLLLTGAMKLVFSRERPYTNNSEGNFFAGNFSSGSFPSGHSAVAWTLAT
FT                   VVAKEYPKTPVQLAMYGLAATVSLTRVTAGEHFPSDVVVGSTVGYLIGVFVTNKDKHAY
FT                   QGPAHTKSRIRQVPNAVIEHVSFR"
FT   gene            complement(337549..338019)
FT                   /locus_tag="Acid345_0314"
FT   CDS_pept        complement(337549..338019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY1"
FT                   /protein_id="ABF39319.1"
FT                   /translation="MRFRVSVLVLTLSCLVVGAAVAEPGERKVQRKDLPVAVQKTVDEQ
FT                   SRGAVLKGFSEESENGHTYYEAEMTFHGRSKDVLIDGDGAVVEVEEQVDFESLDLPVQE
FT                   GLIKKAGTGKIGKVESLTKHGHLVAYEAKVVTNGKRSEIQVGPNGNPLDHEE"
FT   sig_peptide     complement(337951..338019)
FT                   /locus_tag="Acid345_0314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            complement(338261..341638)
FT                   /locus_tag="Acid345_0315"
FT   CDS_pept        complement(338261..341638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39320"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUY0"
FT                   /protein_id="ABF39320.1"
FT                   /translation="MKRLKSVLLIAIVILCSGFAAAQGYLSTINGTVADKSGAVIPNAK
FT                   VTVTNIAKGLSHTYTTSQTGTYTAPSLEPGDYTVTAEAQGFGTLSKESLHLEVAHDLRI
FT                   DFQLLPGVAKETVAVEEVAPLINTSNAVLESTFTNEQINQLPLQGRDFQNLVVLNPGVQ
FT                   RRPGGGFLSISSNGNRVEDNNFIVDGIDDNDAYYGTTVINAEGVEGTPATHLPIDAIQE
FT                   FNVQSSPEAEYGWKPGAIVNIGIKSGTNALHGTAYYFHRNSALDARNYFNPGDQPVSAL
FT                   RLHQFGGSIGGPIKKDKLFFFANYEGVRDVVGNPLELNTPVTVPYGDPSISIPDAVAAC
FT                   TADGSCNDLSSSLLKYFPTNPGTANPADPTLQTFDFNNTNREDNGIVKVDYQINEHNNA
FT                   SFRYFIGDSLQVEEAHNVLQPQWLDQAQTRAQVIGASYNWMPKNNVVTQWRFGFNRFSQ
FT                   QIFTVDHTVNPTEYGINSGVTDPLDFGFPEIAISGFNRLGGSSNWPLFTTPNLTYQITE
FT                   NTTWSHGNHSFKFGGEFRTGSTDNLRDLDGKGYVAFRGLERFTTGDYRYGYIKAGDTHR
FT                   VVSQKSFGFYVQDDWRIKPRFTVTGGLRYDVSLPITEQNDLLANFDPAVGIQQVGKQID
FT                   KPYNTDWNNFAPRIGFAWDLFGTGKTVLRAGSGIIYEIPHISLFVSQNSASALGLANIP
FT                   SGANGISVPGGNITTADLKVSDLNWSSAGPIFGDIPSTKLTCDSDTPCSILGVDKNIKT
FT                   PYSLSWNLNLEQQLTRNMALQVAYVGNHGVKLYSIRNINQNQWYYDWVANGMGDPYEDT
FT                   DGYSGRPFANPTLCGTHCFPYLAEVEMLQNKDSSIYHSLQVTLRQHSYKGIDFVAGYTW
FT                   AHAIDQYGSNRSYDWEDPNNGLLERGDASSDIRNRFTLAFTYQTPKLPRYDKAFGGWTF
FT                   NTILNFEGGRPIDLYDGDSAFSGAYTGNDRWSIYGDPSNLKWGFNGLPFIPVGTPQWAK
FT                   TCGPYAPGLLPGIDPGTDYPTTSDYAGGCYAENGTVLVPAQWGQFGNMHRNMFRGPGYS
FT                   DVDMSLAKTFKLTERFSLQVRGEFFNILNHPNFAGLGANLETGAVGIPAYTPDVAESNP
FT                   VVGSGGSRHIQVGAKIVF"
FT   sig_peptide     complement(341570..341638)
FT                   /locus_tag="Acid345_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            complement(341980..342273)
FT                   /locus_tag="Acid345_0316"
FT   CDS_pept        complement(341980..342273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39321"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX9"
FT                   /protein_id="ABF39321.1"
FT                   /translation="MLDVLSFAIGRPAQPPKNPKILVNPLLPVGPDPWVTFHDAYSPGH
FT                   NSFFQTDNGKQDWILYHANSGPTKVAPISDLRARSPSPGIPTAHPTSAHPPA"
FT   gene            complement(342299..343450)
FT                   /locus_tag="Acid345_0317"
FT   CDS_pept        complement(342299..343450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39322"
FT                   /db_xref="GOA:Q1IUX8"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX8"
FT                   /protein_id="ABF39322.1"
FT                   /translation="MRSHRKQQLIGLLLLLVSFTAVAQTPRWTEEKAAQWYKQQPWLVG
FT                   SNFIPTDAINELEMWQADTFNPQEIDRELGWAEGLGMNTMRVFLHDLLWQQDAAGFTKR
FT                   LDQFLGICAKHHIRPMLVIFDSVWDPNPKLGPQHPPVPGVHNSGWMQSPGRKGLEDPAE
FT                   YPRLKAYVQGVVGKFANDQRILAWDVWNEPDNDNKPAYERVELPYKADYVNKLLPQVFE
FT                   WAREMHPIQPLTSGVWRGDYSSLDKAIPTAKIQLEQSDIITFHSYDWPETFEERINWLR
FT                   AYNRPIICTEYMARPAGSTFDTVLPVALKEHVGAINWGLVVGKTQTNLPWDSWKRPYVL
FT                   EPPVAWFHEVFYADGRPYRAREAEIIRNLTSQANGNSGDSGTN"
FT   sig_peptide     complement(343379..343450)
FT                   /locus_tag="Acid345_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(343505..343924)
FT                   /locus_tag="Acid345_0318"
FT   CDS_pept        complement(343505..343924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39323"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX7"
FT                   /protein_id="ABF39323.1"
FT                   /translation="MESASSSSTPIPRPSPFFSACRRAKTSQPPRKAALYRHHHRWRLL
FT                   GQIVSGDLVLLNIVIDTGHDQPETLASYAPKWNADPKGWHVLSGSLDQVQKVCHYFDMN
FT                   YYPDEGLYIHSFHTAILDRKGKLVANLEGNEFTAQ"
FT   gene            344060..346009
FT                   /locus_tag="Acid345_0319"
FT   CDS_pept        344060..346009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0319"
FT                   /product="ASPIC/UnbV"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39324"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX6"
FT                   /protein_id="ABF39324.1"
FT                   /translation="MPPKYNSFSSNRLPEAGTKRRWKPCILAGMSLGILSRSSRDRCFS
FT                   FFLAAALSLLNPHVSAGQEPNAGQGMGVSTSGTHAAVLDNQKRPITAGGFVDTGPVVFQ
FT                   DITAQAGLAAWNHVMGSEKKQFILETVGSGVALLDYDNDGWLDIYVVNGSTYDALNGKA
FT                   DSPHAALFHNNHDGTFTDVAKQAGVTNNRWGFGVAVGDYDNDGWPDVYVTNFGKNRLYH
FT                   NNHDGTFTDVAEKAGVALGGWSTGPTFGDYDGDGKLDLFVPGYVQYDIAHPPVPGSDVV
FT                   AFSTCEFRGIKVMCGPRGLKGEQDHLFHNNGDGTFTDVSEKAGVSDKNGYYGLASVFVD
FT                   LNNDGRVDLAVADDSTPNYLYINKNNGTFEDASYASGYALNEDGHETASMGIAVGDYRN
FT                   NGLLDLYNTVFSDDYNPLYRNDGDGNFTEVSYSMGIAEWTIPFLGWGTVFLDFDNDGWK
FT                   DLLVANGHVYPEVDKSDWGTTFKQRPLLMHNVKGKFELMPAVTGSALASVYAGRGLAYG
FT                   DLFNDGKIDAVINQLAGPPAVLRNVSADKNHWIAFKLVGGPKSPRDAVGAAVYVTAGVI
FT                   RRRDDVLSGGSFASSNDQRVHFGLGESATADAVEIHWPSGVIQKLTSSLPADRYYTLEE
FT                   GKTPVPQTQGNAKP"
FT   sig_peptide     344060..344245
FT                   /locus_tag="Acid345_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.706) with cleavage site probability 0.470 at
FT                   residue 62"
FT   gene            complement(346156..347979)
FT                   /locus_tag="Acid345_0320"
FT   CDS_pept        complement(346156..347979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0320"
FT                   /product="Protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39325"
FT                   /db_xref="GOA:Q1IUX5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX5"
FT                   /protein_id="ABF39325.1"
FT                   /translation="MLDRRDFLKTAGIAAAGSYASRLSAAQAGPSQAHRFTTFNYGDVQ
FT                   LLDGPLKKQFDENHAFFLKLDEDRLLKVFRQKAGLPAPGEDMGGWYDLTGFDLAKGDFH
FT                   GFVPGHTLGQYVSALARCYAATGSEETKAKVHRLVKGYGATLDDKASFFAGYRLPAYTY
FT                   DKLSCGLIDAHEFAHDPDAMAIHEKLTRGMLQYLPEKALSRAEQRARPHKDESFTWDES
FT                   YTLPENLFLAYRRTGNKFYRELGTRFLEDDTYFNPLSEGINVLAGEHAYSHMNAFCSAM
FT                   QAYLTLDSERHRKAARNGFRMVAEQSFATGGWGPSEAFVEFNKGQLGDSLEKSHSSFET
FT                   PCGAYAHFKLTRYLLQTDGDSTYGDSMERVMYNTVLGAKPIQPDGTSFYYSDYATVGKK
FT                   VYHNDKWPCCSGTLPQVAADYHISIYLKATDGVCVNLFVPSTLIWKASDGSCKLTQETK
FT                   YPFETSVAMRFATTQPVEQTLYIRIPAWVTSEPALRVNGQRTDVAAKPGAFAAIRRTWK
FT                   DGDRIDLDLPMGFELQPVDGQHEKLVALVHGPLVLFAIGDSRPRFHRSDLLDAKPSANN
FT                   DWSVRAAGGKQVVFRSFLKIQDESYSTYVEI"
FT   sig_peptide     complement(347902..347979)
FT                   /locus_tag="Acid345_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.989) with cleavage site probability 0.465 at
FT                   residue 26"
FT   gene            complement(347992..349119)
FT                   /locus_tag="Acid345_0321"
FT   CDS_pept        complement(347992..349119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0321"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39326"
FT                   /db_xref="GOA:Q1IUX4"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX4"
FT                   /protein_id="ABF39326.1"
FT                   /translation="MQRIPKVLVLTLLAILTVGMAEAKTNVTKQTFGKVQDGTAVDLYT
FT                   LSDGPYEARIMTYGGVLVSFKAPDKAGKTADVILGFDDAAGFYDNFNGAHNAFFDAIIG
FT                   RYANRIGKGAFTLDGKKYDLPKNDGPNTLHGGPHGFNNVVWQGKQLPNGVELTYVSKDG
FT                   EMGFPGNMTATVKYTLTKGDLRIEYSATTDKATVVNLTNHSYFNLAGEGSGDILKHQLM
FT                   INASKITPVDATLIPTGELTSVDGTPFDFRKSTEIGARINNDDEQLKRGHGYDHNWVLD
FT                   STGGKLAEAAEVYEPTSGRVLKVLTDQPGIQFYSGNFLDGAVKGKGGKPYTHRSGLCLE
FT                   TQHFPDTPNHANFPSAELKPGQKYHTVTVFSFSTR"
FT   sig_peptide     complement(349048..349119)
FT                   /locus_tag="Acid345_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.967 at
FT                   residue 24"
FT   gene            complement(349155..350744)
FT                   /locus_tag="Acid345_0322"
FT   CDS_pept        complement(349155..350744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0322"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39327"
FT                   /db_xref="GOA:Q1IUX3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX3"
FT                   /protein_id="ABF39327.1"
FT                   /translation="MAIVAGVDFGTLSVRVSLVDSERGMLASAVAEYPLHRRSDDPEYA
FT                   TQSHDDHMRSLAEATREAVNKAGVSGDQVEAIALDTTGSSVIPVGKDLTPLGEYYLWCD
FT                   HRSKGEAAEITEAAHREHLAAIDWCGGVYSSEWGFSKLLHWLRHNPDKRAEFVTAFEHC
FT                   DMVAATLAGITDPKKVKRSACAMGHKWLWNPKLGGLPPEEFLVKVDPLLAGVRGKLEGE
FT                   YTQSDHIAGHLCPYWAEQLGLKAGIPIPVGAFDAHWDAIGAGCRTDDMVNVIGTSTCII
FT                   GITPSVNLVPGVCGVVEGSVHPSRTGIEAGLSAVGDIFNAIATRAGTDVATLSHGLDKY
FT                   RAGQTGLLRLTWDNGDRTVLVNPNLRGITLGWNLQSTAQDELFAAIEGTALHTRVILDR
FT                   MAQNGVEIKRVINAGGIPQKNAVLNQVYANVLGRPVLVPSKSVTSLGSAIFAFLAAGTF
FT                   KTVEDAQDKICPPHKMFEPQPSEQAVYDELYALYSELYFAFGTPATSGLGTVLPKLIKV
FT                   SEHARKSAAVTS"
FT   gene            complement(350763..350978)
FT                   /locus_tag="Acid345_0323"
FT   CDS_pept        complement(350763..350978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39328"
FT                   /db_xref="GOA:Q1IUX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX2"
FT                   /protein_id="ABF39328.1"
FT                   /translation="MTTGGISIWFWIGLSLLGNGILIVQAGVREMIHPPANPVVLFQYH
FT                   ANVWWGAVLLIVGLFYCIRFSPRRTN"
FT   gene            complement(350987..352690)
FT                   /locus_tag="Acid345_0324"
FT   CDS_pept        complement(350987..352690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0324"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39329"
FT                   /db_xref="GOA:Q1IUX1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX1"
FT                   /protein_id="ABF39329.1"
FT                   /translation="MSPLLASFVADRLVNLSSTDLVIIVFYFALVLAIGWQLKGQAKTG
FT                   EDFFMAGREMTAWIAGLSFLSANLGSLELMGWAGAAYQYGILAAHWYWIGAIPAMIFLG
FT                   LVMMPFYYISKTHSVPGYLKLRFGEPSRALSAVSFAFMTVLMSGINMYSMALVMKVVLG
FT                   WDINVSIIVSSITVAIYVTLGGLRSAIFNEVLQFILIWAGALLIPIMGLIEAGGWTNLK
FT                   AQITRNASAEYTHLWSTLGKFSDNPMGINWIGIVFGLGAIISMGYWTTDFLVVQRVLAA
FT                   KDMRSAKMAPIIGAAFKMLVPFIVILPGLLALAVLPMKLVGESQAIATHGHSYNEVLPL
FT                   MLARYCGPGLLGLGITALIAGFMSGMAGNVSAFTTVWTYDIYRAMIKKDASDAHYVNMG
FT                   RASTIGGVIISILTAYFVMKFASIMDYVQALFSFFIAPLFATVVLGMLWKRATNAGGFW
FT                   GLLAGTVSSVGMYAWVKLDPSALRYVAMSPDAQAMAENMYRALWSCLICALVTVVVSYA
FT                   TKPRPDAELVGLVKSVTPIPSEGDVPMYMRPAFWACVVAVGFIILQIIFW"
FT   gene            complement(352697..353395)
FT                   /locus_tag="Acid345_0325"
FT   CDS_pept        complement(352697..353395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0325"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39330"
FT                   /db_xref="GOA:Q1IUX0"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUX0"
FT                   /protein_id="ABF39330.1"
FT                   /translation="MLLLQLRAEVLEANLELVRKGLVLYTFGNVSGVSREQGLIVIKPS
FT                   GVPYDTMKPEHLVVTDMEGKIVEGDLRPSSDLATHLALYRAFPEIGGVAHSHSEYATAW
FT                   AQARRPIPCFGTTHADYYHGSVPVTDPMADEEITGDYEMNTGHAIVRTLHKTGAAHVPG
FT                   ILVANHGPFAWGASAMKAAESAAILEYIARIACFTLSINGSSAAIGQALHDKHFLRKHG
FT                   ANSYYGQKKD"
FT   gene            complement(353576..355078)
FT                   /locus_tag="Acid345_0326"
FT   CDS_pept        complement(353576..355078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0326"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39331"
FT                   /db_xref="GOA:Q1IUW9"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IUW9"
FT                   /protein_id="ABF39331.1"
FT                   /translation="MIDLKKFEVWFVTGSQHLYGPETLEKVAEHSREIAGGLDATPQMP
FT                   VRVVFKPVLTTADAVHELCREANNAAHCIGLVTWMHTFSPAKMWIAGLKALQKPFLHLH
FT                   TQYNRELPWATIDMDFMNLNQAAHGDREFGFIGSRMRLDRKVVVGFWQDLEVISELGTW
FT                   ARAAAGWHDAQHLKVARFGDNMRNVAVTEGDKVQAKIQLAYSVDGFGVGDLVARIHAAS
FT                   DRDVDHLVSEYEDTYTLSEPLTAKGKQRASLLDAARIELGLRHFLKDGNFHAFTDTFED
FT                   LHGLNQLPGIAVQRLMADGYGFGAEGDWKTAALVRTMKVMAAGLDAGTSFMEDYTYHLE
FT                   NGGLVLGAHMLEICPSIASGKPSCEIHPLSIGGKGDPVRLVFDSQTGPAVVATIVDVGE
FT                   RFRMVINKVNVIPPEVPLPKLPVARAVWIPEPNLAVAAACWIYAGGAHHTGFSLCLTAQ
FT                   HLQDYAEMAGIECVLIDNDTTVHACKNELRWNDAYYRLTGWR"
FT   gene            complement(355106..355360)
FT                   /locus_tag="Acid345_0327"
FT   CDS_pept        complement(355106..355360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW8"
FT                   /protein_id="ABF39332.1"
FT                   /translation="MLESPAFHGRPVGDPDWRVATKEGTSRCAEPPFHDLFFFCSPHSS
FT                   ALPWTPCHDAKSGKPSLQISSLVRQNGWPTIALDDGTAK"
FT   gene            355532..357187
FT                   /locus_tag="Acid345_0328"
FT   CDS_pept        355532..357187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0328"
FT                   /product="Alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39333"
FT                   /db_xref="GOA:Q1IUW7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW7"
FT                   /protein_id="ABF39333.1"
FT                   /translation="MSTRRDFLRSTAIGAAGLALTRFSLPSLAQSRSVDSRIEVLLDEP
FT                   LGTISPNIYGHFTENLAGVFYDGIWVGENSKVPNVGGLRKAVIDHMRKIKAPVIRFPGG
FT                   CFADTYDWRDGIGPREKRPRRPNFWGNGDPKQNVKHKYDPNEVGTDEFMHFCREIGAQG
FT                   YLAANVRSLPAEQFQQWVDYCNSPAGSTTLAETRATNGSREPYKVEFWGVGNESWGCGG
FT                   DFEPGQYAMEFRRYATWVPGFGMNLKFIASGPNVEDYHWTSGFFEAMQKRMGSLHMVYG
FT                   WALHHYAWNLSRGKTNDWDKGKGEAVNFDATDWYELMKEGQRMEGLIEGHWQVMGETDH
FT                   EHRVKLVVDEWGPWYRPGSEATPGDALEQMPTLRDAVFSGMTLDIFNRHPEKVAMANCA
FT                   QLINCLNSLYLAHEDNFTVTPVGHVFDMYAPHQGGQSLRTIFSSPQVKYERDGTPATFW
FT                   GLRGAASLTGKKLFVTAVNPDTSSPRESEIAIRGASAASGTLTVLSAPDIHAHNTFEHP
FT                   DAVVPRRNELKVNGATVSLVIPPASVVAIELELS"
FT   sig_peptide     355532..355621
FT                   /locus_tag="Acid345_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            357323..358366
FT                   /locus_tag="Acid345_0329"
FT   CDS_pept        357323..358366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0329"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39334"
FT                   /db_xref="GOA:Q1IUW6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW6"
FT                   /protein_id="ABF39334.1"
FT                   /translation="MDIREIAKRAKVSTATVSRTINRVPTVDPKLAKRVWRVVDELGYF
FT                   PNTQARALVSGRSRILGLVVSEITNPFFPEIVQVFENIAVQNNYEILLTSTGHDPVRME
FT                   IAVRRMIEHRVEGVALMTFGMEESLLENLKRRKIPMVIVDVGPPRPLVSNIRVDYQHGI
FT                   RQAVQHLAALRHHRIAFISGPLRLPSARARLDAFKNAMHELDLPAHDELWVEGTHTIEG
FT                   GVEAAGRLLSLPSRPTAIMCSNDMTALGVMRKSHELGIHIPHDLSLIGFDNIHISEFVL
FT                   PPLTTIEMSQAELATLAFNALLAELQRKTPNPNGTEYALETHLILRESTARPKQEADNA
FT                   KKKKAAR"
FT   gene            complement(358380..359153)
FT                   /locus_tag="Acid345_0330"
FT   CDS_pept        complement(358380..359153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39335"
FT                   /db_xref="GOA:Q1IUW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW5"
FT                   /protein_id="ABF39335.1"
FT                   /translation="MLSAFVRRVVVGPKRIRRLDNRRLSPISRSSGEANTKVLPRRNRS
FT                   RRYSYASAGLIPVSGTQANALFWPLMFERFAAEDAEWKPVSTPIIVASAIFYGLFLLYA
FT                   ATNRDGFLFIDNANLAVHEGGHALFGWFGYKIGIMGGTLLQWLVPFLLAAYFFYHRQLS
FT                   GFVFCTFFFFENFLYTATYMADARAEALPLVSLGDSDYVEHDWNTMFGWWGLLGRDTQV
FT                   AGFVRFLGWVGMMSVVAWLSYKYYSDRQNAVAEKI"
FT   gene            complement(359440..359922)
FT                   /locus_tag="Acid345_0331"
FT   CDS_pept        complement(359440..359922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0331"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39336"
FT                   /db_xref="GOA:Q1IUW4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW4"
FT                   /protein_id="ABF39336.1"
FT                   /translation="MYLVSEALRLMKKQPSIQISAADWKILDNYKKNHIDVATKFIPGW
FT                   VKVAVAIALGLGTMVGWKRIVVTVGEKIGKDHLTYGQGAAAEITAMATIGAADWFGLPV
FT                   STTHVLSSGVAGTMAANHSGLQWGTVRNLLLAWVLTLPVSIMLSGFLFWCFRHIAA"
FT   gene            360199..363399
FT                   /locus_tag="Acid345_0332"
FT   CDS_pept        360199..363399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0332"
FT                   /product="Protein of unknown function DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39337"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW3"
FT                   /protein_id="ABF39337.1"
FT                   /translation="MKSSKVELQLCLAIVLCLLACTPLFAAAPTLNSISPKSAPLNTAV
FT                   TLQLVGANFASNSQVYFNGNAVPTTFSSTTVLQASVPAASVATPGNFAVTVTTPSMGTS
FT                   AALMFTSYVALPNNSMAYSAATGQLYVSVPSTAGMPYGNSVVAIDPVTGAITKSIFVGS
FT                   EPNKMAVSADGTVLWVGLDGSSAVRQVSLTAGTAGAKITLGSNTGTNAPPVALSLAALP
FT                   GSPNSFVVSMTAPLGGTVVAIYDNATRRANTWSASTYSGNALQTNATTSEVYVGGPTYY
FT                   QPLSYSATGLSVPRLGSSGNFTGSTDDLQVVNGEVYTDLGALYDAETGARNGSLLNGSN
FT                   LAAGPTFTDTPLGKTFVFDSPTANKYTQVQVFTTSTSALAATFPLNLASNTTGTPSHLL
FT                   RWGTNGLAVRDNVAIYAFRSAQVTNLAGINADLSVTLAQSGTPTTGNSITYTATVKNAG
FT                   PATSTNVAFTAQAPATASIVSITPTVGSCSKLNGLSCNLGSLATGATTTVTVVAKQMLA
FT                   GSVVLNAQVFGSENDPNLANNQASTSVLTITGNPYNGVPTITSISPAAIQAGSGTTMVT
FT                   VTGTGFSTAASILIDGTALATTVLSSTQATAMVPSTKLASLGWSKINVSNPAPGGGVSY
FT                   VLPLSVFKVLSAGANHIVYEPFSRKLIASIGAGGSGFTANSVTTIIPDTATVGTTMLLG
FT                   AAPTSLAVTSDGQALYATLPSVPSVARFNLLAQKLDFTYTVPKGSSFTGTINLRGVSTQ
FT                   PGNVNTVALDLGASNGIGIYDFNSTTKTAALRGSNTGNYTGSCVRYSDSTNLMAFDSDS
FT                   NLTFNHFAVPAAGFAYSNPTQYSTWSLASFNCFQMNGGYAFANKGGAAIPVSAATTEVG
FT                   VFKPIPNVTTSTMQVVAPDVSLHVVFYLAQTHSLSSTSAVDGLVTYNQTTYMPNTTIPM
FT                   GLDLIENTTSFGGVDLVRWGQDGLAALTSTGKIYLLRGGAVVPQLLSTRTAATLTSASV
FT                   TSVTHGSGNLLISVVGTNFQSGMVLTWNGNYRTTNVTDATHATVAIPASDFASIGAGTI
FT                   TAVNAGAPASSGLSITIN"
FT   sig_peptide     360199..360279
FT                   /locus_tag="Acid345_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            363432..364376
FT                   /locus_tag="Acid345_0333"
FT   CDS_pept        363432..364376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0333"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39338"
FT                   /db_xref="GOA:Q1IUW2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW2"
FT                   /protein_id="ABF39338.1"
FT                   /translation="MITRRCFLATSVSAITASLLSEAVPLFGGTTPNIQFPTQPRERIA
FT                   IASYPFRDFIDLPPGEKPEGPQHPRIPLKDFPAHVISKFNVNKVELWTGHFPSAEQSYL
FT                   RELRQALDKAKAKVVNLAVDGEHSPYSPDAEERKKAIAFSKQWIDAATFLGSPSVRTNL
FT                   PDAKGAAPDLNVMAGSLTQVVEYAASKNVVVHLENDNPISEDPFFLVKLVEKVNSPWLH
FT                   TLPDFCNSLTAKPAQYAYDGVNAMFSHAYGMCHVKAMENDRDGKPVHVDMARTFGFLKQ
FT                   HGYKGFCSMEYDSPGDPYAGTSELIETTLKFLA"
FT   sig_peptide     363432..363503
FT                   /locus_tag="Acid345_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.574 at
FT                   residue 24"
FT   gene            complement(364377..365234)
FT                   /locus_tag="Acid345_0334"
FT   CDS_pept        complement(364377..365234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0334"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39339"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW1"
FT                   /protein_id="ABF39339.1"
FT                   /translation="MFAKDLLQGKRALITGGGTGLGKAMARRFLELGATVYICGRREEV
FT                   LRGTCEELTSATGGEIHGIPCDVRDLAAVDTMITQIWNDGPLDILVNNAAGNFLAKTEE
FT                   LSPRAWEAVIGIVLNGTINLTMACGRRWLAEKKPANVLSIVATYASTGSGSGYVVPSAV
FT                   AKAGVLALMRSLAVEWGPRGIRLNAIAPGPVPTEGAFSRLIPSDQLEEIAKQRVPMRRF
FT                   GRPEEIADLAAFLVSDGAGYINGEVVTIDGGEWLQGAGEFNYVGQMMTDEMWAMFKPGK
FT                   KRRE"
FT   gene            complement(365323..366744)
FT                   /locus_tag="Acid345_0335"
FT   CDS_pept        complement(365323..366744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39340"
FT                   /db_xref="GOA:Q1IUW0"
FT                   /db_xref="InterPro:IPR007000"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUW0"
FT                   /protein_id="ABF39340.1"
FT                   /translation="MRKSIAALAGIALAGAVLWLPIVRTVRAEGQPAELKKAYRQPAKN
FT                   GWTYVHIEGTPHELGFQSGYLLANEVQDTLHVVQLEAAHDYKKDWQFFRDAAQNMMWPH
FT                   IEKEYRNELQGIADGATAHGVKIDVWDVVAMNAALEWSYYVKVYDKQHGITTTAKLGTP
FT                   EHCSAFVATGKYTKDGKVVIAHNNWTTYLEGERWTIIYDIQPTNGKRMLMDGLPGFIHS
FT                   ADDFVVNSAGIAITETTIGHFEGYDPNAIPEFVRARKAAQYATNVDDFARIMKDGNNGG
FT                   YANAWLVADERNNEVARLELGLKNVTLERTKDGYFVGSNFPINEKLIKEEASSYDVNNM
FT                   SESSNARHVRWEQLMAENKGKIDLAAAQKFEADHYDTFEKKEDPDERTLDGHIELSPRG
FT                   SGDWVPPFGTAGAVQNKAADSGMIAKMSFSAAAGHACGKDFKAADHLAKHPEYDWQKPL
FT                   QRDMDAYPWTTFASK"
FT   sig_peptide     complement(366658..366744)
FT                   /locus_tag="Acid345_0335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.980 at
FT                   residue 29"
FT   gene            366834..367901
FT                   /locus_tag="Acid345_0336"
FT   CDS_pept        366834..367901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0336"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV9"
FT                   /protein_id="ABF39341.1"
FT                   /translation="MANILYGVNGEGAGHSTRSREVLAHLVKAGHNVHVASFDRGLQNL
FT                   RDEFDVTEIYGFRFAYVNNRVRYNRTIAKNLFTAPKAARSSHHLVKLAEEWKIDLVITD
FT                   FEPLTCHVAHRRHLPVITIDNQHCLTNTLVSYPKEFRRDAAAAKLVCRLMTPRVDASLV
FT                   TSFFVPKVKKAKTFIFPPILRQEILSAKPTEGNAILVYVTSPAPALAKTLAGVRAEFIA
FT                   YGFGREGREANITYKKPSITGFLADLVAAKAIIANAGFSLVTEALHLGKPYLAVPVAHQ
FT                   FEQTFNAYWLQRMEYGAWWDDLNKERVESFLYNLPLYREKLQGYPRQGNDAILAKLDSL
FT                   IEDFTAPRKRAAGPR"
FT   gene            complement(368124..368636)
FT                   /locus_tag="Acid345_0337"
FT   CDS_pept        complement(368124..368636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39342"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV8"
FT                   /protein_id="ABF39342.1"
FT                   /translation="MRTLLHVALLLTASMTAFAQATDAAKPLAAFVGHWEGGGTFVETP
FT                   MSPAGKVASKTDCSWSTQGHYLVCEQTLTDDKGTHQQLTIYTPSDDGGDFTYYTMTGSA
FT                   APFTGKVKIESNVWTYDNSFEQDGKKTEVRTTNTFSGDDETFKTEFRIADGAWTTMLDG
FT                   KSHRAKK"
FT   sig_peptide     complement(368571..368636)
FT                   /locus_tag="Acid345_0337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.530 at
FT                   residue 22"
FT   gene            complement(368665..369318)
FT                   /locus_tag="Acid345_0338"
FT   CDS_pept        complement(368665..369318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39343"
FT                   /db_xref="GOA:Q1IUV7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV7"
FT                   /protein_id="ABF39343.1"
FT                   /translation="MFCSLVMPKLTSEMKQLIPWSMTLGRVLFAPIVIWLALTGRSGWW
FT                   ISACIVAEVVLDIFDGIVARRLGVATPLLRRMDSVMDTIFYLAILYIGWKVHYDVLWER
FT                   RWLLAGLIAMELLRYSFDYLKFRREAAYHMYSSKAWGLLLGAAVIALLGFNISGWLLSA
FT                   ALVVGILCDVEGLVISWLLYESVEDVPHIARALQLRREQRQRRRSTNTFAATAK"
FT   gene            complement(369398..370159)
FT                   /locus_tag="Acid345_0339"
FT   CDS_pept        complement(369398..370159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0339"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39344"
FT                   /db_xref="GOA:Q1IUV6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV6"
FT                   /protein_id="ABF39344.1"
FT                   /translation="MTRAMRIQQFAKETGVTVRTLHHYDRLGLLKPERTESGYRVYGER
FT                   DLIRLQRITVLKFIGCSLQEIKDLVDRNSDDLRTTLELQQEALERRRKTLDGALKAVEK
FT                   ARRLLDESGKADWQTLKSIVETIEMEQNTDWMNKYYSPEAQKDLEKRREELGPEGMQQG
FT                   QKDWELLTADCQQAVKDGVDPKSERAQQLAKRWLGLINAFTGGKPQIAEGLTKLYADRK
FT                   NWPKTAERPWSDELTAFILEAKKAANASNKS"
FT   gene            complement(370214..371173)
FT                   /locus_tag="Acid345_0340"
FT   CDS_pept        complement(370214..371173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0340"
FT                   /product="cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39345"
FT                   /db_xref="GOA:Q1IUV5"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV5"
FT                   /protein_id="ABF39345.1"
FT                   /translation="MVYPYFMATTAVVAPPSTAVRRITQFAWGTLAYNIAVIVWGAYVR
FT                   ATGAGAGCGNHWPLCNGEVIPRGARIETLIEFSHRASSGIAAILVLALLVLCWRALPKR
FT                   HPARVMAVAAAFLMLSEALLGAMLVKLALVAQDKSAMRAISLPIHSTNTMLLLAAIAAT
FT                   AVWLPLDGSSVRWNTKRLWLTIAALAMLLITAAAGVIAALGDTLFPNATISADFSPTSH
FT                   FLIRLRILHPALALLSTIIVAVFVSLTTRTHERAKRFAGLVGIAIVTQLFLGIMNIALQ
FT                   APVWLQMLHLGVADLVWIGTVLVAAESLVSAENFSLLA"
FT   gene            complement(371186..373810)
FT                   /locus_tag="Acid345_0341"
FT   CDS_pept        complement(371186..373810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0341"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39346"
FT                   /db_xref="GOA:Q1IUV4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV4"
FT                   /protein_id="ABF39346.1"
FT                   /translation="MGRILQDLRYGLRMLGKRPAFTLLIVLSLALGIGANTAIFSAVNA
FT                   VMLKTLPVYNPAQLKLMQWTVPTSDFPDAYLEDLEGSFTRVAGGRFGSYSFSYPAYEDF
FT                   AAKNHSFDTTFAFAANEENVNVGLNGHASNATLVGISGNFFSGMGLSPVAGRGLQPSDD
FT                   ATGAQPVVVISHKFWQKQFGGQASAIGGTIDVNGSPMTVVGVAPPEFFGVDPSIEPDVY
FT                   VAMHWYAEQLDKLNNPLLSMADKQAEPNSYLRSRRAWWVGVIGRIKPGVSDATANAELS
FT                   VLFSQALDTKKQSEGGTEGLFGGDGGAPEEHAQAAKKAPPQIGTVPLARGLDSLRRNFS
FT                   TSLWLLMGMVGLVLLITCSNVAALLLTRATSRQKEVAVRVSLGAPKSRIIRQVFTESLL
FT                   LGILGGIGGLVVARWATALLVQLMSSGRSAVHVELAPDATVLAFAFGITFLSALVFGVA
FT                   PAWHAAKVQPLTTLKQTAGSVTNRNFFSGKVLVAVQIALSFVLLVACGLFLRTLGRLQN
FT                   VDLGYQRANMTRFTVSPGLNGYTNDQLIAYYHNMQSQLGAAPGVQAVTFSLHGPIGSGS
FT                   SVTTGRIQGYTPEGKDVDIYRHDVGPAYFETLQIPILLGRGIGEVDGPTAPQVAVINEA
FT                   LAKKYFRGDNPIGHQINLGSVKKPRPYQIVGVARDVKYAQIREEVPPTAYFSYIQRKEV
FT                   PQFMTFEVRSTLPQGTLVALIEKTAMQLDKTVPVEKIHTEEEVVGQVLFLERTFAMLSS
FT                   GFGVLALLLAAIGLYGTIAYTVAQRTNEIGIRMALGADRTRIVRMVLREIGIVVVAGLA
FT                   VGLPVAWFASKTLQSQLFGLSPHDALSLGLALLTIFLVAVLAGSIPARRASRVEPMEAL
FT                   RYE"
FT   sig_peptide     complement(373673..373810)
FT                   /locus_tag="Acid345_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.795) with cleavage site probability 0.273 at
FT                   residue 46"
FT   gene            373884..374246
FT                   /locus_tag="Acid345_0342"
FT   CDS_pept        373884..374246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV3"
FT                   /protein_id="ABF39347.1"
FT                   /translation="MTKRRQGCSGTMRDVRDRTVLQTAGFASGSIWPLPLQAEQSAMRA
FT                   PWQAGHAWFSTNNRDFTPVPEHAGHVTRPEPLQTGHSIPNIVVISRDSRIADLFPHPSK
FT                   TETRNRHRVLASPMAR"
FT   gene            374276..375310
FT                   /locus_tag="Acid345_0343"
FT   CDS_pept        374276..375310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0343"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39348"
FT                   /db_xref="GOA:Q1IUV2"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV2"
FT                   /protein_id="ABF39348.1"
FT                   /translation="MPELRKDPIVGRWVIISTDRAKRPTDFLRERFVHKGGFCPFCYGN
FT                   ETKTPPEILAYRPSNGGPPAQPNTPGWTVRVVPNKFPALGIEGSLNRQAEGMFDKVTGI
FT                   GAHEVIIESPEHLETLATLPEKRIEDVLWAYRDRILDLKQDRRFRYILIFKNHGEAAGA
FT                   SLEHPHGQLIALPILPKHIVEELEGAKQYYLIKERCVYCDIIRQETEAGVRIIAENDSF
FT                   VTLAPYAPRFPFETWVMPKRHESAFENASSKTYQDLARALKQLLMKSDRVLDNPAYNLV
FT                   IHSAPIQDPALDHFHWHIEFMPKLTKTAGFEWGTGFYINPTPPEEAARFLREARVETPQ
FT                   TVGK"
FT   gene            375367..375996
FT                   /locus_tag="Acid345_0344"
FT   CDS_pept        375367..375996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUV1"
FT                   /protein_id="ABF39349.1"
FT                   /translation="MVRAVIANKPMDSEQREMQDRVNLPADAVTVSLWDTLHDGDVLAI
FT                   ESDLLARSLTIVFQVGYVSRFQKLPDETRFVLKFSGVRSVQCLKSASWPGEFTVPPGTS
FT                   REDERKLIDDYHSKWREESFAWGDLERTTGAGLEVSNALLATADAFVALQLGLLVGDGS
FT                   YVDAFIRAERIDFFVGEDSVTLGAFSSLGEAYWEAFANRKPSGSDI"
FT   gene            complement(376523..377554)
FT                   /locus_tag="Acid345_0345"
FT   CDS_pept        complement(376523..377554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0345"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39350"
FT                   /db_xref="GOA:Q1IM23"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IM23"
FT                   /protein_id="ABF39350.1"
FT                   /translation="MRIVAVGIDLGKTVFHLVAMGERNRVLVRRKFSRQQLLAYTANLE
FT                   PTLIGTEACAGAHFLATALCAQGHDVRLMAAQFVKPYRKSNKSDFLDAETIADAVQKEN
FT                   MRFVPVKTDEQLDLQAMHRVRTRLVQRRTALINEIRGFLLERGIIFPAKPIHLRKQLPG
FT                   VLEDATQNLTPRLRWLLSELAEEWKELEARIIAISDAIERISTSDPLCQRLRQIPGFGP
FT                   LVSTATVAAIGNGSSFRKGRDFAAWLGVVPRQYSTGGKTALYGMSKRGNRYLRQLLIHG
FT                   ARAVLIRVKYDTAGLGQWIHKLAERAPRNKVIVAIANKLARIAWAVLAKGEPYRHQPLA
FT                   AAA"
FT   gene            complement(377827..380265)
FT                   /locus_tag="Acid345_0346"
FT   CDS_pept        complement(377827..380265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0346"
FT                   /product="cell surface glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39351"
FT                   /db_xref="InterPro:IPR010620"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU9"
FT                   /protein_id="ABF39351.1"
FT                   /translation="MNPRHTFLPGAAIVATLCASLATFAATPSSPERFNRYGDSPMFFE
FT                   PNVGQSTDVVRFIAHGSRYGLFLTNEGATLDLSRDARHSVAFKMTFSGAAQPGSLSAEQ
FT                   PLPSQSNYFVGDSKNWHTGVANFARVRYSSVYPGIDAVFYGNQRQLEYDFDVAAGADPS
FT                   QIGLHIAGADKLSLTADGALEIHADGRSIVFHAPIAYQQVNGTRHSVASHFVLRGKDEI
FT                   GFAMDPYDKTRSLVIDPTLVYSSYLGGSGDDEGDAVTVDGYGYTYVTGGTVSLDFPHTA
FT                   GAYLKGSAYRIFVTKIKPDGTGLVYSATIGGSKGLYGNAGLQTGRAIAVDDLGAAYVVG
FT                   DVDSTNFPITSDAIEPANATTAGLVGVAFALSPNASRLLYSTYVGGNTYASRVNGVALD
FT                   RSRNAYITGFTSSSGLPVTPGAFQTVAKSGEEAFAAKINPSGSAYVYATYLSGNDTDQG
FT                   TAIAVDGNGSAYVTGWTGCATFPSTPNAFQPTCQGPYDVFVVKLNASGSALSYGTFLHA
FT                   PIDFNLGPTGIALDVHRNAYVVGRANAGLPTTPGAFQASAPGNGDGFVVKLNATGSTEL
FT                   YATYLGGSTGDDFATGVKVDLSGRAYLSGHVIGTTDFPVTANAYQSTLHTFGGPVASTR
FT                   NAFLTRLNANGTGLDYSTYFGTRYALALSLALDLKNNVVLTGLTSYNDIPITANAFDKV
FT                   ASNNGALEAWVAKFSFGTTGTCTPAQSGALICSPVEGDTVGTTVPVTAGATAEPGLYIK
FT                   SIRFYVDNVAKATVSTSGNPTSFETSKSLTLTPGTHRISIVAFQSASVGLTASVTVNVQ
FT                   "
FT   sig_peptide     complement(380188..380265)
FT                   /locus_tag="Acid345_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(380518..381720)
FT                   /locus_tag="Acid345_0347"
FT   CDS_pept        complement(380518..381720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0347"
FT                   /product="diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39352"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU8"
FT                   /protein_id="ABF39352.1"
FT                   /translation="MLRYIARQAILDTRQQTFGYELLYRAAAENFARIGDPDEAARRTL
FT                   DDLLTLGVKELSRGKQLFLNCTHELLAQGFVKLLPTQNLVLEILETVVPDHDLLQSCAE
FT                   LKAAGYSLALDDFIPGPNTLPLVEFADYIKLDFRAMPLEECGALVQQFGKKIEFLAEKV
FT                   ETLEEFTAASDMGCSLFQGFFFAQPALLTMRQIPPMYVNYIRLLDATCKPDFNFAEIEA
FT                   IIKTDVALSYKLLRFLNSAAFCIRSTITSLRQALIILGENAIRRWVAVSAAANAATGKP
FT                   PELLISALLRARFCELLAVGAHSNPYWAFTVGLFSMLSPLLDTPLETILASVQLPDEVR
FT                   AALLGESGQLRTLFELVCGYIEGDWIAITPKCLALGLAQKQVTSCYLEAVRSVDALMAL
FT                   A"
FT   gene            complement(381763..382770)
FT                   /locus_tag="Acid345_0348"
FT   CDS_pept        complement(381763..382770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0348"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39353"
FT                   /db_xref="GOA:Q1IUU7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU7"
FT                   /protein_id="ABF39353.1"
FT                   /translation="MLPVPRFRGPYRHKCRRICSLAIARATAHRLSLGARRKSWNWAVE
FT                   VGTAVIREQLIAAFKLPTAEEQRKFLDCMVLEVPAPQKVAREEAVESNFRGTWFLPEKP
FT                   VDRTLLYLHGGGFACYPKESYAEFLPLIALAANARTFALDYRLAPEHPFPAALDDARRA
FT                   YLCLLELGVDPRRMVVGGDSAGGNMTLSLLPQLRDAGIPLPALGIALSPATEFDVERPS
FT                   LHHDEADWITGRMAETWRDWYCREEERGDPRVSPIHADMRGLPPIYIQAGEAEILYDSI
FT                   VAFAEEAKRQSADVTLEAWEDMNHVFQFFGYNAPQSSAALKRITEVIEQHLPSA"
FT   gene            complement(382840..383634)
FT                   /locus_tag="Acid345_0349"
FT   CDS_pept        complement(382840..383634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39354"
FT                   /db_xref="GOA:Q1IUU6"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU6"
FT                   /protein_id="ABF39354.1"
FT                   /translation="MGSGTRIRPMPSRRTNGLSDHAEADISIWKEALFGAELLLLHASP
FT                   VYYGFGIPRGNGSAVVVIPGFLGNDEYLGHLHGWLDRIGYRVYMSGIDLNAECPNLLIR
FT                   DRLGKTINKAIRETGGKIHLVGHSLGGVIARSVANQRPGDVASVTTIGSPIRGVVAHHA
FT                   VLSAANAVRTQILRDHGSQVLPECYTARCTCEFISSLKASIPENVMETAIYTQDDGVVD
FT                   WRYCLSNNEEANFEVPGTHIGLAFNASVYSIVAKRLQLANSK"
FT   gene            complement(383899..384822)
FT                   /locus_tag="Acid345_0350"
FT   CDS_pept        complement(383899..384822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39355"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU5"
FT                   /protein_id="ABF39355.1"
FT                   /translation="MPTETHDPMAHARPSSLISLLSGWVQQGMESFFATQRILVDVAMR
FT                   QNAAAMKAMRENLSHPEHSPMALLNELAVEGTANYIDAQRILLDLVQQENEILMEGVKE
FT                   RVVGSNPLTAMVNLARRSVDGFVDMQHEFLTMASKHSQVWMEGVKQGKVYDRDHLVEIA
FT                   REGMENFVAAQKKFLDVIAEETTLATSDKKPGKPGKTTDIAALARESANAMIDAQKKLL
FT                   DVASAQMKTNLKVANRGADMLAPFRLPIAKLTNEGVKTFVDAEKAMIDSMMKRGQKGTK
FT                   ATTAARKKPRKMARGRKTAVKEPVEA"
FT   gene            384937..385482
FT                   /locus_tag="Acid345_0351"
FT   CDS_pept        384937..385482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0351"
FT                   /product="PHA accumulation regulator DNA-binding-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39356"
FT                   /db_xref="GOA:Q1IUU4"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU4"
FT                   /protein_id="ABF39356.1"
FT                   /translation="MNPARVVVKKYPNRRLYDTSASAYVNLDDIARMVRNGKDVQVVDA
FT                   LTSEDLTRVVLTQIIVEDTKGQPTGLPLELLRQLIVASDHAGKEFIMWYLRSAFDAYQK
FT                   MQGTLQSGIAGIKDVATSPVDTLRNFLRGPDRPTAPPDETEELRHRIADLESRLAKPKK
FT                   RTAKKKPSKSPKKKRPNR"
FT   gene            385617..388730
FT                   /locus_tag="Acid345_0352"
FT   CDS_pept        385617..388730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39357"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU3"
FT                   /protein_id="ABF39357.1"
FT                   /translation="MKLRSLCLCFLLGVSAAIAQPTPASTATSQAAIVPHLIRFTGQVK
FT                   DANGTVGITFTLHKSQSDNAALFTETQNVKLDGEGRYTVLLGATKGDGIPMELFTSGEA
FT                   QWLAIRVEGQTEQRVLLVSVPYAMKAAEAETLAGHAATDFVTADRLTSTVQQQMRQQAS
FT                   TTTTAKDAPTGKRGNVVTNTATNFADATSTQVVLVTQSGAGSGLVASAVSGNGVAGSTT
FT                   TAAGFGVSGANSATTGVAIGVRGTTVADSGISVFGTASGTAGSATGVKGITGAPNGFGV
FT                   FGQNTATTGPAVGFRGTTASTSGIGIFGTATAATGTAIGLRTSVASPGGTAAVLQNTAS
FT                   GKLISGQSGATNTEVFSVDGAGNTVSAGGVQAATMNVVNTTVRQPFQLNGTGILGIGDP
FT                   TELNVFVGRDAGKVNVADFPTGAGIGNTFVGNGAGEHNIDGSNNTYVGLFTGGAIHSSD
FT                   NTALGDSAGAGDGARNTAIGKAAGAGVHDDNTTLGYEAGFGSSGARNVVIGASAASDFF
FT                   SGNENVVVGMQSALHLSTGSHNTFLGAGAGALTSTGSLNVMIGQNAGTASSAGSGNVYI
FT                   ASNGCNPSPCNENNTIRIGGDSGLGTGHTAAFFAGINGHAISTGSPVFIDSNNQLGTGP
FT                   ATLPPSAGSSFYIQNNTGSPQTSASFNIDGNGFAGGLLQGGFVNATSTAANKPYRENGV
FT                   PFLGIGVEGQNNVFLGELAGQSNVSGSGLNNTFVGASAGNSNTGGDSNTFLGSSAGQSN
FT                   VSGGFNTFVGVDAGLRNTTASGNTFIGQTAGIENSTGASSVFVGHSAGANNTTGGHNVY
FT                   VGTTAGLDNSTGGLNTFVGDGAGLTDTGNANIFVGANAGGNNTSGDNNLYIGNVGCTSP
FT                   CTESATIRIGNTQTSAFMTGIAGKTSSSGITVLINSTGKLGTTTSSRRFKQNIANIPDS
FT                   SKLFQLRPVTFFYRPEYDDGTHVRQYGLIAEEVAKIYPDLVVFDNQGKPYTVRYQFLAP
FT                   LLLDAMQKEHAVVAAQQSVIASQQKRIDELSQRLARLEETVNRISAAH"
FT   sig_peptide     385617..385676
FT                   /locus_tag="Acid345_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.780 at
FT                   residue 20"
FT   gene            389186..390115
FT                   /locus_tag="Acid345_0353"
FT   CDS_pept        389186..390115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0353"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39358"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU2"
FT                   /protein_id="ABF39358.1"
FT                   /translation="MRNWLLCGVGVLSLAAFGVAQDNDFSKVQIKVEKVAGSVYMLQGA
FT                   GGNIGVSIGDDGIVIVDDQFAPLADKIRAALKGITDKPVRFVINTHYHGDHTGGNLAFQ
FT                   KEAPIIAQDNVRKRLEEGGVGGVGAMKNEHKPVEPGALPILTFDHQMTVHLNGEDIRAL
FT                   HVPSGHTDGDSVIFFPKSNVVHMGDDFVTYGFPFVDINSGGSVRGMIDAIDKVLSQVPP
FT                   DAKFIPGHGPLSTSKEVRDFQQMLKETLAAVQDAMSKGLTLDQMKQQKILEKWSSFDGK
FT                   DKFIHADTWIETIYDDLSGKSGEFVKHN"
FT   sig_peptide     389186..389248
FT                   /locus_tag="Acid345_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.844 at
FT                   residue 21"
FT   gene            390250..392319
FT                   /locus_tag="Acid345_0354"
FT   CDS_pept        390250..392319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39359"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU1"
FT                   /protein_id="ABF39359.1"
FT                   /translation="MKPWLATVCLMFAFTTLAFAQQPNSTSTTPQVSVPSMIRFSGQVK
FT                   GASGTVGITFTLHKTQDDNAALWTESQNVRADESGHYTVLLGAAKAIPIDLFTSGEAQW
FT                   LAIHITGQPEQRVLLVSVPYAVKALEAQTLAGHAATDFVTSDKLTTAVKQELQQQAPTR
FT                   KTTKKDATTNAPNPATNFADTNTTQVVQVVQSGIGSGLVAIAAAGAGVQGATSGASGYG
FT                   VFGSNTSATGTAVGVRGSTTSGNGIAVYGTANGTSGSSTGVKGISSAPSGYGVFGQNTA
FT                   TTGTAIGFRGSSASTSGVAIYGTATSTTGTTKGMLASVASTNGIAAVFQNTAASGKLLS
FT                   GQSGASNTEVFSVDNAGNTTAAATVSGLLMNTSSTVARKPYMINGLGILGVGQTVNDYN
FT                   LFIGWGAGDAEVHDGNQQNNVFIGPGTGMNNTTGYSNTFIGSGVSSNSSTTHSNTLIGS
FT                   AVATNGAGNQNTILGSLAGFQLGAGDANVFLGFEAGFYNTSGNSDIYIGSAGCGTSSCS
FT                   EDSTIRIGSAQTATYIAGIYSESPGPSSASVVIGSNGKLGIPTSSRRFKEQIADIGDSR
FT                   KLFQLRPVTFFYKPEYDGGAHEKQFGLIAEEVAKIYPDMVINDKEGRPFTVKYQFLAPL
FT                   MLNAVQKDHAVIAAQERVIATQQKQLKSQQQHMDELSARLARLEAAVDRLTTTH"
FT   sig_peptide     390250..390312
FT                   /locus_tag="Acid345_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(392335..393141)
FT                   /locus_tag="Acid345_0355"
FT   CDS_pept        complement(392335..393141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39360"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUU0"
FT                   /protein_id="ABF39360.1"
FT                   /translation="MTRLLSAFFLLITAALAQVGPIQDNSFLAEEAYNQEPGVVQHIST
FT                   FTHQSDGTWAYTFTQEWPVPDHWRNQLSYTSSALGASGNAGMGWGDTLINYRYQLIGSG
FT                   ETRVAFAPRASLILPSGSSYWSRGFGGTGAQFALPLSVVLTKNVVSHWDLGVSIIPHAT
FT                   DAAGDHGTLRPWYAAHSFVWLVKPRFNALVETAYFNNETVVSARRTSHSGQLFVSPGVR
FT                   WAYNLSHGLQIVPGVGVPIGAGPSSGQAGVLLYLSFEHPLWKESEK"
FT   sig_peptide     complement(393088..393141)
FT                   /locus_tag="Acid345_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.897 at
FT                   residue 18"
FT   gene            complement(393335..395029)
FT                   /locus_tag="Acid345_0356"
FT   CDS_pept        complement(393335..395029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0356"
FT                   /product="alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39361"
FT                   /db_xref="GOA:Q1IUT9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT9"
FT                   /protein_id="ABF39361.1"
FT                   /translation="MIKRLLVLSLFFAFALPVLAQTTDADWWRHAVIYEIYPRSFGDSN
FT                   GDGLGDLNGITEHLDYLKELGVDGIWISPCFPSPQVDFGYDVSDYTAIAPEYGTMADFD
FT                   RLMAEAKKRNIRVLLDFVVNHSSDKHPWFIESASSRTNPKADWYVWKDGIGADKKQVPT
FT                   NWISLFGHSAWEWDSKRNQFYYHMFAKEQPDLNWRNPEVQKAMYGAMRFWMDKGVSGFR
FT                   LDAVDTLFEDPNLHDDPILPGKKNAYGDQDVEHKYTQDLPETHDVYRAMRHVTNQYPGG
FT                   VLVGEVYFDTAAQMATIYGKNNDEINLPMATQLGFTNKRDVSEIRRKLDDLMTLPATQT
FT                   ALMVFDNHDNARSWDRYGNGLNDAQRAQFAKVVAATLLTPRGSALMYYGQEIGMKTTTP
FT                   TRREEVKDPIGRTGWPKEKGRDGERTPMQWSNAKDAGFSSSDHPWLPVPPTFKQVNVAA
FT                   EDKDPNSVLNFYRAMLKLRRENPVFRDGDYKGVNENNSNVLAFTRTSPQGTVLVVLNYS
FT                   DKAQTADYSQSGKEARTLLSTFSKSDGAQKLNALTVPAFGVFIGQVQ"
FT   sig_peptide     complement(394967..395029)
FT                   /locus_tag="Acid345_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            complement(395072..396694)
FT                   /locus_tag="Acid345_0357"
FT   CDS_pept        complement(395072..396694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0357"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39362"
FT                   /db_xref="GOA:Q1IUT8"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT8"
FT                   /protein_id="ABF39362.1"
FT                   /translation="MESSTQREYLSFGDALFLHLEREGIPINIASVAIFEGNIRFEELL
FT                   PYVEAKLSQVPRCMQRVVEPPFNIGLPCLEYDPEFDFRNHVHETTLKHGTDAELKEFAG
FT                   KLFSENLDRNRPLWDFFLVRGLKRNRTALIARIHHSMADGMSGVAFLNALMDTSPEVPH
FT                   LVRKKLEVPVSPPRDPATTLLDSLTSSWFLTVQRLLNAQSDILTMARQIVRQPAPVNGH
FT                   GAATPSPTHHASLPNMDDLSQIFPEIASAPERMPFNVVCKGPQNFDWCDIPFDSLRAVK
FT                   NAFGCSFNDVALAAVTATFAKYAEYRGADLNGRSLRIVVPVNTRPPEDDRSGMGNEITF
FT                   VPVAVPLDIRDPKQLIAAAHQRMTMIKQAKIAEMVMLAGALISAIPSPVQVLIGPLAAQ
FT                   LPLTLCNLIFTNVPGPRQTLYVLGHRMLKAYPYVPIGGEMGANCALLTYDGYAYFGFSC
FT                   DSVATPEHHLLPKFLHETVAEFRAAFGLDEEIKPRVNKPRAVKNSSAKKRVTKRKPRAV
FT                   KTSAERVQEKLVELEREFAMASD"
FT   gene            396898..397365
FT                   /locus_tag="Acid345_0358"
FT   CDS_pept        396898..397365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39363"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT7"
FT                   /protein_id="ABF39363.1"
FT                   /translation="MNPLFYRGDCTHMEKIKEVVEARSLFTEAAVDWSVMKWLSEKKRV
FT                   RKTADACNATLDRVELEMQQGWSAELKTAYESLSGKDTDKIAPDAEKLAKSLKEAHDAA
FT                   IAKRMEAEETFEKAEKRMSVSMAREGCQIAMAGWDLHEAAIKKSETAASKK"
FT   gene            397510..399198
FT                   /locus_tag="Acid345_0359"
FT   CDS_pept        397510..399198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0359"
FT                   /product="unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39364"
FT                   /db_xref="GOA:Q1IUT6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT6"
FT                   /protein_id="ABF39364.1"
FT                   /translation="MAAAATFAEHLKDLSPEAMHSALGQFLPDGVTTEQKVQLVAMALR
FT                   SPEGATLRQELGRWIVDRLVPVESLLPNRYAMWRSPTRECMLFVISQLSVERLAPKLIE
FT                   QYELPLKTTPEVRLLKLIARVPGLQKLGQVLARNRHLRHSVRTALSKLENGIRDVGMKD
FT                   MLEVLHRELGERMELFDMKIERRLLSEASVSAVVRFSWWNAEERRREKGVLKVLKPHIP
FT                   DCFAEDMKILQELADYFGQRAHKGFASGVIPDTFSKIRRHLQREVDFPGEQAALLEAAK
FT                   QYSAVRRVRVPQLIPHFCTARVTAMSEEEGVKVTSAAPHLDGQGREQLSKQLVEALVAF
FT                   PLLSRSPYALFHADPHAGNLLYNRRTGELVLLDWALAERLTREQRRRLTLLFGAVAFRN
FT                   PAAACEQIQYLSERDKHDHPGDAKTIGRVVERFFEELPVAKLPRAVDAMSLLESAAMVG
FT                   VRFPSSLIMFSKVLFTLDGILDDIRGGSATTEFTIARYLLKRWVRQPFTFGLPLTVRDW
FT                   VGLECSALLYGGRLGVRWEETLSTRMFASKPDAQRSRAAGSRTRH"
FT   gene            399248..399961
FT                   /locus_tag="Acid345_0360"
FT   CDS_pept        399248..399961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39365"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT5"
FT                   /protein_id="ABF39365.1"
FT                   /translation="MARHRSMAGALSLLLALLFFVLTVPASAQQDYVGKFDAFAGFSWM
FT                   ASPSANLYQRGGLTQVAYNWKRWLALGADYSYMTGNTSILPSYLKPSLQQQLSGEIAAA
FT                   GGLPPGYTLYVPYQGNTWTFAAGPAVNYRHFKNVTLFVHPNLGAIHETATTKPKDLIQT
FT                   LIVSQLAPSGKKEDTVVFFGVGGGIDWNLSKHYGIRTTADYVWCNLFSDLLKDSRNSWR
FT                   LGVGPTFHFGKNVEK"
FT   sig_peptide     399248..399334
FT                   /locus_tag="Acid345_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(400022..401692)
FT                   /locus_tag="Acid345_0361"
FT   CDS_pept        complement(400022..401692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0361"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39366"
FT                   /db_xref="GOA:Q1IUT4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT4"
FT                   /protein_id="ABF39366.1"
FT                   /translation="MQDDQRQFDFDFIVIGSGFGGSVSALRLTEKGYKVAVMEMGRRWT
FT                   PDNLPKTNWSLARWFWRPGLGLRGFFSMRFFSRVTILHGCAVGGGSITYASTLLRAPDK
FT                   VWDSGTWKGLSNWKSEMPRHYETASRMLGVTQNKILGPADHLLKQVAVASGAGETFYRT
FT                   NVGIFQAPEGEAGGLTYADPYFGGEGPARTTCNACGGCMIGCRHGAKNTLDLNYLYLAE
FT                   KRGMKIFAETRVVDVQPLGAVDGREGYEVTTERSTSFVFKNRQRFTCRGIVFSASSLGT
FT                   TELLFRLKTKHSLPNISDQLGNRVRTNSESLIGVRVPKSEQDLSRGVAIGSGVYIDDHT
FT                   HIEAVRYPKGSDVMGGLATTLTAGKPGIGRIALWFKNLLVSFCTHPVRTVRLLQPFGFA
FT                   RESVILLCMQALEGHIDMRWKRPWYWPVRRVLVSSGQRIPTFIPAANQFAQVFAKMAGG
FT                   TAMSMLPEILFNIPATAHCLGGAVIGASPVDGVIDARHRVFGYTNMYVCDGSVVAANLG
FT                   VNPSLTITALAERAMEFIPLASAHTWTDRADSIEVSKAV"
FT   gene            401800..402504
FT                   /locus_tag="Acid345_0362"
FT   CDS_pept        401800..402504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0362"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39367"
FT                   /db_xref="GOA:Q1IUT3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT3"
FT                   /protein_id="ABF39367.1"
FT                   /translation="MSENKVDPGQVLRKVPIFSGLSDVEWNELSQRVVPRKYPNGEMIF
FT                   SEGDACAGLFVVQSGHIRIFKSSASGREQVLSIDGPGSSVAELPVFDGGSYPASAVAVT
FT                   DCTLLFLSKQDFHALCMKYPEMALKVLRVVGGRLRRLVGIIEELSFTTVRHRLVALLLR
FT                   LAKTEGNKTEQGITITLPAHNQELAAQIGTVRELVSRNMSRLQQEGMIEQDGRTVILKD
FT                   PMGLQRTLEEAG"
FT   gene            402521..402934
FT                   /locus_tag="Acid345_0363"
FT   CDS_pept        402521..402934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39368"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT2"
FT                   /protein_id="ABF39368.1"
FT                   /translation="MTYFKDCTPYSYGVADQPRMLSVGWLDKRYPFPKGEIDPALIEKL
FT                   RRLVAKSTWITRGLHICEFCEIPAALAEVHQQGRTGDPAYWEWLKPRSSNGEIRVSLHS
FT                   VTYAAPFLVPHYIEVHKYLPPQPFLVAVEQAPE"
FT   gene            complement(402997..405282)
FT                   /locus_tag="Acid345_0364"
FT   CDS_pept        complement(402997..405282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0364"
FT                   /product="nitric oxide reductase, NorZ apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39369"
FT                   /db_xref="GOA:Q1IUT1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT1"
FT                   /protein_id="ABF39369.1"
FT                   /translation="MQFKKLWIALGFVLVASFVVLGGVGYKAIKSAPPIPSQVVTTDGR
FT                   VLFTGSYIQDGQNVWQSIGGQEIGTIWGHGSYVAPDWTADYLHREAMFILDGSAPQLGA
FT                   AGYEALPAEQKAALQARLQTSMRRNTYNTETGTITVTPERAAAYDKLAAYYGDVFGNGR
FT                   VQYAIPQGALVDVAKQKQMAAFFWWTAWAASTDRPGQNYSYTQNWPHEELIGNRPTSAT
FT                   MVWSIISFVLLLGGVGALVWYFGSKKESEEHEPAAPHRDPLLGLRATPSQRATVKYFVV
FT                   VGILWVLQVGLGAITAHYGVEGTSFFGIPLAKVLPYTISRTWHLQIAIFWIATSWLATG
FT                   LFIAPAVGGSEPKGQRLGVNILFVALVAVVFGSLAGEWLGIQQKLGNLWFWFGAQGYEY
FT                   VDLGRVWQILLFGGLVFWLWLMYRALKPALAKRDENYPLLMLFLVSSIAIPTFYAAGLM
FT                   YGQRSHLVTAEYWRWWVVHLWVEGFFEVFATVVIAFLFTRLQLLRVKSATRAVLFSTVI
FT                   FLSGGIIGTFHHLYFAGMPTSVLALGAVFSALEVVPLVLIGFEAWENLRLTRSNTNSPW
FT                   LGMYKWPVYFFVAVAFWNFVGAGLFGFMINPPVALYYLQGLNTTPVHGHTALFGVYGML
FT                   GLGLMLFCLRALKPGMPWKEKPLAIAFWCINIGLLAMVLLSVLPVGLIQAWASVENGTW
FT                   YARSAEFLNTPLMTTLKWMRIPGDTIFAVGALFLGWFILGLLTGHSYETGDVKAKVRLM
FT                   DAQEVAGD"
FT   sig_peptide     complement(405214..405282)
FT                   /locus_tag="Acid345_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            complement(405353..406081)
FT                   /locus_tag="Acid345_0365"
FT   CDS_pept        complement(405353..406081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0365"
FT                   /product="protein of unknown function DUF542, ScdA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39370"
FT                   /db_xref="GOA:Q1IUT0"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUT0"
FT                   /protein_id="ABF39370.1"
FT                   /translation="MVDTNKTVRDIAVELPYAPKVFEKLGIDFCCGGKRPLSEACHASG
FT                   IAVGEVVNHLESAEKAIQEGRESAAKNWSISTVSEVLDQILSRHHVYVREESPRIQQLF
FT                   AKVASKHGENHPELVQAKELFDALAGELMVHLMKEEQILFPYVRRMEESQVSGEPLPPS
FT                   CFGTVRNPIQMMFMEHDSAGELLKEIRKQTNDLKAPPDACISFQSLYRDLLAFEADLHQ
FT                   HIHLENNVLFPKVLEMEGAE"
FT   gene            406360..407673
FT                   /locus_tag="Acid345_0366"
FT   CDS_pept        406360..407673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0366"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39371"
FT                   /db_xref="GOA:Q1IUS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS9"
FT                   /protein_id="ABF39371.1"
FT                   /translation="MSLQMARRWRSACTSVFVMDIARPEFKQQKRRRQIIIGSVAVVIL
FT                   VAITLGVSRLKPAAPSVERSTVWTDTVKEGPMLRQVRGLGTLTPTPEDVRLIPAETDAT
FT                   VLRIVKLSGSPVNSDTVLVEMSNPQVEQEAVDANLQLKAAEAEYQNLKVKLDADLMTQK
FT                   AGAATVGADYSQAQRQASTDKALYDLGVISGLAYKASQGKADELTTRNDLEGQKLTINQ
FT                   KAIVSQMAVQQAKVEQMRALAQLKQRQLDKLKVRAGIDGLLVDMPLQVGQRVLAGAVLA
FT                   KIVQPNRLMASLKIPETQARDVQIGEPASVDTHNGVVQGSVMRVDPAVVNGTVTVDVKL
FT                   TGDLPKGARPDLSVDGTIDLERLDKTVYVGRPAFGQENSTISLFRLDPDGKGASRVPVK
FT                   VGRTSVNTIQVIEGLKPGDTVILSDMSRWDSNDRIRLD"
FT   gene            407706..408428
FT                   /locus_tag="Acid345_0367"
FT   CDS_pept        407706..408428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0367"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39372"
FT                   /db_xref="GOA:Q1IUS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS8"
FT                   /protein_id="ABF39372.1"
FT                   /translation="MSENGRALIQIQDLTKVFYTDEIETHALSGVHLEIEKGEYVAMSG
FT                   PSGCGKSTLLSIIGLLDTPTGGKYYLNNKPVENLDFADRSRIRNQEIGFIFQSFNLIGD
FT                   LTVYENVELPLTYRQGMATPNRKQRVMEALERVGMAHRIRHYPSQLSGGQQQRVAVARA
FT                   LAGNPSILLADEPTGNLDSRNGEAVMELLQNLHREGATICMVTHDPRFAAHAQRQIHLF
FT                   DGKVVAEEELKKLTQEIH"
FT   gene            408463..410913
FT                   /locus_tag="Acid345_0368"
FT   CDS_pept        408463..410913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0368"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39373"
FT                   /db_xref="GOA:Q1IUS7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS7"
FT                   /protein_id="ABF39373.1"
FT                   /translation="MRGFAQDLRYSFRQLKKSPVFAITAVLTLALGIGANVAVFSVMNA
FT                   TLLNPSGVPHADGVVALRAGYNQGDLGNINLSPPDFEDASEGKEVFTSAAVMNGMDYNY
FT                   SPDGGGTPELLRGAKVTWQWFDVFWAQPMMGRVFRPEEDQPGAEHEVVLAYSAWQKRFG
FT                   GDPHILGRKLQLNQESYEVVGVMGPEFAWPNRAEMWTPLALTPSRYTDPNYRFNEYLFG
FT                   VARLRQGKTLADANTYLTHRTQQVYQTGGRLSDYAKSAQWHQFAMPLIEFVSGKMQKPL
FT                   AFLLGAVALVLLIACANIAGLQLARASGRQREVSIQIALGGSRGRLIRQALSESVLLAL
FT                   SGALLGVVVAKLSIPLLLALAPPSIGRTVSAPMDARMLLFVAGIGVLCALLCGTAPSWH
FT                   MTHIRWFQALQEGGRSDSASPARQRTRSALVVVEIAIAMLLLFGAGLLVRSMNTIQQVE
FT                   TGMQPHGVMTAALTLPKATYKTDEQQANFYNSLEEQLKQIPGVQHAAIVDSIPFSNGGG
FT                   SASFFIEGKPVANGALGPHANIRSVSPEYFETLGIPLMRGRFFTSADRAKTQLVVIIDD
FT                   VLARQYFGDSDPIGQHINFGDPPDKDPWREIVGIVHHARATSLENDTNEGFYYFPMAQA
FT                   PNDSSFIAVKTNGAAAGLVGPIRNAVRNVDPSQALYDVKAMDERVDDSLIGRRFLVVLL
FT                   SVFAGLALLLSAVGLYGVIAYSVRLRTRELGVRMALGAQRSDVLKLVLGHGMQLAVAGL
FT                   VIGLGTGLALSKVFESLLFKVSVFNPVALLSTCALLMGTVLFASYLPARRAAKLDPIRT
FT                   LRDE"
FT   sig_peptide     408463..408597
FT                   /locus_tag="Acid345_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.830) with cleavage site probability 0.333 at
FT                   residue 45"
FT   gene            410924..413491
FT                   /locus_tag="Acid345_0369"
FT   CDS_pept        410924..413491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0369"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39374"
FT                   /db_xref="GOA:Q1IUS6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS6"
FT                   /protein_id="ABF39374.1"
FT                   /translation="MFENLIQDVRYAFRQLRKSPGFAATAIITLTLTIGANTAIYSLFD
FT                   QVLLRNLPVKDPKGLVVFEYKGSHTGSTNNHGGPSGAYFSYPMYKDIRDRNTVFDGVIA
FT                   SDISQVGLQWHNQPELVNAELVSGNYFDVLGVRPAAGRLFVQADDVVPNGNPLVVLSYS
FT                   YWQRRFGLDPKVVGDNVLINGHPFTVIGVSAPGFQSMQTGYLPAIYTPMMMKEQVTPGW
FT                   NDLDNRRSIWLNIIGRLKPGMTMAQAEAGLDSLWHSAREEELKEVRNKSDKFRENFGPK
FT                   SHLYLHNGARGFSLLDQYRMPMLIVMGMVLLVAVMAAVNVATLLLVRAATRVKEMSVRY
FT                   AMGARRTRVIQQLLSEGLILGLIGGALGIVLAPQASALLIRKAFADSNGNVPFSSSPDM
FT                   RVLAFNFGLALLVSLVFSIAPAVQFWRPNLIPALKQQTVTTAGGALRFRRLSVAVQVGV
FT                   SLVLLVGAGLFVRTLGNLKSADVGFVTQHLITFQIDPQLAGYEDNQTAVLHKRITDSLK
FT                   ALPGVQAVASTADPELANTNSSSNFSIAGITEKEGDDMNAEWPNVSAGYFSAMQIPLIT
FT                   GRDFTESDAAGSGNVAVINETLAKKHFGSPDKAIGKVLARGSGDDAKYDIQIVGVVRDS
FT                   KHTNVRDEVKQALFTPLSQMQHWVRDPKKPGAKEVLVPDQPGFLAYYVRTWQPTASAMS
FT                   QIRGAVQGVDSKLVLDTFRTMDAQIDDDVNTERIIALLASGFGILAAILAAVGLYGVLA
FT                   YSTAQRTREIGVRMALGATRMSVVRMVLTEVLWLAGAGIIVALPVSIVLSRFMRAQLYG
FT                   VSHYDPLTVFAVVLLVTLVAVAAATLPARRAAGIDPMKALRYE"
FT   gene            413496..415913
FT                   /locus_tag="Acid345_0370"
FT   CDS_pept        413496..415913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0370"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39375"
FT                   /db_xref="GOA:Q1IUS5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS5"
FT                   /protein_id="ABF39375.1"
FT                   /translation="MMTGLLQDLRYAWRQLRKSPGFTAVAVLTLALGIGANAVVLAAVQ
FT                   SVLIAPLPYRDADRIIALNTQFTNEGRSINRVTGADLMDIEAQSKSFEQVAYYFGGEMG
FT                   VQLPDHAAFTGVQGATANFANVFGVTPVAGRLFNDSEATHSALINANFARDNFGSVEAA
FT                   VGKSLSVEGTTYDIVGVLPGEFSFPKGTQVWMGVSDTPEAEWSHRTSYNFRSVAKVKAG
FT                   VSMTAAQSELNTIGDRLRIAYPADNKNKAFLAVSLQEQLVGKVRPMFLLLVGAVALILL
FT                   IACVNVAHLQLARATTRTKEVALRSALGASRTRVVRQVFLESLVLAFLGAGVGLLIAVP
FT                   LLRSFLRLAPTDIPRLNEVHISAPAIALIAVVSVIATLLSGVAPAWQSLRLNVNESLKQ
FT                   DTSRGMVGRGVSKLRNVLVVAEIALTFVLAAGAGLLVRTMIKLNATDPGYRSDHLLVMY
FT                   VHAPAKGLLENLQRTQQMETLFDQLRAVPGVTAVAGVMGLPAGQYGSNGGYQISGQTLP
FT                   ASLDDLPQANWALSSPQYFSTMGIPLLRGRDFQKSDTHDSEPVAIISDAMAKQSFGNSD
FT                   PIGRQLRCGLDEESGKWMTIVGVVGDVRQDSPASTPRATLYLPLKQHPFRANELQVVMH
FT                   TELPPLTLMETARKMVQGMDPRIATKFTTMDSMLAESTATPRFRSWLVGGFASLGLILA
FT                   MLGIYGVMAYTVAQRTFEVGVRMTFGAQPGDILGMVLGRAMRLTVIGVVVGLVLAAASS
FT                   RLIASMLFGVPAEDPVSFGVACGLLALVALAAAYFPARRAASVNPLTAIRYE"
FT   sig_peptide     413496..413624
FT                   /locus_tag="Acid345_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.984) with cleavage site probability 0.870 at
FT                   residue 43"
FT   gene            415921..418338
FT                   /locus_tag="Acid345_0371"
FT   CDS_pept        415921..418338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0371"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39376"
FT                   /db_xref="GOA:Q1IUS4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS4"
FT                   /protein_id="ABF39376.1"
FT                   /translation="MTTLMQDVRYAFRQLYKKPGFSFTAVFTIALAIGVATAVFSVLYA
FT                   ILIRPLPFDQPDKIFFLQGYSPQGYTQPAAYPEYLHWRRNTQSFSALAGYSRGSANFET
FT                   NGGPVPITSVSTTDNFFQVFGVNPILGRTFADGEDQPGKNDVVVLSYESWQQDFGGRQD
FT                   VTGATAKIDGRPYSIIGVMPAGFRYPISAAHAVYLPLHIPKDLAESKGSHWMPMVARLK
FT                   NGVTSKQAEDDMGRAMESYAVENPDAKGRRMNIEGIAAHVVGDTGAPLKVLLFAVLAVL
FT                   GIGCANFAGLLLARGVKREREVAVRSAIGATRTRLVRQMLTETVMLAIAGTLGGVLLAF
FT                   LLLSGITKLLIAALARGADVQINIPVLVASLAVAIITALVAGVVPALRLSSIAPSLALK
FT                   AGGSAGSARGQHHLRAVFIVTQIALALVLLVTSGLLMRTLAGLRSTDLGFTTNNMIATE
FT                   LDLSRGAYENRDVVTEFYNPLMEKVQAIPGVKAAGMIQIIPIQNWGWNSDVQIVGKPPA
FT                   PKGQEQLAEYRVVTPGYYSAMGIRLLRGRLIDPKLDNRNTKPVTVVNEAFVKKFFAPGE
FT                   DPVGQHLSDDDKTEIVGVVSDVRQNIYAPPLAEMDYAVSQVSAKNAFGYLSSMQLVVRT
FT                   SMDPAGMMGSLRNALHEVDPGVPSRTPETMKDVIAEVLIFERLENWLFGTFAALAILLS
FT                   IVGLYGLISHEVDLSIRDIGVRMALGATRAQVLAGVYKRVGLLLAIGVAGGLIMTMAVQ
FT                   KILSALVVLHLGKDAVTIVSLAAGLALFGLLAALLPARRAASTEPMTALRYE"
FT   sig_peptide     415921..416037
FT                   /locus_tag="Acid345_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.646) with cleavage site probability 0.306 at
FT                   residue 39"
FT   gene            418354..419064
FT                   /locus_tag="Acid345_0372"
FT   CDS_pept        418354..419064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0372"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39377"
FT                   /db_xref="GOA:Q1IUS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS3"
FT                   /protein_id="ABF39377.1"
FT                   /translation="MIQLKNVERSYKTGAGQTWVLRRIGLDIQPGEFITIMGPSGAGKS
FT                   SLLNALALLDDQWAGEYWFKGEAVHDMKRKQRADIAKKHIGMVFQSYHLLDDLTVQENI
FT                   DLPLSYKDIPKSERQSMVADTLDRFQIVAKKDLYPNQLSGGQQQLVGIARAVIHNPALL
FT                   LADEPTGNLHSSQAKEIMELFKELNQQGTTIVQVTHSEVNASYGTRTLQMRDGWLVGDT
FT                   SNPNLQFQGEAATR"
FT   gene            419061..421049
FT                   /locus_tag="Acid345_0373"
FT   CDS_pept        419061..421049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0373"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39378"
FT                   /db_xref="GOA:Q1IUS2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS2"
FT                   /protein_id="ABF39378.1"
FT                   /translation="MNDRFATRLRKTVSLLCVYATFASTTAAMAQNTTAGPNANNVPDA
FT                   PPAPTAASAFNVQVPHSHNPLGPYTPSHVAAPVLSNSPRLASLIRDGKLYLSLNDSIEL
FT                   ALENNLDLAIARYNVPIADTDILRTKAGGSFRGVNTGVVQGTPGGGVGGFGSGAPGAGA
FT                   GGTSSGAGGAGAGAAGLVQSTLGSGTFVNSFDPQINANIGVEHATSPLSNQTIYGVPSL
FT                   QLNTTTGNFNYQQAFATGTQISFDFNNNRQITNSPNNNLNPSLNSLYRISLQQPLLAGF
FT                   GFGPNLRYLRIAKNNKKISDIAFKDQVTATVTQIANIYWDLVGAFEQARVNQQSLDFAN
FT                   QTLDNTRKQLKLEAVPEMDVLRAEAEVSKRAQDLTVANTNLELQASLIKNAITRSLDDP
FT                   VLEAMPVVPTDRMDTTEPVTPQNLVDLITHALQSRPELLESDIDLENRRISQKATRNAL
FT                   LPSVNLVGFYGSAGLAGLANPAFVGDNPITVPPDWGGSIENAFNGSSPDYYVGVNVNIP
FT                   IRNRIAKADQFRSELEYRQSELRREQLKKQIRIEVRNAQYAYEQTAARVEAAIKARDLA
FT                   QRTFETMKKEQDLGAGSIYQTMTAQRDLALASLDLVTAQTIYQKSKVELDRATAQTLEH
FT                   NGVHIQEAITGVVAANPAEKPAGTEIR"
FT   sig_peptide     419061..419153
FT                   /locus_tag="Acid345_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.994 at
FT                   residue 31"
FT   gene            421046..422461
FT                   /locus_tag="Acid345_0374"
FT   CDS_pept        421046..422461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0374"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39379"
FT                   /db_xref="GOA:Q1IUS1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS1"
FT                   /protein_id="ABF39379.1"
FT                   /translation="MTQSATTGNPKLITTPARSERAARILAADDQEHILDALKILLRPE
FT                   GYEVDTAKSPVMVRELLNSNSYDALLIDLNYTRDTTSGREGLDLLSEIVAQDSTVPVIV
FT                   MTAWGSIDVAVEAMRRGARDFIQKPWENERLLTILRTQVELYRTLQRAERLQAENQLLR
FT                   ATGLPQLIATAPSMQPVLDSIARIGPSDANVLITGEHGTGKEVVAQTLHGISQRASKTL
FT                   VAVNTGALPDTLFESELFGHVKGAFTDARTDRIGRFELADGGTIFLDEIGNVPVRQQAK
FT                   LLRVLETGEIERVGSSKSRRVNVRVISATNTDLRAASAQGQFREDLLFRLNTVEIHIPP
FT                   LRERREDIAALALHFLKRYAERYRRPVQGLEKSTLQALMQYSWPGNVRELDHTMERAVL
FT                   MARGNELAPADLGLVQQKQQSSPNLEELSIESVESILIRKALQRYHGNVSQAAEALGLS
FT                   RGALYRRMEKYGL"
FT   gene            422451..423935
FT                   /locus_tag="Acid345_0375"
FT   CDS_pept        422451..423935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0375"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39380"
FT                   /db_xref="GOA:Q1IUS0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUS0"
FT                   /protein_id="ABF39380.1"
FT                   /translation="MVSDDPPERTMGFAAGSGQHSERAKAAIANTRSADEAPSRTAAPF
FT                   RTKRSRIRYERRVLLLAFLVALPSMIVSVILVLIQKWTIDAKIALLAGESIAWLLLVLA
FT                   QHEQIVRPLQTLTNVVAALREEDYSFRARGAAMDDALGELAIEVNALADVLTIQKTSAI
FT                   EATALLSRIVEEIDAPLFAFDPEHKLKLVNSAGERLLQQPATKLLGSTATELNLQVAFE
FT                   AESESLVPLPYSPNSRWMVRRSSFRQDGVPHTLIVLSDVSRALREEERSAWQKLIRVLG
FT                   HELNNSLAPIKSIAGSLNSRLKRTSLSDEEREDFEKGLSIVEGRAESLNRFLQAYRQLA
FT                   TMPPPKLKLVSMKSLVERVAGLETRVVVEVRNNPDVHLQADPDQLEQMMINLVKNAVEA
FT                   SKEMQQPETPEPPEVIVGWDAEPAAIILKVEDNGPGIMNPSNAFVPFYTTKQGGSGIGL
FT                   VLSRQIAEAHGGRLELINREGTRGCMARVTLPRGRD"
FT   gene            423981..426485
FT                   /locus_tag="Acid345_0376"
FT   CDS_pept        423981..426485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0376"
FT                   /product="Glycogen debranching enzyme-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39381"
FT                   /db_xref="GOA:Q1IUR9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR9"
FT                   /protein_id="ABF39381.1"
FT                   /translation="MRLLKSLPIACLLAALSHAQQPDFAPIAHFPLTTSPLTIHQRAQE
FT                   RLPFSVTGDTGAILGQQDGSFELWHFPDKVFAHVSIHAALKDYPVPIELNPLAATIDVA
FT                   PDHTTITYSHAAITVKQHMFLARGLQDAPAPLVMFEIESIRPVTLTIDLDPVMQHMWPA
FT                   LNGNRPGAGWIPMGTGGAYMLETEDPSFYGMIAMPNAQPGIMAPYQERPKDYPLQFILS
FT                   YDPQRDGNKYFPLLTHVVDGGTLRGQERTSQLTSEIAEIAANLPKYYGASRDYYAHFFD
FT                   THLTVETPDPLFDQALRWAEISIDQLKVRKGNEVGLVAGVYPSADSDRPGFGWFFGRDS
FT                   LWTTFALHSEGDFATSRNALEFLIARQRADGKIMHEYSQSADRVDWPSFPYMYAAADAT
FT                   PLFILAMHDYLRTTGDDAFIQKHWKNIKRAYDFLRAHDSDGDGIYDNSQGTGWVESWPP
FT                   GMPQQELYLAALDQQATAAIGDLAKTLGDDTLTKSAHDTAESIRTKLNAYLAPDGIYAF
FT                   SRNKDGSYDTTPTSYPAVAWWTGELALPNAAKTLDFYAASDLNADWGSRAIAQSNQLYD
FT                   PISYHQGSIWPLFTGWTAMAEFRAGRSLAGLQHLRENLRLTWEGDPGNVTELMSGKFNE
FT                   PLGRSTAHQLWSSAMVLTPAIRGLFGIETNVSQHKLFVVPQLPPEWPRAVVHHVPYGDT
FT                   ELDITYQRQGTTLNITVTSAKAIPLCVIPERTDRMCKVAPATTHTASITLPDVQVSLPD
FT                   EAPRPGDASHLLRVINQQYEGRKLALTLEAPAGSHQQLPLQMNDPRVKTVTAQGATINK
FT                   ETLEVAFPTGEGFQRQIVTLTW"
FT   sig_peptide     423981..424040
FT                   /locus_tag="Acid345_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(426489..427853)
FT                   /locus_tag="Acid345_0377"
FT   CDS_pept        complement(426489..427853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0377"
FT                   /product="Succinate-semialdehyde dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39382"
FT                   /db_xref="GOA:Q1IUR8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR8"
FT                   /protein_id="ABF39382.1"
FT                   /translation="MAIASVNPATGEVLKTFEALTPEQIEAKIAKAHATFSTYRLLPYS
FT                   KRAAWMNKTAELLEAEKQELGRIMTLEMGKPLKAAVAEAAKCATACRYYAENTERLMAD
FT                   EIVQTSAKRSFVKYQPIGPVLAIMPWNFPFWQVFRFVAPALMAGNVGLLKHASNVPQCA
FT                   LAIEDILRRAGFPEGVFQTLLIGAKAVDAILSDSRIMAATLTGSEGAGIEVGVSAAKQI
FT                   KKVVLELGGSDPFIVMPSANLETAVATAVTARVQNNGQSCIAAKRFIVHEAIADSFTEK
FT                   FVAKMAGLKIGDPMDDATELGPLSTPSGVTDLERDLKASVDAGARVLTGGAVIKRPGNF
FT                   FAPTVITDIPKESPAYKEEFFGPVASVFRVKNIDEAIAIANDSRFGLGASVWTNEPAEQ
FT                   ERFIRDIEAGMVYVNKMVASDPRLPFGGVKQSGHGRELGVHGLHEFLNIKTVWVE"
FT   gene            427971..428171
FT                   /locus_tag="Acid345_0378"
FT   CDS_pept        427971..428171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39383"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR7"
FT                   /protein_id="ABF39383.1"
FT                   /translation="MPRVPLHPKNPERVCWGCDKCCPADSLDCGNGTVRTQHPVEIFGE
FT                   DWLEFSKPRPNPESSHSGTAD"
FT   gene            428324..430969
FT                   /locus_tag="Acid345_0379"
FT   CDS_pept        428324..430969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0379"
FT                   /product="acetaldehyde dehydrogenase / alcohol
FT                   dehydrogenase AdhE"
FT                   /EC_number="1.2.1.10"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39384"
FT                   /db_xref="GOA:Q1IUR6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR6"
FT                   /protein_id="ABF39384.1"
FT                   /translation="MPTKTLEEKTAKLSPERIAHLEGLVDNARAAASAFLQFTQEDVDR
FT                   IVKQMVLAGMEHAQKLAQMAVEETMLGVLEDKVIKNMVATEFVYNYVKDKRTVGIIREY
FT                   PERRLTEIAEPIGVIFSLIPITNPTSTVLFKCIMAIKTRNAVIFSPHPRAWRCCKEAVH
FT                   VMYEAARKHGAPDGVFACLESHNLDDNDYLMHHKYVSMIDATGGPSAVKAAYSSGKPAL
FT                   GVGAGNTPVYLEKTADINMAVVDIITSKTFDNGTICASEQTVVIDDEIYDTVLKKFSDL
FT                   GTHICNEGETELLGRTVIDPDTGAMQPMAVGQKAADIAAAVGIEVQPKTKLIIAPIKGV
FT                   GPNHPLSVEKLFPVLAVYRAHSTEEALDVCVAVNRAGGLGHTAVIFSRNDDIIHRFGIL
FT                   LNAGRLIVNSPGSIGALGGVYNDMVPTFSFGCGTGGGNSTMDNVNVYHYLNIKRLARRT
FT                   PPSMWFRIPNQIYFNPNSIQNLATFPTRSTVIVTNPPLEQMGHVDIVRRYIPADTRIHV
FT                   LVIPDCEPELKAVMDGVEALNFYKADQIIALGGGSVIDAAKMMKLKYESPDANFEELGS
FT                   PFLDLRKRVVQFPTEKKHHARLIAVPTTSGTGSEVTPFAVLFDKARQRKITLADYSLSP
FT                   DVAIVDPQFVMSMPKGLTADTGIDCLTHALEAGVSNYASPYTDSNAMQAIRLAFKYLPI
FT                   AYENPQDEEARNTMHNAATIAAIAFSNASVGLNHALAHAFGARFGVPHGRANALMLPHV
FT                   IAFNAAVPQKFMPSPNQQGYVAHKKYAMIADLLGLPGHTVEEKVASLITAVEELLDRLN
FT                   LPRSIASMGIKREDFESAMPELVKAAFEDPSWLSNPRMPLMSELQELFLQAYEGSGRKK
FT                   AEAREEATVS"
FT   gene            complement(430994..431821)
FT                   /locus_tag="Acid345_0380"
FT   CDS_pept        complement(430994..431821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0380"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39385"
FT                   /db_xref="GOA:Q1IUR5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR5"
FT                   /protein_id="ABF39385.1"
FT                   /translation="MPEGDTIFRAARTLQRALAGKVVTRFETVLPKLARVDEDAPLAGR
FT                   TVVDVEARGKWMLMHFSGDLILLTHMLMSGSWHIYRPGEQWQRSRNDMRVVIETSDILA
FT                   VAFRVPVAEFHTEESLKRRARLNQLGDDLLGAEFDIPASVERLRAHGDLELGDTLLHQS
FT                   VLAGPGNVFKSEICFACRLDPFRKISSLSEEELLRVATKARELMTSNVSDTSGDKIVTY
FT                   TGFRRTTGRSDPYERLWVYGRAGLPCRRCGTRIEVKRQGAQARKTYFCPECQR"
FT   gene            complement(432546..433667)
FT                   /locus_tag="Acid345_0381"
FT   CDS_pept        complement(432546..433667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39386"
FT                   /db_xref="GOA:Q1IUR4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR4"
FT                   /protein_id="ABF39386.1"
FT                   /translation="MANDENSTDRVDVEEVMRQFVEKRDLLEAFRSKTEGLISELLDAA
FT                   AIRCQSIQSRVKTNKKLRAKYLDPKKDYRSLDEITDQVGFRIIVYYQDEIDVVAKLVRD
FT                   EFDVDEANSVDKRITDPERFGYQAVHCVCQHSSGRSKITEYKKHAGITCEIQIATILGH
FT                   AWAEMEHEWYDLQDDFPDDIKRKFSRLAALLDLADSEFLDIRKKKSSYERSVELRIEAN
FT                   VPDVPLDSVSLKSLLTQDPHVKEVDSKLAVIFASELVPDLSDAEARRRFPIMEFLGLQS
FT                   VRSAQDKLRQHEAALLEFATLSEQGVWRDWKLKTPIMPGIGFYHLMLLFAFSGGLESAQ
FT                   VALAKLGGGLKGYPHLDEQVRIAQAVAKKYGLT"
FT   gene            complement(433674..434306)
FT                   /locus_tag="Acid345_0382"
FT   CDS_pept        complement(433674..434306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39387"
FT                   /db_xref="InterPro:IPR032417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR3"
FT                   /protein_id="ABF39387.1"
FT                   /translation="MAQVRFDHHSFPNLSCRVPQVSRFFETWADNAAGTSEHRRKIGDR
FT                   QNNFKIWRLVEIVILSSVPISPSLEFPDSRCTLSLISFASCIFKFGRIGLGCSSGDHMD
FT                   GLWTAEFGSSVGLSGGGVVVLSNGDVRGGDGGYYYVGTYRRDGNRFVVELRVSPFLLSY
FT                   NSVFNTIGRPFSLKIEGNLTDESHAIGQGRPLEIPGVTLGVKLTRQA"
FT   gene            434311..435462
FT                   /locus_tag="Acid345_0383"
FT   CDS_pept        434311..435462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR2"
FT                   /protein_id="ABF39388.1"
FT                   /translation="MACDPQSFSVLGDHLGTEYHLVGETSMSNEGVLPLGILPVRTTDP
FT                   PKKTSLPDITIFEFPIIGAVAIADALPWDPIEIDRNNLRMRIFKPKPALHSVTVGGELT
FT                   TQAIDIRSTLFRVECELLGQADTPNVLDVFPVVNEFVHLIRIVARQYWLGLAMANEGSV
FT                   TQGVRTRIEAGNAVFTGQGSYSVPFIVTGLTSFGWHFLGDLFVNQCFPGTAELLLCDAL
FT                   VEVRRGALAQAALLLGVASEVELSTFLNDIATWKGLSKNKRQAIADTKFREKLVTRTVE
FT                   LGIPDPQGITIPPFAPGWAQTLLELYRIRNQAAHGGTATVTVGSVVRPIDLTDTARFIF
FT                   AVEALLAWTAQQRVSRSISTSVTATMLPSGYPLKAVIDPRNTP"
FT   gene            complement(435481..440076)
FT                   /locus_tag="Acid345_0384"
FT   CDS_pept        complement(435481..440076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0384"
FT                   /product="ATP dependent helicase, Lhr family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39389"
FT                   /db_xref="GOA:Q1IUR1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR1"
FT                   /protein_id="ABF39389.1"
FT                   /translation="MTSRKPNPLALFHPPVRDWFTAVFDAPTRPQTLGWESIARGDSTL
FT                   VLAPTGTGKTLAAFLWAINRVMFEPVPEKKQRCRILYVSPIKALAVDVERNLRAPIVGI
FT                   AHAARRLTTSFHEPSVMVRTGDTPTAERVRFQREPADILITTPESLYLLLTSNAREVLR
FT                   SIETVIIDEIHALVPGKRGTHLSLSLERLEHLCGRPLQRIGLSATQRPLEEVSHFLGGV
FT                   DTAKAKPVTDEATDELPYRPVTIVDASAPKRLDLRVEVPVEDMASLDDINPLPSGPASQ
FT                   GPVRGSIWAAIHPELLRLVQEHRSTLIFVNSRRLAERISGAINDLAGESLVRAHHGSVS
FT                   VAQRKEIEDLLKAGQLRGIVATSSLELGIDMGAVDLVIQVEAPPSVASGMQRIGRASHQ
FT                   VGAVSKGLIFPKYRADLLACAAVTRAMQDGEVESIRYPRNPLDVLAQQIVAAVAVDPWN
FT                   VDDLYAFVRGSAPFATLSRPLFDGVLDMLSGRYPSDEFAELRPRINWDRVQNTLTPRQG
FT                   SKSMAIANGGTIPDRGLYGVFLSGAEKKGGRLGELDEEMVFESRPGETIILGATTWRID
FT                   DITHDRVLVSPAPGEPGKMPFWKGDAAGRPAEFGTRIGALTRKLLTTPRGAAIASLVES
FT                   HRLDANAADNLMRYLEDQRAATEKVPSDKDILVERYRDELGDWRVCVLTPFGSRVHAPW
FT                   CIAVTAKLRADLGIEPESMWTEDGFVVRLPDSDAPLDVEALFPTVSEFTALVTAQLGGT
FT                   ALFAGKFREAAGRALLLPRRRPGQRTALWQQRKKSADLLAVAARYSTFPLLLETYRECL
FT                   RDIFDLTAATDLLRDIQNGAVQVTTVDSQKPSPFASSLLFGYIANYIYEGDAPLAERRA
FT                   QALSIDQAQLQDLLGDVDFRELLDPAVLDEVEAQLQMREAEFGARTADALHDLLRRLGD
FT                   LSAEELAQRAEDGVDVAALVADLERQRRVVRATVAGAKRYIAVEDAARYRDALGVPLPP
FT                   GLPDVWLEPAQDALLSILRRYARTHGPFTTAQVAARFGVADSLVEPALTALHAAGKLLE
FT                   GEFHPRGTGSEWCDPEVLRIIRRKTLARLRKEVEPVDEAVFARLITRWQGVSVRRPGLD
FT                   AVLDAVELLQGAPIPASTLEREILPARVKDYRRGDLDTLIAGGEVVWVGVERLGRRDGR
FT                   IALYTAQNVAKLLAPAELRPLPQLSELAQKLLEFLKTQGASFFPALQAASGAGFFGETL
FT                   DALWELVWAGLVTNDTLQPLRALVSGGDSKRGDERKNGRPESLGRSRGRAPNPAGQGRW
FT                   SLVETRIGGNSAGVTEWSAAVAQQLLNRYGILTREAVAAEGIPGGFSSVYRTLRAMEDS
FT                   GLVRRGMFVGGLGGAQFAMNAAVDMLRRLRNPPEQPETLHLATVDPANPYGAILPWPRT
FT                   ENNATLSRTVGTSVVLVNGALAAYLRRSSEEVTVFLPENEPERSATARALAGKLAEIAI
FT                   ARQAYRAGLLVGTINGAPAEKHLLGRFLEQAGFVKTALGYQMRRVGGPLVGRAEPEVEE
FT                   EELESDEAQID"
FT   misc_feature    436855..436916
FT                   /note="Selenocysteine insertion sequence (SECIS) (RF00031),
FT                   score 15.82; Acid345_R0004"
FT   gene            complement(440346..443270)
FT                   /locus_tag="Acid345_0385"
FT   CDS_pept        complement(440346..443270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0385"
FT                   /product="Integrin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39390"
FT                   /db_xref="GOA:Q1IUR0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUR0"
FT                   /protein_id="ABF39390.1"
FT                   /translation="MLKYLVSKAYTVTGLPKVIQRGIAAAVWLGLIGSGCSAFASTATT
FT                   TTLAITSGGTAVTTISAGSQVTLTATVLAGSTAVKQGQVNFCDGAATHCSDIHVLGTAQ
FT                   LNSSGKAKITLRPAPGSFSYKAVFVGTPKTTTAYAGSTSSTASLTVTGKLPSFTTIAEL
FT                   GPSVGYTLTATTYGFTKAKTATAPTGTISFVDTTTGNSVLTSAALATPQAAVNWVNSYT
FT                   STLGYLPNAMVGADFNGDGYPDIAVELSNTANPVGIYLGNGTGNFNEVTKSPIIAAGIP
FT                   VLAQDFNGDGIPDLVLCHGHNDSLTVLLGNGDGTFTEAPANPFGDGLGIPPVVVADFNG
FT                   DGIPDLATGGAGSLSVFLANGAGAFTQVPTTSKTLILGNFATMVAGDFNGDGITDIAAL
FT                   DATFSETVRVYFGSGDGTFTTGPTNMVSPGGSAGAPMVMVTADFNGDGKADVAVPLWNG
FT                   GVAVLLGNGDGTFQEASGSPIGLGDYTLQVGLADFNGDGVPDLMLQQESNITNAYALLG
FT                   KGDGTFTVSSNPAPYLPCCGIALLMDVNGDGLTDVVNSSQYDGTASVLLTSAQQATTQV
FT                   TGISVGGTSPHNVVAKYPGDTKYLASISAPTELQPPAAAPVFTPASGSIRPYMDSIKLT
FT                   SSTPGATIYYLAVGAIDTGGSYVTYNGPIYGYNMGSATIHAYALAPPNYGQSATVTATF
FT                   NVVGIPAAMTSPVPGSPLTGSSATFTWDTGIGGSQYSLYLGSTPGAHDIAYISAGTNTT
FT                   ATVTGLPTNGELLYVTLYSWMGTKWQSNAYTYVTSGKGTAGTMTSPANGSRMTGGTQAF
FT                   SWTKGTGTDGYSLYVGKTAGSHEIAYVNAGRATTTSVNGLPTNGEEFYVTLNSLNGKTW
FT                   LQNTYHYYASGSGTAAVMTSPANGTTLASSTVTFSWTAGTGINEYSLYIGTKPGAHDLA
FT                   FVNAGSATTKTVSGLPTNGSKVYVTLYSRNGTKWLSNSYSYTAK"
FT   sig_peptide     complement(443148..443270)
FT                   /locus_tag="Acid345_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.994) with cleavage site probability 0.806 at
FT                   residue 41"
FT   gene            443563..444057
FT                   /locus_tag="Acid345_0386"
FT   CDS_pept        443563..444057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39391"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ9"
FT                   /protein_id="ABF39391.1"
FT                   /translation="MCKLYWLTRLRCSGLKSRADLQPSTSQRRPSTRETKRANRRQRLR
FT                   HPVLVNFRRAPRHHIHVLRRRTIGKGHDAIARAGLYHSGGSATFTWTAGTGVTQYSVYI
FT                   GSTPGAHDIHYVNAKHALSTSVTGLPSDGGTIYVTLYSLIAASTRAKRTPTSLGRRHAG
FT                   R"
FT   gene            complement(444061..446481)
FT                   /locus_tag="Acid345_0387"
FT   CDS_pept        complement(444061..446481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0387"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39392"
FT                   /db_xref="GOA:Q1IUQ8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ8"
FT                   /protein_id="ABF39392.1"
FT                   /translation="MNSRQLLRFLKSAMLSLLLAGVTLAQGGPLELKREGRVISLVPYA
FT                   PNVLRVTMSIDNSAASAAPGFGIVGAPSPTGWTHEHDADGSEVYRSDNMIVRLAPGDLP
FT                   KEKLPRPMPLDELNQQLRDVYFGGGGDHGPNHDALLVTTPQGKMLLHMRTWIMTPQQEG
FT                   AQAKSGGKTYRVSASFDSPSDEHYYGLGQQQKGWMDLRDHQIHCWHDYGAIGGENVCVP
FT                   FMVSSRGYGLVWDNPSKTTVDLGFNGQNRWTSDVGDRVSYFVIAGDSSDQIYAGYRLLT
FT                   GVTHLLPRGSYGYIQSKAIYPTQGQILDLARTYREKKVPLDTVVVDFLNMTRQGEMDLD
FT                   PKRWPDPAGMNRQLHDMNVRTLLSVWPHFAPGTQFYDMLLKKGWLIHTPDGKPDHGWYK
FT                   EIIGPNLDTTNPDAAKWWWEQIRDRYVKPYGFDDLWLDETEPDVDPANDVFWVGPGTSF
FT                   YNVYPLFHTASVYEGFRRDFGDSKRLMILARASYLGAQRNGTVFWSSDIVSTWDMLRRS
FT                   IPAGLNFTASGMPYWDTDIAGFFSPAIPADHHAEHKPLIDGSDARDVIDRYEDYPELFV
FT                   RWFEWGAFHPVMRAHGERKHNEVWAYGKQAEPILTKYLKLRYELLPYTYSVAYRSYETG
FT                   APYMRALFMDFPNDPKALDIPDEYMYGPAFLVAPVTEQGATQRTVYLPAGSDWYNYWTN
FT                   EKLHGGQTVVVQAPIDTLPLFVRAGSIVPFGSEVQSAQQEQKIASVRIYPGANGSFTLF
FT                   QDDGKTYAYEKGAGSVTKLMWNDAEGRLKHEGVPAWNGSDESIVVVVGKKPMQ"
FT   sig_peptide     complement(446398..446481)
FT                   /locus_tag="Acid345_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.517 at
FT                   residue 28"
FT   gene            446563..446904
FT                   /locus_tag="Acid345_0388"
FT   CDS_pept        446563..446904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ7"
FT                   /protein_id="ABF39393.1"
FT                   /translation="MCAAGDLLVPEALEEARIHLCCADRSELLGWRSAEVATERAELGN
FT                   PTKGNVLSLLANGNVVPGQQILRKTIAALSSSRACAMAWARRLAFQHLESVVGVGGLRL
FT                   RGLWPLRSG"
FT   gene            complement(446925..447890)
FT                   /locus_tag="Acid345_0389"
FT   CDS_pept        complement(446925..447890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0389"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39394"
FT                   /db_xref="GOA:Q1IUQ6"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ6"
FT                   /protein_id="ABF39394.1"
FT                   /translation="MKSMATQPKPAEDDELLFDMSVSFCGIKLKNPVLAASGTFGYGVE
FT                   FEDIVTIEKLGGFVSKGLSREPMPGNPPPRLWETAAGMLNAIGLQNIGAKAFVEEKLPL
FT                   LRKLKNVPVFCNVYGTCNEDYEETIRILNDGEGITAYELNVSCPNTQHGGMTFGADPTL
FT                   LAEVVTVAKKAATRPLIVKLSPNVTSIPQMAKIAQDAGADAISLVNTFVGMAIDVETRK
FT                   PRISNIVAGLSGPAIKPIALRMVYEAAKTVTIPVIGIGGISTAEDIVEFMLAGATAVEV
FT                   GTANFWDPCASERLVDQLEKWCLEHRVQKISELTGGMLLS"
FT   gene            complement(447960..449555)
FT                   /locus_tag="Acid345_0390"
FT   CDS_pept        complement(447960..449555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0390"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39395"
FT                   /db_xref="GOA:Q1IUQ5"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR026263"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ5"
FT                   /protein_id="ABF39395.1"
FT                   /translation="MKRLALLLLVLSQLSFASAYDAHPKLVVVIVIDQFRGDYLQRYHN
FT                   EFGEGGFRLFTDHGAYFSDCYYDYATLVTGPGHATIGTGSYTIGHGIMANEWFDPQINE
FT                   RVTSVSDEATHIVGVEGGQGSSPHNLLTDTFGDELRMATQGRSRVFGISMKDRAAILPT
FT                   GHSANAAYWLDGKSGAWITSDYYMKALPPWVEAVNHSDEAKKFLNRDWKDAAGKVMGNT
FT                   NPRNDEDGQPEDYFEIVGSTPFANDLELDFARSLITNEKLGTRATTDLLVISLSENDIL
FT                   GHAVGPDSPILHASIVELDRQLAGFFQFLDKQFGMNNVWLALSADHGVAPVPREVQTLH
FT                   MPASEMDTKQFTEKLNEEIAKTTGKPGKYLRSAGLPMISLDPASWSDTKEADAEQIVGE
FT                   AAVRTGALAYFTKSDLAKGRVPETPMGHKFANTYSPYGGWWVMVQPRPFTIPKEDGTTH
FT                   FSPYSYDAHVPLAFYGVPFAPGVYRGHSEPIDLAVTLSSLLGTNKPAAATGRVLTEALK
FT                   PPPNPPAGEKHLVK"
FT   sig_peptide     complement(449496..449555)
FT                   /locus_tag="Acid345_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.629 at
FT                   residue 20"
FT   gene            449674..450972
FT                   /locus_tag="Acid345_0391"
FT   CDS_pept        449674..450972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0391"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39396"
FT                   /db_xref="GOA:Q1IUQ4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ4"
FT                   /protein_id="ABF39396.1"
FT                   /translation="MLMLDLGFVRDNLALVEEKLRQRGMNPDEVLKGFPEIDARRRAAI
FT                   TEAETLKAQRNKASEQIAQLKKNKQDATALIEETKQAREKIAEFEKNAEAAEGAMCEIL
FT                   VSIPNLPHESVPVGRSEHDNQEVRQWGTKPTFDFTPKPHWELGEELGVLDMERAAKITG
FT                   ARFAVYWDLGAKLERALMNFMLDLHTKEHGYTEVLPPFLVNADSMYGTGQLPKFEADLF
FT                   KVPHGERNLYLIPTAEVPVTNLYRDETLDAAQLPTSLTAYTPCFRSEAGSYGKDVRGII
FT                   RQHQFQKVELVKFTKPEESYAEHEKLTRNAEEVLQRLGLHYRTMVLCTGDMGFSSAKTY
FT                   DIEVWLPGQNLYREISSCSNFESFQARRANIRYRPEGKNKTDLVHTINGSGLAIGRTWV
FT                   AIIENYQQADGTVVIPEVLRPYIGAERITPRKL"
FT   gene            451014..451379
FT                   /locus_tag="Acid345_0392"
FT   CDS_pept        451014..451379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39397"
FT                   /db_xref="GOA:Q1IUQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ3"
FT                   /protein_id="ABF39397.1"
FT                   /translation="MNVWKTIKGYLWWTYPRGSLHYDVMVSLILLFIFLGPRWIHFGDK
FT                   PPGTAAHPTAVLVQPAGDHLFIYQLDASAITATTDRAIRQQLKSVIEPFSGSMVIDRYA
FT                   VEKTDANHAVYKVWVHR"
FT   gene            451391..452083
FT                   /locus_tag="Acid345_0393"
FT   CDS_pept        451391..452083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39398"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ2"
FT                   /protein_id="ABF39398.1"
FT                   /translation="MKTKSLMACALWMVMLSGAAMAQQANGLEGVLASMDKASANFKAI
FT                   ECSFNWDQFTKVVNDTDTQAGHMFFRRSGESIEMAAHIEKPDTKIVVFSNGIVRIYQPK
FT                   IDTEQRIDAGKNRAEFESFLVLGFGGRGHDLSKSFDVQFGGNETVQGVTTAKLVLTPKE
FT                   AKVKNMFNSIILWIDPARGISIQQQFMQPSGDYRLAKYTDIKVNQKLPDDAFKINTTRK
FT                   TKVVTPNG"
FT   sig_peptide     451391..451459
FT                   /locus_tag="Acid345_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            452259..452609
FT                   /locus_tag="Acid345_0394"
FT   CDS_pept        452259..452609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39399"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ1"
FT                   /protein_id="ABF39399.1"
FT                   /translation="MAIQVLANLLAVSRPGAILRATKAVLGSSNSRAAEIPPMYKVSRM
FT                   GRVVVIPARPNPERIKRVQTSDRKYIDGQKLIVEAMKYLAQSDPENNRPAIELLSEHFR
FT                   TRFRMSDTPLES"
FT   gene            complement(452689..456462)
FT                   /locus_tag="Acid345_0395"
FT   CDS_pept        complement(452689..456462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39400"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUQ0"
FT                   /protein_id="ABF39400.1"
FT                   /translation="MRISRIRVTFLLFSFVLSTLCLHAQTSTTAVRGTVVDQNGGVISG
FT                   ANVTLHDAKTDFTRNMDTNGQGEYQFVQVPPATYTLTVKMKGFNTTTQTLQLLIGTPAT
FT                   ANISMTVGAESTTVDVSGEAPLVNTQDASLGNAFGNIQIKSLPLDARDPTELLSLQAGV
FT                   VYVGNNNQIDQTFDSRNGATQGARSDQSNVTLDGLDNNDQTNGFAFNGALRSTPDSLEE
FT                   FRVTTTNSNADQGRSSGAQVQLVTKSGSNKYHGSLYEYHRPTVGVANEWFTKAAEISSG
FT                   EPNTPQKYLRNNFGGSVGGPIIKDRLFFFFNYEGLRQREDVSVLRTVPTKDLAHGYISY
FT                   VCGDGCVQRLDPTQIAYMDPQGIGPDPTVMAYLQQYPAPNTTVIGDGLNYSGYVFSSPQ
FT                   PLNQNTSILKLDYNLTANGNHRLFVRGNLQDDTSFGVEQFPGQPASSKTRDNNKGIAAG
FT                   YTAAFGANWVNNLRYGYIRQGGSTSGLSDQSFFTLRGIDTLQSFSRSASVNVPVQNIMD
FT                   DVSWIHGNHTIQFGGNYRRIDVYHHNNSNSFSGASSNPSWLVNAGIANTGQAFDPAAYG
FT                   FPAVDSGWTNNYDYPMGALAGLITEVDTTYNRDRTGNTLDQGAYISRHYRDNEGEFYIQ
FT                   DSWRIKPNLTITGGVRYSLLQPPFESNGLQVQPTINVGDWYQQRWQSMLQGNTNQPSMT
FT                   FDLSGKGNGGKPYWAWDYKDFAPRLAFAYSPKFEHGPMHWLFGSDGKSSIRGGYGMYYD
FT                   HFGEGIINTFDQYGSFGLTTTITNPAGIIDPGSAERMNNIVGLPGSILAPPPANGWPIT
FT                   YPDNFAITWGLDDHLKTPYSHVVDFSITREFAKNYVVEASYVGRFGHRLLQQDDLATPL
FT                   DIVDPKSGMDYFTAATMLVKYANAGADISTVPNIPFWQNIFPNAAGAGKIYGCSNGSDT
FT                   GANYSATQTVYDLFACVPTNATTALQYLDYPGLQNPGDCFPACSTINGKYGPYHFYDSQ
FT                   FSSLYAWRSIGVSSYHGLELSLRHHGSSNLQFDVNYTFSKSLDMGSDAERISWVSGPGG
FT                   QIINSWDPRALHALSDFNATHQLNTNWVYNLPFGHGQRWGTDSGRFADAILGGWSLSGI
FT                   LRVSSGYPFSVNNGANWATNWELGGDSILVGPKPKTGTYMINGQPNVFADPSTAINAFR
FT                   YAYPGESGQRNNLIGPGFFNMDTSLAKAWKITESQLIRFQWDVFNVTNSVRFDALTMAF
FT                   NNGSIGNSTQFGQYTNTMTQYRRMQFALRYEF"
FT   sig_peptide     complement(456388..456462)
FT                   /locus_tag="Acid345_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.968 at
FT                   residue 25"
FT   gene            complement(456626..458095)
FT                   /locus_tag="Acid345_0396"
FT   CDS_pept        complement(456626..458095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39401"
FT                   /db_xref="GOA:Q1IUP9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP9"
FT                   /protein_id="ABF39401.1"
FT                   /translation="MIRFIRDSKGLFLIGALVAFAFRLVFIFKFPHVTGDTYIYGDIAK
FT                   NWIDHGIYGFTQLVGPPNPTWIRLPGYPSFLAVCFALFGREHYTAVMLVQMFVDIASCF
FT                   VVADLARRMMSERAGKIAFILACLCPFTANYVASPMPETLSIFAIACAFWFLYIALDSP
FT                   QPVGATSKTSSVILSEAHAMRAVEGPLSPTRRFWPWFFCGLSIAAAIQLRPDGGILLAS
FT                   TLLFLFVRLIRYPQRKQTFAAGVLVATIALAPLIPWTIRNWRTFQHFQPLAPRYASDLD
FT                   EFTPLGFNHWVRTWMAEYVSVEDIYWQMPGSASDVELLPRRAYDTPEEEARTRDLFEQY
FT                   QTRTAIWPELDEQFEQLARERVARHPFRYYVQLPLLRITDMWLRPRTETLPLDSRWWQD
FT                   YTDDFWNSFKAAGLGLINLIFVALAVVACFLRPRPRYLLAVLAFLLIRTAFLGTLENPE
FT                   PRYTLECYPLLIALAAITISRLPSRRSSQKL"
FT   gene            458230..461694
FT                   /locus_tag="Acid345_0397"
FT   CDS_pept        458230..461694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0397"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39402"
FT                   /db_xref="GOA:Q1IUP8"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP8"
FT                   /protein_id="ABF39402.1"
FT                   /translation="MPGPVFYDPERKRWRRLRMALDITGVLATLLIVFFIVSIVRNTNV
FT                   PSLGLTEAKKPYHALKENQKRKYFRKASTHRKTKQAPSQVQLNTTEGIRAAFYVDWDAA
FT                   SFSSLKQYYPQIDLLFPEFLHVLTEDGHIQGVTAENKLFDVMDASGKVRPVDDKLMPYL
FT                   KAEKAETEVFPLVNNFDPIANEWKSDIGDFLDDPASRANFRKQIDAFLGSDRYRGLTLD
FT                   FEEIPVDSMPGFEALVSEIYQDMHASGKKLYISVPAKNTDFNYEAVAKNSDGLILMNYD
FT                   EHYPGGPAGAVASQDWFVENLKFAVKHVPREKIICAISNYGYEWTTIGNAKLPQTAHTV
FT                   STQEAWTTAEESDADVELDGDALNPHITFMEGENARHDVWFTDGVTALNQMRAAQQLGI
FT                   DTFALWRLGSEDRSLWNVWDRPGEQGAPDKLKDVPPGQDVDMEDAGEILQIEERPAPGQ
FT                   RTIKVDAETGLISEEDFTKIPSPYRIARYGSSDKKIAITFDDGPDPTWTPKIMEVLDKY
FT                   GVKGTFFLIGVQAEKYPGVMKKLYDDGHEIGNHTFTHPDISSVSRSYFKTVELNLTERL
FT                   FAAKLGVKPVLFRPPYSIDQEPDTADQVGPLELAQDMGYITVGDKIDTNDWRDDPRKTA
FT                   PEMFTEVMNNLPPCKPTNFLTCGNVILMHDGGGDRSETVKALNLIIPAMQARGYKIVPV
FT                   SELLGKTRAEVMPPISKNERWAAMVASLSFILFGAVSQFIIAVFFVGDVLMTGRLVFIG
FT                   TLAIYDRIRGPRLTADPDYRPAVAVLIPAYNEEKVIERTVRSVLDSDYPKLRAIVIDDG
FT                   SKDATVEVVEQLFAAEIASGKVTLLTKPNSGKAAALNYGLEFVTEEIFVGIDADTIIAP
FT                   DAIGLLVPHFQNPKIAAIAGNAKVGNRVNWWTRWQALEYITSQNFERRALDVFGAVSVV
FT                   PGAIGAWRTEAVLAAGKYHHDTVAEDADLTMALLQDGYRVEYEDLALAYTEAPSTANGL
FT                   MRQRFRWSFGIMQSVYKHRSAFKQGGALGWFALPNVVIFQILLPLVSPFIDLMFLFGAG
FT                   SYAWNRYMHPESTDPSSFHKLVLYFALFLVIDFVASTIAFTLERRQPGGQKDFWLLAHV
FT                   WLQRFAYRQLFSIVLIKTLKRAIEGGEFAWDKLERMASVKPVGVHTK"
FT   gene            461785..462168
FT                   /locus_tag="Acid345_0398"
FT   CDS_pept        461785..462168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0398"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39403"
FT                   /db_xref="GOA:Q1IUP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP7"
FT                   /protein_id="ABF39403.1"
FT                   /translation="MSKQPKILFVEDSIFFRKAVTQTLTNEGFEVQTAATGEEALQRAQ
FT                   NETPDMILLDMMLPRLDGMMVLRILRSGEKTRNIPVIVLSGNAMERDRATAQKLGISHY
FT                   FRKDASPITELVTTMRAMLGVVA"
FT   gene            462226..462564
FT                   /locus_tag="Acid345_0399"
FT   CDS_pept        462226..462564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0399"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39404"
FT                   /db_xref="GOA:Q1IUP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP6"
FT                   /protein_id="ABF39404.1"
FT                   /translation="MSEFFEQAGFAVRIARTAAEAKEEVGHKHFSLVITDLRMESGRDE
FT                   DGLGLIRHIRQHNPGLPVFVLTASGAPETESEGWRLNVDKFLGKPISMPKLLTTVKEFV
FT                   GQFYGAVQ"
FT   gene            462874..464469
FT                   /locus_tag="Acid345_0400"
FT   CDS_pept        462874..464469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0400"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39405"
FT                   /db_xref="GOA:Q1IUP5"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP5"
FT                   /protein_id="ABF39405.1"
FT                   /translation="MATTLTSRVEVRVPTKFSNEPLTDFSREDNARKMRSAIEKVRGEL
FT                   GREYDLIIGGKRIKLAKKLQSVNPSNPTEVVGVFQEAGAAEVEPAMQAALKAFETWSRT
FT                   SWEERANLLFRVANMLQERKFEFSAWMVFEVGKNWVEADADVAETIDFAYFYALEALRL
FT                   SQAKTPIQLPGEVNTLKYIPLGVGAVIPPWNFPCAIMAGMTMASIVCGNTVVLKPSSDS
FT                   PAIAAKFMELLEEAGLPDGVVNFCTGGGRSFGGNVVNHPKTRYIAFTGSKEVGLDIHEH
FT                   AAKTQPGQVWIKRTILEMGGKDSIVVDADADFDAAVEGVAQAAFGFSGQKCSACSRAIV
FT                   DERIYDRFIGALRERVAKITVGDTTKNPGMGPVINESSMKKILGYVEKAQQEGGRLILG
FT                   GVRDEEAGPGYFIKPTIIADVAPNATISQEEIFGPVLAVMKCRDFEEGVKIANNTEFGL
FT                   TGAVYTGTQDKLDYAAQEYFAGNLYLNRKCTGAMVGAHPFGGFNMSGTDSKAGGPDYLL
FT                   LFTQAKSIAEKVIR"
FT   gene            464631..464996
FT                   /locus_tag="Acid345_0401"
FT   CDS_pept        464631..464996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0401"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39406"
FT                   /db_xref="GOA:Q1IUP4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP4"
FT                   /protein_id="ABF39406.1"
FT                   /translation="MARILCIDDEPHVVTLKCAILEAAGHTVTPSSSAHDAIEKLKTNE
FT                   YDAVVTDWRLGDANGRAIVQAAKSHSSVPVVVVSGYVAEAFQAAEPLADLYLEKPVNPE
FT                   ELVTIVNELLKTSERSA"
FT   gene            complement(465021..465362)
FT                   /locus_tag="Acid345_0402"
FT   CDS_pept        complement(465021..465362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0402"
FT                   /product="Ion transport, K+ channel"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39407"
FT                   /db_xref="GOA:Q1IUP3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP3"
FT                   /protein_id="ABF39407.1"
FT                   /translation="MFLSGITLTFFKQFGLGIWLTLPVLIAFGLVIALCGQVVGRREGW
FT                   SRFDSFYWSFVTATTVGYGDLHPSKRGTKMLALFIALLGMSCTGILIAVGVHAITLALA
FT                   AHDAAGKLH"
FT   gene            465563..466999
FT                   /locus_tag="Acid345_0403"
FT   CDS_pept        465563..466999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39408"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP2"
FT                   /protein_id="ABF39408.1"
FT                   /translation="MSCSSERVPMEKLRQSLFRSLMAILCAIALLPGEALAAPLPQQAP
FT                   APASSASSPTTSKISADQMESLLAPVALYPDPLLAQVLAASTYPLEIMQLQQWLGRNTG
FT                   LKDKALADAVAKEPWDPSVQALAALPDVVKRLADDVQWTTDLGNAFLSQQQDVMDAVQR
FT                   LRKKAQDKGTLKSTEQQKVETKVIETKTVVVIEQANPQVVYVPTYDPMVVWGPLYYPYP
FT                   PIWYPPYGYYGAGLAISFGVGIAMGAFWAGGWGWGCGWGGGDININRNNNFNRNSNIGG
FT                   GNRVNNGLPGRGDGNRGNGGNRGNGGRVNNDLPGGRGGTGGDRWSHNPQHRGGTPYKDR
FT                   GTADRFGGTTRGDSLAKRQSGARQTIGRQGGQLPSNRAGAGGNRGGAGAGNRAGAGPGA
FT                   GNRGGAGASNRVSSGGGADRIGSRDVSRSGGGNRDALGGGNRSYSGSSARSSSSRGSSS
FT                   MGSRGGGGGSRGGGGGGRRR"
FT   sig_peptide     465563..465676
FT                   /locus_tag="Acid345_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            467039..468055
FT                   /locus_tag="Acid345_0404"
FT   CDS_pept        467039..468055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39409"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP1"
FT                   /protein_id="ABF39409.1"
FT                   /translation="MNAKLKTLSRSLWFGVAVCALSTMGMAQEKPAATATPAAADKTTA
FT                   AKATAPTAATLGAKAFDTPQEAAEALVAAAKNFEVGKLVEIFGPGGEDIVFSGEFAQDR
FT                   KHATDFAKEAEEKKSVSVDPKNGNRAFLLVGNEEWPTPVPIVKRGTKWYFDANAGRQEL
FT                   LYRRIGANELDAIQICHGFVEAQYEYAEKPREGYEVNQYAQRIIATPGKQDGLAWQKTD
FT                   GTWEGPVGEKIAKALEEGYTSKAEPYHGYFFKILKGQGPAAPMGQLDYVIKGAMIGGFA
FT                   MVATPAIYGATGVKSFIVSQDGVVYEKDLGPESLTKFQGMDLFNPDNSWTPVAEDED"
FT   sig_peptide     467039..467122
FT                   /locus_tag="Acid345_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.935 at
FT                   residue 28"
FT   gene            complement(468113..468769)
FT                   /locus_tag="Acid345_0405"
FT   CDS_pept        complement(468113..468769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0405"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39410"
FT                   /db_xref="GOA:Q1IUP0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUP0"
FT                   /protein_id="ABF39410.1"
FT                   /translation="MLKILLADNQAIFRAGIAKVLAVEDDLRVVAQAGTLEQMMMAIDK
FT                   FRASVLIFSASFVPDLSALVQAATRCKTGLIVIAENGENSARYLNGGVRGVVYRNVSGD
FT                   MLVDCVRRVARGDRFTQETKPAAATPESDDFVGARVRDRLTPKELRIVALIVQGYKNKE
FT                   IAVQLGTTEQVIKNYLRNVYDKIGVSDRLELALFTIHHHILAEAAAATTEGRMLQ"
FT   gene            complement(468782..469093)
FT                   /locus_tag="Acid345_0406"
FT   CDS_pept        complement(468782..469093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39411"
FT                   /db_xref="GOA:Q1IUN9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN9"
FT                   /protein_id="ABF39411.1"
FT                   /translation="MSEVRTGKRFDVHLPIKISGEGAQTHEGQTDNLSAAGVFLSLDQS
FT                   LEVGSQVEFDITMPASVIGAEKDVRIHCHGRVVRTEGPKDGATNSGVACVIDKYEFIR"
FT   gene            complement(469491..469916)
FT                   /locus_tag="Acid345_0407"
FT   CDS_pept        complement(469491..469916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0407"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39412"
FT                   /db_xref="GOA:Q1IUN8"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN8"
FT                   /protein_id="ABF39412.1"
FT                   /translation="MINEIHTRNGKSIADVLNDFKNEVHRAVLTRAQLFVEEIKQKAVS
FT                   IKASLPMLVMASIFLLTAWFLFTAAIVTLIAAAIPGNPWAYPIAFGAVMVLYALIGGIL
FT                   AMTGMKALRKNNLTPEKTIRVLREDGILLETEARRIA"
FT   gene            complement(469909..470475)
FT                   /locus_tag="Acid345_0408"
FT   CDS_pept        complement(469909..470475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39413"
FT                   /db_xref="GOA:Q1IUN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN7"
FT                   /protein_id="ABF39413.1"
FT                   /translation="MADPLRNQSGIPAARAASKPIFDDRSVDELLAGFPADRSLPEAGN
FT                   PRLNRAAESIGGALGTTVGRVRNGLTLVKGNLVETSNQITEQISDKASAIKDKVESQAH
FT                   DLNITARAKAAEFGDVVQGTSEQLAGIAERQWLELRQNARQRLIMARNRAAVLKQDHPL
FT                   ELIAAFAGAAFVIGFAFRVWRSDHD"
FT   gene            complement(470570..471433)
FT                   /locus_tag="Acid345_0409"
FT   CDS_pept        complement(470570..471433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0409"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39414"
FT                   /db_xref="GOA:Q1IUN6"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN6"
FT                   /protein_id="ABF39414.1"
FT                   /translation="MSKPAQLLWKIARILLIVYAVLCLVLVFAQSHMLYFPQPVIESTP
FT                   EDYNAQYEQVWIPGADNSKLYAWWLPSQDPAAPTLIYFHGNYGNVGSNAEQASRLARTC
FT                   CNVLLFDYRGYGRSAGPFPSEKRIYADAEAAYNYAVTQKKVSPNHIVFYGHSLGGGVAF
FT                   EMAKRHGDAAGLIAESTFTSVADRAALDPLYRFFPVRLLVHQRFDSIHKIAAIHMPMLV
FT                   IAGTGDTTIPYAMSEQLYRSAPPNSELLLIPGAGHDNPAVVGGAKYIEAVKRFVSRVPA
FT                   QQLSSR"
FT   sig_peptide     complement(471344..471433)
FT                   /locus_tag="Acid345_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.898) with cleavage site probability 0.492 at
FT                   residue 30"
FT   gene            complement(471430..473568)
FT                   /locus_tag="Acid345_0410"
FT   CDS_pept        complement(471430..473568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0410"
FT                   /product="peptidase S9, prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39415"
FT                   /db_xref="GOA:Q1IUN5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN5"
FT                   /protein_id="ABF39415.1"
FT                   /translation="MRKLSNVLILLFLSIGSSLFAQQKPKLTLDEFFNAVYYRDVHIAP
FT                   DGNAVVFATERADWDNDRFREDLWLYRTNGGSLIPLTRTGHDSSPQWSPDGQWIAFLSD
FT                   RATDSDSTKDDDDDSKDKSKGVSHVYVISATGGEAFAVTRGEEEIHAFAWAPDSKGIYF
FT                   ATRTPWSKEKKDAYKEAWKDTVQYRASERGDVIARIALADVMARHFSLTSEPKEKKKKD
FT                   SDKEDKPETAETPGSALITSTPFRVRQLAVSSDNARLAFLTGSISEREESAADFEIYAA
FT                   EIAGTVPEQAKRLTNNSGIEFEIRWAADNHHLFFQNSEGSVESTKYADTQNRIYWIDAT
FT                   TAQIERWAATYKGHVSEYAPLKPDTLLTAGMSGTETQLYTATGAKGEVKKISSWPGTYA
FT                   NVSAIASSPRVAFIYSRVNKPTEIYLADSLDQLADAKPITSFNKLFTERALPEAKPFQW
FT                   KADDGVTVEGMLIYPPGKFGEKNLRMFTFIHGGPIDADGDHFGADWYDWALLAASEGWL
FT                   VFRPNYRGSTGYGDEFEQQIAPHLVSKPGKDILEGVDALVKAGIADPNQLAIGGYSYGG
FT                   YMTNWLITQTTRFKAAVTGAGAVEHAANWGNDDTTLDDSWYLGGAPWEATKMYTDEAAL
FT                   YQANKIKTPTHMVAGGDDIRVAVLEDYLLEHALKTLGIPNALLIFPGEGHGLGKNPWHG
FT                   KIKVREEIKWLEKYAPAK"
FT   sig_peptide     complement(473503..473568)
FT                   /locus_tag="Acid345_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.981 at
FT                   residue 22"
FT   gene            473659..474057
FT                   /locus_tag="Acid345_0411"
FT   CDS_pept        473659..474057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0411"
FT                   /product="Alkylhydroperoxidase AhpD"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39416"
FT                   /db_xref="GOA:Q1IUN4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN4"
FT                   /protein_id="ABF39416.1"
FT                   /translation="MNPERKEPEYLFTEKQVGEKSGIAQRFLDTRAELNGIVTQADNYL
FT                   VKRFYNIDHNTYLEGAIPAKYKELMGLVVSAGLRCDDCINYHIIQSYRLGANRPEQEEA
FT                   LNVALVVGGSIVVPHLRRAYALLQELYS"
FT   gene            474029..474490
FT                   /locus_tag="Acid345_0412"
FT   CDS_pept        474029..474490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN3"
FT                   /protein_id="ABF39417.1"
FT                   /translation="MRCSRSYILSAPNRGFMKRTLCLLAVLVLGVAVCAPLIAQEMPQI
FT                   DKKQIKKDAKDRDKEAKKMAKQARKEEGSQRKDALKQEKAAKKQVAKDHTSEQKKALKE
FT                   AKKQKKDEKKEIKEAKKQNNGLHDPEAPKEKKKKGKDKGESAAPAAPAS"
FT   sig_peptide     474029..474148
FT                   /locus_tag="Acid345_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.988 at
FT                   residue 40"
FT   gene            complement(474487..475665)
FT                   /locus_tag="Acid345_0413"
FT   CDS_pept        complement(474487..475665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0413"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39418"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN2"
FT                   /protein_id="ABF39418.1"
FT                   /translation="MNAPSQLHYDVIILGAGAAGLMCAIEAGKRERRVVVLDRAEKIGK
FT                   KILISGGGRCNFTNLHTTPANFLSENPHFCKSALARYTPSDFIALVEKHNIPYHEKTLG
FT                   QLFCDRSARDIVHLLETECTAAGVRIVTNSLVQEVRRADEFIVIADSAEYRAPALVVAT
FT                   GGLSIPKIGATSLGYDIARQFGLNIIEPSPALVPFTFNDEDSATYSDLTGLSADVIASC
FT                   NGAHFREKMLITHRGLSGPSILQISSYWRSGETITLDLAPAQDVTSALRAHPAGRNESS
FT                   LKSEFRKVLAQRLADRWVERHLPKSWTNHALEDLERQAHAWKIVPAGTEGFEKAEVTAG
FT                   GVDTNELSAKTMESRKVAGLYFIGEVVDVTGHLGGFNFQWAWASGYSAGQAI"
FT   gene            475793..476035
FT                   /locus_tag="Acid345_0414"
FT   CDS_pept        475793..476035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0414"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39419"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN1"
FT                   /protein_id="ABF39419.1"
FT                   /translation="MDEVQIYARLTDIFHDVFDDESIVVKPELSAKDMEGWDSLTHIRL
FT                   MLTVEKAFKMKLSTAEIGRLENVGALVELIRERAK"
FT   gene            476046..477974
FT                   /locus_tag="Acid345_0415"
FT   CDS_pept        476046..477974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0415"
FT                   /product="HAD-superfamily phosphatase subfamily IIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39420"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUN0"
FT                   /protein_id="ABF39420.1"
FT                   /translation="MNALYSELRWLPRGPEDFTRQLKSVGESEETLGSALQRLASFALD
FT                   LNQLTKLAKVVAKAQSEKRSLAPLIPFRLAVLSNSTTDLLVPALIASAARHGISLEVAR
FT                   SSYDQAAQEALNPDSETNRSKPDAVLFAMDYRALPLKLSAGNAQAAAETVNDAIGYLQS
FT                   LRDGVKEHSGGLCIFQTFAPPVELLFGSMDRSVPGTMRSLIDAINRELADFVRSSGDVL
FT                   LDVAGLAETVGLADWHDPQLWNLGKFAFSDRFIPIYADRVALTIAAIRGKSRKVLVLDL
FT                   DNTIWGGVLGDDGIEGIKLAQGDAEGEAYLAVQRMALDLRSRGIVLAVSSKNDDAIARG
FT                   PFERHPEMLLKLEHVAVFQANWSDKATNLQAIADELSLGLDGLVLLDDNPVERGMVRQL
FT                   LPQVAVPELPEEAAFYARTLAAAGYFETVTFAAEDLKRAAFYQDNAKRAELQKQVRGVD
FT                   AYLASLDMTITFQPFDAAGRSRIVQLINKSNQYNVTTRRYTEPEVIEAEEDAKVFTLQV
FT                   RLADRFGDNGMISVVICRPAEAGTWEIDTWLMSCRVLGRRVEHMVLREVLRHARATGIQ
FT                   KLRGTYLATEKNGLVADHYSKLGFNQIAKHLEAVTQWELLLEKADVSEAPMKVISRGFP
FT                   AAQEVLP"
FT   gene            478049..478137
FT                   /locus_tag="Acid345_R0005"
FT                   /note="tRNA-Leu2"
FT   tRNA            478049..478137
FT                   /locus_tag="Acid345_R0005"
FT                   /product="tRNA-Leu"
FT   gene            478185..480206
FT                   /locus_tag="Acid345_0416"
FT   CDS_pept        478185..480206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39421"
FT                   /db_xref="GOA:Q1IUM9"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM9"
FT                   /protein_id="ABF39421.1"
FT                   /translation="MRAQSCCIAHALDIQSPPSHRLQVPTLVSISRCEETAMRKLAGIT
FT                   VVLTVVFAAWSALAATPATMVTPVAGSKFAGANVTFTWNAGAGVSQYSLYIGTTPGAHD
FT                   LAFVSTGVSTTTTVNGLPTDGRNIYVTLYSLIAGVWQGNRYSYFASGAGVAATMTAPAA
FT                   GSKLAGASVTFSWNTGAGISQYSLYVGNTKGAHDIAFSSGNVTSKLVNGLPTDGRMVYV
FT                   TLYSLNGSTWLRNYYTYVASGVGVGAVMSSPAPGSTFANSAANFSWTNGTGVSEYSLYV
FT                   GSTPGAHDIAYVNAGSIPLATVTNLPTNGSTVYINLYSLNGATWLRNSYTYTAAAAPSK
FT                   RVAWIPDFYGETLQVRIGTGAGAIATSVNLPTCNPNSVAVNSDKAYVVCSAFEANPDKI
FT                   LVYDATVIRASAGGVLAISPTKTITSAQFNSLIGIAFDAGNNLWVASYGNHQINEITAA
FT                   ELAKASPTATAELVHSPDNPVTLTFDSSGGMWVSGQYSGGIVLHFPSSQIHSGSGATPD
FT                   YCLATTDLGAGCQFVDGIFLNPEGLALYNGDVWVANNATGAAGEVPGRQLVDLKFNAGN
FT                   VTVNGTFGDPTAAAKSPFVCPGGLFAGAIHLWINDESYAEADPQCGAMGDVSAATGGVF
FT                   AFTPAQLAARSTSTSQVLPYSGVTGRPGFGGIFVEKDQ"
FT   gene            complement(480503..484006)
FT                   /locus_tag="Acid345_0417"
FT   CDS_pept        complement(480503..484006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0417"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39422"
FT                   /db_xref="GOA:Q1IUM8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM8"
FT                   /protein_id="ABF39422.1"
FT                   /translation="MNSCSRVVALLLLCFAVVGFAFGQADTGQVTGVATDPSGAIVAGA
FT                   KVTITDVNTGATRTSTTTQSGTFAFTNLKPSAYDVVVEAEKFARFTRRLDVSVGSRNDL
FT                   QAQLAVTSAGTTVDVTAETEAAQVNTESQTLSNVVTAKQIAELPTLTRNAYDLVATAGN
FT                   VVEDTTDFVRGTGFSINGQRSASTDILLDGGENVDLYDAAVGQNVPLDSVQEFRIVTSD
FT                   FTAEYGRAGGGVVNVATKSGTNAFHGTAYDFNRVSALAANSWENDANGIDKGHFTRNQF
FT                   GYSIGGPVVKNKLFFFSSTEWTRVRSTNNNIATIIDPAFLAAPEVSDNTKAFFQAYGAR
FT                   KDNLDVLDVQTWAQTPHTTSTGPADSTPTLDKVSYQIAGNSGGGAPQNSYSTVNRVDWN
FT                   ATDKTTIFGRYALESQDYFPGYISFSPYSGYDTPDLLFRNNVLINMTHVFSPNFVSQSK
FT                   IAYNRLNESQPFSTAPVGPTLYSNYFGLPTINGGLLLFPGYSPSTPGNSIPYGGPQNLY
FT                   QLYQDLSWTKGKHQLRFGGQYIHTRDNRTFGAYEGAAAYLNNAFDVGDAFDQLVAGNTK
FT                   RYQVAVDPQGKFPCPYTTDGAYQELDSCKVSLPVSSPSFTRHNHYNDGAWYAQDTWKFT
FT                   PRLTLNLGLRWEYYGVQHNVDTSPESNFYLGQGSGILEQIRNGSVQLAGQGPTSGLWAP
FT                   DRNNFAPRVGFAWDVFGDGKTAIRGGYGISYERNFGNVTFNVIQNPPGQYVMIQAAPIS
FT                   VDNFGPLAPGSGANPYLRPGSLRAVNQNIPTAYTESWSFAVERQVIKNSVLAFEYSGAH
FT                   GVHLYDIANISGAGMGYAFFGDPDSVRLTGTNLQYSAINYRSANGFNTYGGLNTRFTTD
FT                   NLFNLGLQLNFNWTWSHSLDNLSNTFSEAGNGPFQLGYVHPFDPVLDKGNSEYDARHRF
FT                   VVSAVWQVPWGKKVNNSVLRQVVDGWSLSPLFSYHTGYSYSIFDGTNAFNNDGRWIPGA
FT                   ATSRDGSANRNSYVGGGVFNYMGLPWDPNNMTLVNLGQTTAPGAVAGTGVSWGDLPINP
FT                   ATGLSSCPTVGSLVGCSYGPNTDRNQFVGPGNHQFNAVIGKTFRLSERFSMQFRGEFYN
FT                   VFNNHNYYLLTTNADVFGMSVAANGDSSLSAGRNIQAVKGGYGNALDETRNIQLGLKLI
FT                   F"
FT   sig_peptide     complement(483935..484006)
FT                   /locus_tag="Acid345_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.622 at
FT                   residue 24"
FT   gene            complement(484250..486673)
FT                   /locus_tag="Acid345_0418"
FT   CDS_pept        complement(484250..486673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0418"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39423"
FT                   /db_xref="GOA:Q1IUM7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM7"
FT                   /protein_id="ABF39423.1"
FT                   /translation="MLAQEIRHGVRILQRSPGFAFATVLTLSICIGVNIAMFWIVDGVL
FT                   LRPLPYRESDRLVNITTGSPERQITGIPTSWTKFQRMQQESKLLESVGAYFPTTLSIST
FT                   NGVPEELPAAHATASLFQALDVTPAMGRSFLPQEEREGGAQVAIISDHFWRTRFNASSD
FT                   ILGKTISLDGRSVEVIGVLPRRFQFPFVQPAPEVWVPRVFEYPTVAPARVRSGAAFLSV
FT                   HGRLKSGATIKQLQSELSTLARAYEADNPGFADGRGFTLEVVALKESVVGQIRSTLLTL
FT                   LIAVGFLWLVGCSNIAGLLVARATTRRKEIAIRQAIGASRSRIATQLVAESLVLSYLAG
FT                   IFGVVIALACGKGLRMLPPGTLPRVEELGLDPTVVLFAILLSTFATVVIGIIPAVQIYR
FT                   PDIYTPLKEGGRTANTGQKGSRSRLVLVVGEVAAAMVLLAGAGMLIKSFANLARVHPGF
FT                   DPQNVMTFTINLPTSHYNTPEKQREFYRALLEEARAIPGVDAAGVISALPIGGFGFSVY
FT                   VCPEGTVCQGIGKDPVIAYRMVSPAYVKTLRIPLLAGRDFTDHDNLNGSLVTIINQSTA
FT                   KKYFPNVDPIGRHLVPSRERIPLEIVGVIGDVRANGLGAPVSEEFYVPAAQASAATMTL
FT                   VLRSHTNLSAFAPPVRRIMAKLDPDVPFANVATMNQVISDSVTQSRLTAILTGAFASIA
FT                   LFLTSVGIYGVIAYWVAERSYEIGLRLAVGAMRKDILTLVLKQGMSLVAIGLVIGLAGS
FT                   LLLSRFLKEILFGIGTFDPRTLIETVVILSAVAVLAVLIPARRALSVDPIIVLR"
FT   gene            complement(486780..487964)
FT                   /locus_tag="Acid345_0419"
FT   CDS_pept        complement(486780..487964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0419"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39424"
FT                   /db_xref="GOA:Q1IUM6"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM6"
FT                   /protein_id="ABF39424.1"
FT                   /translation="MSLSLITSEEVHAASASKEKTNWSLVWGVNAISWLVLSFLEVITV
FT                   YPMRISQGRPLPFWMMFKDVFLHNLLGMVLTPGIYYLALKFPFSPRRILKPTMVHLSGS
FT                   IFFAFANTAQHYLMFPLHVSPDSYEKFTWMLFYGFMSYAWFLDTSTTYIPVLAIAYMCS
FT                   YYQKYRENEMQKLRLDAQLAQAQLQFLRSQLNPHFLFNTLHSITSLMHFDIDAADKMMA
FT                   QLSDLLRMALQQADVNETELKYELDFVDRYLAIEKTRLGDRLRISRSVSEEAKQALVPP
FT                   LILQPLVENAVIHGVSQQVEGGELFLRAIVFSGTLRLTVRNKGSLRTPSFRPPGHSGVG
FT                   IRNIRERLNQMYGGDHSFVIEEDGKGGVEVAIILPLRTAAVSPNLTIDQVHAAL"
FT   gene            complement(487964..488917)
FT                   /locus_tag="Acid345_0420"
FT   CDS_pept        complement(487964..488917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0420"
FT                   /product="transcriptional regulator, LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39425"
FT                   /db_xref="GOA:Q1IUM5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM5"
FT                   /protein_id="ABF39425.1"
FT                   /translation="MQQKIALRAASASQPATSVPDSSPLVPHSSAPDLLRVFAGIRFEQ
FT                   LGRERVEVATNPVVDLELRAVIVEDEPLATMKLKKLLDGEPGIRVMGHAANIDEAVAQI
FT                   RKLQPNVIFLDVQLPGGSGFEVLDRLPEANRPCIIFTTAYDQYAIKAFDLHAADYLLKP
FT                   FDQERLHRAIEKARVQAAGPVDKEWTQRLAKLIETLPKNGRNPEERLVFKSGGRVLFLE
FT                   QDEIEWIEAASNYVHIHCGGNVVHSVRNTIRDVETRLNPLKFIRVHRSIIVNVNRIKEL
FT                   QPCNSGEHVVVMKSGKELSCSRTYRMAIASITRERL"
FT   gene            489050..489850
FT                   /locus_tag="Acid345_0421"
FT   CDS_pept        489050..489850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0421"
FT                   /product="transcriptional regulator, LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39426"
FT                   /db_xref="GOA:Q1IUM4"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM4"
FT                   /protein_id="ABF39426.1"
FT                   /translation="MATSFETAGIMERQQNLRGIRVVLACSELLNCAALRQALDQQLDV
FT                   CVVGNATDWPTLVYQMNEFVPELVLAGNDLVSRALMEFGGPFPLFVRLGDSNPIDSSRV
FT                   IATLPMSASPEQIFETVQQMKVAVLEAKWMDVMQMLQACRPDVVARRYSDLIEMTGKDS
FT                   VTRVHAEDIRCITAAKNYVRLETTSGEFQTRAPISEIGARLDPAKFIRIHRSVIVNKRE
FT                   IASVLRREGNCVAVTLRNGKRFRIGSTYRHATTQLFDGSTEIAS"
FT   gene            complement(489859..490581)
FT                   /locus_tag="Acid345_0422"
FT   CDS_pept        complement(489859..490581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0422"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39427"
FT                   /db_xref="GOA:Q1IUM3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM3"
FT                   /protein_id="ABF39427.1"
FT                   /translation="MRRGRQSEIPAYQKIEGALLASMEAGELQPGDALPSERDLAKRYG
FT                   VSLMTARHAVLALQNAGRVHRRPRAGTYVAPPRIQFNRLSGLTEQLSEHGVRMRSKVLT
FT                   FEFCENEPHVNAQLVLPTDARVVKIQRLRIGGEEPFAIETCYVSAEAFPELRREHAEKK
FT                   SLFATVAEQYGHPLNYADEEIDATTASARQAVLLGIRRDAPLLRIRQLIHASDGLPIIY
FT                   GLGFYRPELHTVYVRRVR"
FT   gene            490961..494449
FT                   /locus_tag="Acid345_0423"
FT   CDS_pept        490961..494449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39428"
FT                   /db_xref="GOA:Q1IUM2"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM2"
FT                   /protein_id="ABF39428.1"
FT                   /translation="MSWLNKVRLVGCLLFLSLLAANYLEAQQVTAAITGTVTDPAGAAI
FT                   NGATVTARDVERGTVTTVKTNDSGVFNFPRVAIGTYEVRTEASGFEIAVQPPFTLVLNQ
FT                   TARLTFQMKIGKTTETMEVSAEAPQLQTDTTQVSTLIDAKTNDSLPLATRNFIQLTLLS
FT                   PGALSVDPQSMNTGSNVAEEGGRPYINGNREQANNFLLDGIDNNQSSENLAGFTPSPDA
FT                   IAEFNVITQNAPAEFGNFNGGIVSATIKSGTNSFHGNVFEFFRNDIFNANKWENGLHKG
FT                   DPAYFNADGFDSNGVAFTPKVRWNMFGVTFGGPIIKNKLFFFVDYQGGRLDHPSTAGTF
FT                   GVLTPAQIGGDFSSLLSLSTPVQLYNPCAAGTGVSGNPCQLVPVASRQPFAGNIIPSNM
FT                   LDPTFAALTTNSLYPKSIASDPTSGFGLASNITGQQYNTDQGDLRLDYNLSQKDHLFAR
FT                   MSKGYQTDPSTNSILLLGDTLNQAWLNNFAFNWDHNFSPSLLNEVRFGLNWVKFTNGAH
FT                   TFDSSVGQLGNTIGIENGNPGGIDGLPAMSFGGGGITNPGVGSIPTIGSANVVENFAST
FT                   VTQFDDVLEYTHGRHVIKGGFQMNNYRINVFYSGNGGELGQLLYGTTYSSSLDAGGTPV
FT                   GGNGVADWALGLPELVGRGTSTGGWHQRDWLYAGFIQDDWRITDSLTLNLGLRYEARTP
FT                   WTELNDRQVNVNVASGALEYAGNTPVVGVGSNGFSEGLYDSSYGLSAFQPRFGFAYSPR
FT                   SMDGKFVVRGAFSISSYLEGTGTNLRLTQNPPFTPAQVEANNATTGMPYTSATGFTTAA
FT                   PPGGDPFQNATMLAWSGTVQPAVAKQWNLTVQQELAKNLTLQLGYVGQATQHLMVPEWL
FT                   VQGVLNGDGSVTPSAFAGGTNADGTLGPNHFGNVKDTASNGSMNYNALQAVLQQRFNHG
FT                   LDYQISYTYSKCMTNNDGYYGTWGANTETTPAANYWQNLYDPQADYAQCYWDAKHVISA
FT                   YATYELPFGKGKQFGGNMNPVLNAVVGNWQIAPIVSWHTGFPIALYGPDNSGTNSPAAR
FT                   PDCNGPVQYIQHTVDGGYQWVSPSAFSAAQPGTFGNCPAQGPVVGPHYTDADISMQKNF
FT                   PITERYRLQFRADFLNAFNHPNFAHPDNTVGDTTFGLITGTQDARQIQFALKFYF"
FT   sig_peptide     490961..491041
FT                   /locus_tag="Acid345_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.969 at
FT                   residue 27"
FT   gene            494523..495464
FT                   /locus_tag="Acid345_0424"
FT   CDS_pept        494523..495464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0424"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39429"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM1"
FT                   /protein_id="ABF39429.1"
FT                   /translation="MRTLIGFCCLLISGVNVHAQAASNSPANSPASPKAALRLAQEGHC
FT                   KEALPALKKGLASAAKDDHRDLAMAGVRCAMFMNQPESALEFLRVLEREFPSDPDTLYL
FT                   LVHTYSDLSTHAAAELATKHGNTYQARELNAEALESQGKWQEAEKEYKTILEANPKAVG
FT                   IHFRLGRLLLSAPNPPADMAEQAKREFEAELAVDPTNAGAEYVLGELAKTANSYDDAIQ
FT                   HFSKATKLDPSFAAAYLGIGTSLVAQKKFAEAVTPLETAVKLQPANPAGHYNLATAYSR
FT                   TGRKADADREFAIHNEMMQRSGGASAPVQQPQ"
FT   sig_peptide     494523..494582
FT                   /locus_tag="Acid345_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.687 at
FT                   residue 20"
FT   gene            495477..497186
FT                   /locus_tag="Acid345_0425"
FT   CDS_pept        495477..497186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39430"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUM0"
FT                   /protein_id="ABF39430.1"
FT                   /translation="MRKVSRRDFLCSSATLAAYAGLGRYAFAAPTTTYPFEEISPEKSG
FT                   ILWKHVAGHSSAKYLPETTGAGCAFLDYDNDGWMDIYLVNSGKSDFYTPAQPIRNALYR
FT                   NNRDGTFTDVTEKAGVAGGGYGQGVAVGDYDGDGYPDLYVTQYGRSILYHNNGDGTFAD
FT                   VTEKAGVAAPGWASSAVWFDYDNDGRLDLFVCRFVDFSKDKNLPCEAEGKPGYCVPRLY
FT                   KPMASYLFHNNGDGTFTDVSKSSGIGNFLGKAWGAVATDINNDGKLDLFVANDTVANFL
FT                   FANRGNGKFEEIGTMAGVAYSDAGRPRSGMGVDSADFDQDGWMDLFVANIDHERFSLYK
FT                   NNKDETFDDAAEKTGIAMATRLMSGWGLKFFDYDNDGNLDLILCNGNPDDLIQVYHHDV
FT                   SYEEPLLLFHNEGNTLRDVSAESGPIFSKKMSARGLALGDFDNNGAVDVLISMNDGAPL
FT                   LLRNAVGDKNAWVGIHLKGKKANPDAIGARVTYKADDLTRTRMIVGGGSFLSAQDPRLV
FT                   LGLGARKKIDWVEVRWPAPSGLVERFTDLPLGRYTTIVEGSGKQAPPSQPAR"
FT   sig_peptide     495477..495563
FT                   /locus_tag="Acid345_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(497199..499040)
FT                   /locus_tag="Acid345_0426"
FT   CDS_pept        complement(497199..499040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0426"
FT                   /product="beta-glucosidase family 9"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39431"
FT                   /db_xref="GOA:Q1IUL9"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL9"
FT                   /protein_id="ABF39431.1"
FT                   /translation="MLHAAKMSSVLLLLCASAFCANDLKVLTDHVGYETTGAKHAVVLG
FT                   KAGDRVSECSIKNSTDDRVVAPIKAVAVGPVKKWRDWYFWTLDFDSLTQEGHYYIECAS
FT                   SRGAVRSFPFAVQANLLEQGTLSDVLYYFKDERSSGPMDKADSHLPFDPPKQGTLDAHG
FT                   GWWDATGDYGKHLSHLSFSTYFNPQQIPLVVYSLLKSYGQLTRRGLPEVTRYKDRILDE
FT                   AMFGADYLVRVKDPSGSFYRSISTGGVKQVPEERKVAGEMKKFAIYQSNDKRPDMIEKA
FT                   NNDLEYEVSYRSGGGIAIAALAMASTAPISGEYKNADYLKAAEDAFAYLEKNNLKMVND
FT                   GKENIVDDYCALTAATELFRATKKPIYKEAADRRASSLVSRLASDGQHQNYWRADDHDR
FT                   PFFHASDAGLPVVSLLYYAEVTDAQTRTKVLETVKKSLAFELATTREVPNPFGYAREFV
FT                   QDKTGARRTSFFFPHNSDAAPWWQGENARLASLSSAARLAALQFTDDPEFAKQLNSYAL
FT                   NQLNWIVGLNPFDSSMLNGVGHNNPQYLFFDSWEFTNAPGGISNGITSGFRDEDDIDFN
FT                   LTYKQTGADNDWRWQEQWLPHASWYLLAVSTGNTSPR"
FT   sig_peptide     complement(498972..499040)
FT                   /locus_tag="Acid345_0426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.782) with cleavage site probability 0.408 at
FT                   residue 23"
FT   gene            complement(499063..501198)
FT                   /locus_tag="Acid345_0427"
FT   CDS_pept        complement(499063..501198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0427"
FT                   /product="Cellulase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39432"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL8"
FT                   /protein_id="ABF39432.1"
FT                   /translation="MKCIRKQCLFVSLIAICSSVIGLGQTIRVDISHPTNSFVPNESLG
FT                   AGIDRIGAAAAAKYFSEPPSKAVLDAGWQPVTYRQNTELAVEAWHWNPQGTWSDPSGKG
FT                   YFTGSAEPGPEIIKHSYGYVLPHRGFTRNDGTDTSGFGRMTDGDLNTYWKSNPYLTKHF
FT                   TGQEDSEHPQWIVIDLATTQSINALRIAWAEPYAKQYLIQYWTGDDAIKLPSKGSWVAF
FT                   PAGVVSAGKGGTVTHQLSNSPMPVRFLRVWMTEPSNTCDTHGSADIRNCVGYAIREVFI
FT                   GTTDRNGFHDVARHTPDQDQTTTYCSSIDPWHEPSDLGSTQHEHVGMDLFYRSGYTRGL
FT                   PAMIPTALLYGTPEDSAAEIAYVEKRGYPISYVELGEEPDGQYTLPEDDAELYLQWARA
FT                   IHKVDPKLKLGGPVFTGQNEDILSWPDAQGQTSWTRRFLNYLRARGGLRELAFFSFEHY
FT                   PFEPCKVNWSSLYDEPQLMTHIMQVWRDDGLPADVPMFVTESNITWNSGESSVDIFGAL
FT                   WLADYVGSFFTAGGKGLYYFHYLPLGVHPGCNQSGGTFGMFTTKGNFEVDKPTSQFFSS
FT                   QLINTEWVQPGDGVHETYAATGDLMDAAGHALITAYAVKRPDGQWSLLVVNRDQENAHK
FT                   VTIDFSDSGRGKTGFAGPVQLLTFGSTQYKWNPTREGGFPDPDGPVAKSSINASADTVY
FT                   ELPKASMTVIRGSLSHQ"
FT   sig_peptide     complement(501130..501198)
FT                   /locus_tag="Acid345_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.981) with cleavage site probability 0.611 at
FT                   residue 23"
FT   gene            complement(501264..504854)
FT                   /locus_tag="Acid345_0428"
FT   CDS_pept        complement(501264..504854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39433"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL7"
FT                   /protein_id="ABF39433.1"
FT                   /translation="MRRANWFAASLLSTLLLMTSMLWASITGSISGVITDSSGAVVAGA
FT                   NVTATDTQTGTHTTVVTDSKGFYNFPSLAVGNYTVEISRPGFKQYRTTDLVVNANSALR
FT                   LDAALVVGAASEKVEVTSEAVHVETQSTQMGEVITGKTMTAVPLNGRAFTDLLALQPGV
FT                   SPYNSSDTGMAGVNDRPVDGGLNSGNQSVNGQREASNGFMVNGSNVEEGKTNGAAIIPN
FT                   LDSISEFRIITNNYDAEYGNYSGGQINVVTKSGTNALHGTVFDFLRNTSLDAKNYFAAH
FT                   SDPTPVFRQNQFGGTIGGAIKKNSTFFFVDYQGTRQTLAPTVTAQVPTVDNLGGNFSDS
FT                   ADSFSGVVNGPYFANLLSQRLGYNVNDQEPYYTAGCTNATQCVFPNADVPKAAWSPVAT
FT                   AMVGMGLIPQPNVSTQNFNYETSQYAQTLRDDKGGVRIDQNWRFGQLFGYYFADDYLLD
FT                   SPFPSGGASVPAQGFPYSATTSGRAQLVNIGDTKSFGATAVNEFRFSYVRNTLSLTTPT
FT                   SGIGSNFSLANLGFVTPWGAASGGISPIAPGLEGVPYITFNSFGIGVPQVSTRQYNNSF
FT                   QWLDNFSKVIGTHSLKFGGQFHYDQINERNLAAENGQYGFSGSETGIDFADFLIGAPDS
FT                   LTQASPQILDSRSKYYALFAQDSWRVTPNLVFNYGLRWEASMPWYDTQNKTETIIPGKQ
FT                   SVKFPGAPPGYVVAGDPGVPRTLAPTQWANFSPRLGLAYSPSATSGFWAKVFGGPGRTS
FT                   IRIGGGLYYTSVEDLSQFLEVGDPPYGLYYGSANPPLLEAPYLARYSGDSVGQRFPFPY
FT                   PPTNVSPSNPDSTFPWAQVEPLSYDWSFNSHNKLPYSEHYELSLQRQIGADTVVTASYV
FT                   GNQAHRLVAAVESNPTNQAACLFLSDSANLGPNSAGPCGPFSETPPFTVTVVGGESIGT
FT                   TTPWVTSTGKVVNSVRPLGPLFDTNPWVSTIANSNYNSLQMSANYESSSLSFLAAYTFS
FT                   KCMDNASGLQDSVYPYDPRVSRALCNFDVTHNFVISYNWLLPFDKYASKRWERALIGGW
FT                   ALSGITSFATGLPVSLSENDDNSLIGANAAPVDVPNCSYSGAVLGDTDPRSGKPYFNTA
FT                   LFSPEQLGQFGNCRRRYFHGPGINNFNMALLKTVVFTESKQLQLRFEAFNVFNHAQFTN
FT                   PSGEINSDTFGLVTNARDPRIMQVGAKFIF"
FT   sig_peptide     complement(504780..504854)
FT                   /locus_tag="Acid345_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            505028..506380
FT                   /locus_tag="Acid345_0429"
FT   CDS_pept        505028..506380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39434"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL6"
FT                   /protein_id="ABF39434.1"
FT                   /translation="MRLTHSFVLFALAGALSGAMCRAESPRKCRVEPVRFGGWNAQQVS
FT                   NDWVALTIVPQLGGRLMQVAFHGHNYLFVNPKLEGKYFPPTPSKWFNYGGDKIWPLPEG
FT                   SGDDQHWPGPIADVLDDGEYAFTVLSRGETCKVRLEGQSDPKTGLQYSRDISLQSDSPG
FT                   IHFDATMKNASQRTIRWSMQSVSQYDLASEENPLKLNPKFFAFTAANPKTAYEDGYRLR
FT                   LGQAEDTAVGVKNGLFTLHYNSFQREIWVDSTDGWLALVDGSSKFAMVEKFPHENEEYP
FT                   GKATVIFYTNGPAVEFNADGVPHLTASDPANMPFYMEAEVNSPMISLQPGETYTLRTSW
FT                   FPTRSGETLQSVAPAGVVNEPLRAQWESNGLRLSGLFGVFQSGELTAYFYDDKDGEAGL
FT                   AGVQRVSPAELVQLQSIVTPPHGSTRVVLHVMSNLVDRGVLAETSFEPRGN"
FT   sig_peptide     505028..505099
FT                   /locus_tag="Acid345_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            506382..508517
FT                   /locus_tag="Acid345_0430"
FT   CDS_pept        506382..508517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0430"
FT                   /product="Galactose-binding superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39435"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL5"
FT                   /protein_id="ABF39435.1"
FT                   /translation="MISRFASISCAMFLAAASLGAQTIVVDADPAHVVNRFRPQYALGT
FT                   TVDRVPSNATDTFFRPDQVQQVLSAGWGVVSYRQNTELFIQAWHWNPKGKWSDPSGKGY
FT                   FVGDATPTSEPIRHSFGYSLQHRGFTRNGGSEFDGFSRLDDGDIKTYWKSNPYLTQTFT
FT                   GEPDSAHAQWIVIDLEKPQDINAIRIAWAEPYAREYNVQYWEGSGDAMDEQDKGTWKNF
FT                   SSGAVANGEGGTPTIKLSTSTVQARYVRVLMTGSSNTCDTHGSSDKRNCVGYAIREVYL
FT                   GTVDQSGDFHDLLKHTPGQQQTLTYCSSVDPWHEPSDLYVAPDRMESGDQPGFDLFFTS
FT                   GITRGLPAIVPIALIYGTPEDSAAQMAYLKARKYPISYIEMGEEADGQYMQPEDNAALY
FT                   IQWATAIHKVDPTFKLGGPSFQGVTEDIKAWADPKGRTSWFARFLDYLKTHGHLDDFAF
FT                   MSFEHYPYDGCETPWENLYQEPELIMHVMDVWRADGLPPNIPLLDTETNDHGGEAAVDI
FT                   FGALWLGDSFAGFLTAGGQSTHYYHALSYSPPHPACPNSWGTYHMFMVDKNYVIQRKTS
FT                   QYFGAKMLTQEWVQPGDAEHQLFRATSDIKDAAGHTLVTAYPLLRPDGKWSILLINKDR
FT                   DHPHEVQITFRNSGAGGLRGAVEMVTFGKAQYQWHPDRKNGYADPDGPPVTSKLTAGEQ
FT                   TRYTLPPASINVLREVH"
FT   sig_peptide     506382..506447
FT                   /locus_tag="Acid345_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.443 at
FT                   residue 22"
FT   gene            508642..510033
FT                   /locus_tag="Acid345_0431"
FT   CDS_pept        508642..510033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL4"
FT                   /protein_id="ABF39436.1"
FT                   /translation="MENVTNASPGQIVIIPPAEKLDAHRKALTLNLDTTAFGSFAEIGA
FT                   GQEVARWFLIVGGASGTVAKTISAYDKQVSDDLYGAGSRYVSRERLEAMLENEWAQLLT
FT                   QLQSTRGSNTRFFSFVDTVSARNHAGTNDPHGWVGLRFQSAPGGPFNDILLHINMRDPS
FT                   NVLQQEVIGVLGVNLIFAAFYQLTAQESFFGGVTQDLPKERVEIDFVDFRGPAFEGWNR
FT                   HEVQVYLVHAGFAEAVFFSSKGTCSPPTEALYKKAVVLAPGTFVHLDPIHSEIHLHLLA
FT                   AGVQELGRELGQSSAAPMGFFALSAAPLSPEGPAPDVSDLLRRIDGLLAQGGDVLLFRE
FT                   RELYAMTTLVNRYTKAPMRFVVGLSLSIRAFTDPYYHLQGSLLEALSRLFVQNVRIYAY
FT                   PMRASELQEAIKDFAPAGLKWDETDGWVTADQLRFASPLCHLHAYLLASNFLVPMKVDP
FT                   ESAST"
FT   gene            complement(510373..511593)
FT                   /locus_tag="Acid345_0432"
FT   CDS_pept        complement(510373..511593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL3"
FT                   /protein_id="ABF39437.1"
FT                   /translation="MKRALAQFALLFVLCAISFAQETEALRQTFHAPKGDIEQALKDLS
FT                   AYQPGRLPFVEGFVGSIDAPLKGFQRPSYQYAINLQQASESEVTVSVNAKISAWYEDKD
FT                   ATKSGYRELPSNGRLETDLFDRLRARLSQHAADIAASRTPLVSPKLMGTAPMVVDAGPS
FT                   VTPAPTLSSAPPSFRAYAAPAGPLVPPEQNPRYQRLVQEEKSLNEVIAAQQHPSDLVAV
FT                   KAPHTPIVATPTDAARVVMYADAEDEFQYLKTEGEWTHVQISGLNRGWIRSAQVEQIGT
FT                   KAAQTAASTAGEEFRLTKEETSTFPGDWAPLRGKNVKIIWVQPNGKSTQKARLSYAESV
FT                   FKKQANATGVDGVVVVFDAAEGGMAAATTPMLRQWIAGTLTDPSFLAQCWFDPADAFAR
FT                   PASSSSK"
FT   sig_peptide     complement(511531..511593)
FT                   /locus_tag="Acid345_0432"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.983 at
FT                   residue 21"
FT   gene            complement(511590..512489)
FT                   /locus_tag="Acid345_0433"
FT   CDS_pept        complement(511590..512489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39438"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL2"
FT                   /protein_id="ABF39438.1"
FT                   /translation="MPLSHLPVYRSLHVRRVTHIVLAMFVLSCFTAPHLVAGTRKDIHE
FT                   SPNALQVLVNAPLKDVIDAVQQVSGDTVIYGTQSYQREKNLMGARRAESSKAFGDAAPA
FT                   GTVIYKIAEGVLAPTNFKNTADMGTITVRYVVSRFDEKNTNVRIDAVFIENSSKHVHES
FT                   DGSVEAAEFGEIRQRVEQIMARHETDRMEAERIARERNEKQAELDLAARQEAAKAAAAA
FT                   PIDLEQRVVQLRRKAELRVKASGTQLKSAPYKGAASLQSLSPYTDVVVLIVTPFWYGVQ
FT                   TADGHRGWVYHAEVENLP"
FT   sig_peptide     complement(512376..512489)
FT                   /locus_tag="Acid345_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.638) with cleavage site probability 0.603 at
FT                   residue 38"
FT   gene            512966..514345
FT                   /locus_tag="Acid345_0434"
FT   CDS_pept        512966..514345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39439"
FT                   /db_xref="GOA:Q1IUL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL1"
FT                   /protein_id="ABF39439.1"
FT                   /translation="MRIDVIGRFQRLRSAIASYLAMGMLLGIFLAASSQSSFAIAAFAR
FT                   KYGLPCSACHDAWPKLNNFGQTFKDNGYQLMNDRDAPIWQNPSYWPVAFRITPNWDLEN
FT                   TGRVATDQAPNGQSVTTHGFNLSGLDILTAGTLNKDISFLLVPSADETGAFHFESAWVR
FT                   FDNLFHSSWANLKVGKFELDNLISEKRGLTLSANGGSYQLYHFLPFGDSNPYQFGIGDN
FT                   QMGIEFAGHSKNDYTRFSASLLSSNDGNVDVPYGSTYDGSFTFSTAFNAGSLGLQRIGA
FT                   QAYIGQAPTYYLTSGGGDIPGTGKGNHGFSREAVFALLYFGKFDVTPLFGHGSESAYLA
FT                   NYVSTGGMPPVLPAGSRDPSWNNFMVESHYLFNPQFIMTYRYDAIYMTQQASTAYPDDA
FT                   GNTTANTIAARYYPFMHSRAGFALHGEFSHLNQKHVFSTTTGTLQDVSYYSVFGGMDFI
FT                   F"
FT   sig_peptide     512966..513085
FT                   /locus_tag="Acid345_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.601 at
FT                   residue 40"
FT   gene            514358..515302
FT                   /locus_tag="Acid345_0435"
FT   CDS_pept        514358..515302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39440"
FT                   /db_xref="GOA:Q1IUL0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUL0"
FT                   /protein_id="ABF39440.1"
FT                   /translation="MNAITKTLVSMSFSLAIAIAVPALAQEPPGSGMPQPIPQTPATHD
FT                   FTSHIGKVTGHADHGKQDYRRWCVGCHGPYGDGNGENAPWIDPKPRDFTAATFKCRSTP
FT                   TGTLPTDDDLFNAITRGFNTSNMPQWRPLTPQTRADLIAYVKTFSPRWKSEKPGTPITI
FT                   TPETPVTIDSIARGKALFVKLECWKCHGPLGRSDGPSAATLTDSKDQPIKPYNFSTGGR
FT                   LKCGEANADIYRDFMTGLDGTPMPSFADNVKPEEAWDLVHFLRTLQTTRPSKENEVLKA
FT                   AGGKIPDVPPPAAPAQENNQAPQQEQKSPSSGK"
FT   sig_peptide     514358..514435
FT                   /locus_tag="Acid345_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            515331..516044
FT                   /locus_tag="Acid345_0436"
FT   CDS_pept        515331..516044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39441"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK9"
FT                   /protein_id="ABF39441.1"
FT                   /translation="MRTKQVCTAAALALLIAPASVWAGTISGKVTVDGPVPKQKVIDMS
FT                   KEPACAKDYPASDPPKTETATVGAGNSLSDVVVYISAGANDEGTVPPQAVTLDQHGCRY
FT                   IKHVTALHVNQDMKVTNSDPTSHNIHPLAKTNREWNKSQPPGSPALDAKFDQAEFIPVK
FT                   CNIHPWMHGYIVVLKTNHFGVTGADGGFSLKDLPPGKYTVTAWQETLGSSQQDVTIGGA
FT                   NETKTINFVFKGKAY"
FT   sig_peptide     515331..515402
FT                   /locus_tag="Acid345_0436"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            516124..516927
FT                   /locus_tag="Acid345_0437"
FT   CDS_pept        516124..516927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0437"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39442"
FT                   /db_xref="GOA:Q1IUK8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK8"
FT                   /protein_id="ABF39442.1"
FT                   /translation="MGKLFAVVLVLIAIGSAIPIVMHWYPMAQDISTHGHLIDDQMGET
FT                   MAEAGIAFLAAQFVLAFFVFRYSDRKDPGKIRTFPGGARTMVVAAVLLVGSEVLALGIF
FT                   GQRAWAGQYFTPPGADAMTIQTQAGQFAFYFRYPGADGKLGQQHPDKIDEGNQNFFGLD
FT                   PANDVESRDDVVTAELGIPANREIRLLMHSKDVGHSFYVRELRVQQDFVPGLDLMVHFT
FT                   ATKPGRYEIVCTQLCGLGHYNMKAYLNVMTQEDFDAWMKQKTSEQ"
FT   sig_peptide     516124..516210
FT                   /locus_tag="Acid345_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.654) with cleavage site probability 0.627 at
FT                   residue 29"
FT   gene            516991..518778
FT                   /locus_tag="Acid345_0438"
FT   CDS_pept        516991..518778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0438"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39443"
FT                   /db_xref="GOA:Q1IUK7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK7"
FT                   /protein_id="ABF39443.1"
FT                   /translation="MSGLGSAEASHQHVAPTGFIRKYVFSLDHKVIGLQYYGLAVVAVF
FT                   IGMVLSWLMRIHLVWPNSPIPGLHLLSKNGAPGDVMTPEYYLSLLTMHGTLMVFFVLTN
FT                   APFAAFGNYFLPIQIGAEDMAFPRFNMMSFWTTFAAFCVLIAAFFIPDGPPISGWTAYA
FT                   TLSAVGGDAGPGMAYGQTLWGISIAIFCIASLLGSLNFIATTLDLRTKGMSLMRMPICT
FT                   WAWFITSCIALLAFAVLLPACILLCLDRVAGTSFFIPSGLVFNDHVIPHGGGSALLWQH
FT                   LFWFFGHPEVYIAILPAMGIVSHILINSMRRPLLSHRVVIGSMISIGFLSYVVWGHHMF
FT                   VSGMNPLSSLVFSFPTLIITIPATVLTLIWLGSLYGSRLRINSASLFALGFISMFVSGG
FT                   VSGFFLAQPSIDIYLHATYFVVGHFHLVMGVAAIFGVFAGTYFWFPKMTGHMMNETLGK
FT                   IHFWGTFIGAYCIFMPFHYLGMVGNVRRYSSFVDDFLQPYLPLHKFITFAALTTGAFQI
FT                   LFLLNLLYSRFKGPKAPVNPWECTSLEWTVPSPPPFDNFGGVHPVVYHDPYQYGIEGST
FT                   GDYVMQSSPETIAVERDEK"
FT   gene            518789..519478
FT                   /locus_tag="Acid345_0439"
FT   CDS_pept        518789..519478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0439"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39444"
FT                   /db_xref="GOA:Q1IUK6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK6"
FT                   /protein_id="ABF39444.1"
FT                   /translation="MSALNEPLNLAQAVEVERQERRKTSGGSTVPPSSTSGRLPSIADP
FT                   AGESVRTGVWVGLATIAMMFAAFTSAVVVRKGASNDWTHIVLPNILLLNSAVLVASSIT
FT                   LEIARKKVKAYAKGTAPSQSVPLAWLGSTLALGLIFVVGQFVAWSQLKAQGVYLATSPN
FT                   ASFFYVLTVIHAIHVAGGLGGLTRVILKTSGSVFTLRRSTLDGTAYYWHFMGALWIYVV
FT                   SLLYLKF"
FT   gene            519504..520130
FT                   /locus_tag="Acid345_0440"
FT   CDS_pept        519504..520130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0440"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39445"
FT                   /db_xref="GOA:Q1IUK5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK5"
FT                   /protein_id="ABF39445.1"
FT                   /translation="MSQADIAQVGHGPAYEAPPFAIPSKKLVMWLFIISDAVTFGAMLY
FT                   GYGYLRNASSDWPTPFKFSPSIVNVMIMTFVLITSSLTMLIGVRKAQSGDRFGAINWTF
FT                   ITVLLGLVFAGLHIREWIGLIHEGVTLSANPWGSKQFGALFFSITGLHLTHVFGGVIAL
FT                   TVVALGFKRGRYKAADIEIWGLYWHFVDLVWMFVVPLVYLLNLEK"
FT   gene            520143..520451
FT                   /locus_tag="Acid345_0441"
FT   CDS_pept        520143..520451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39446"
FT                   /db_xref="GOA:Q1IUK4"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK4"
FT                   /protein_id="ABF39446.1"
FT                   /translation="MEQTARQESLKTDILIYVVILIIAGLQILLAYRPGTIGKHVLEML
FT                   ALAIVQAGLGIMFFMHLFQEKRLLMIALIPVTIFVLLMMNMFWSDSFRLIHMKPWAN"
FT   gene            520459..520746
FT                   /locus_tag="Acid345_0442"
FT   CDS_pept        520459..520746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39447"
FT                   /db_xref="GOA:Q1IUK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK3"
FT                   /protein_id="ABF39447.1"
FT                   /translation="MKNFARVLLFQAVLLAATGLFGQGCALCYTQAAASGPKMISALKS
FT                   GIIVLMVPPFFICLLITNLSYKKRNQFRSSRLSGAAGSSAIESENADLGW"
FT   sig_peptide     520459..520527
FT                   /locus_tag="Acid345_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.980) with cleavage site probability 0.357 at
FT                   residue 23"
FT   gene            complement(520761..521468)
FT                   /locus_tag="Acid345_0443"
FT   CDS_pept        complement(520761..521468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39448"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK2"
FT                   /protein_id="ABF39448.1"
FT                   /translation="MLRSPQIFSSLRLFSLLLLFPCGAIAQSSTTASSAVRAPVQEYPV
FT                   VMQQKIQAGKTPVGTKVLAKLVVATLVNGFVYPRNAIFSGEVTESVARNGDAPSHLAVR
FT                   MHSLQWRDKSTPLEVDLCAWIYPMASTRPQDLSFEPPDAANSPGKWNGGGAYPDPNNPV
FT                   SQEKFPGRDSDRDSGPQASSPSSQISKHRVMMKGVVESYDSNNRITLSAAKFNVEVDRM
FT                   TTYVLTSSASASK"
FT   sig_peptide     complement(521388..521468)
FT                   /locus_tag="Acid345_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.675 at
FT                   residue 27"
FT   gene            521765..522871
FT                   /locus_tag="Acid345_0444"
FT   CDS_pept        521765..522871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0444"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39449"
FT                   /db_xref="GOA:Q1IUK1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK1"
FT                   /protein_id="ABF39449.1"
FT                   /translation="MTRKRRGIHLIAEMAQVSIGTVDRALHGRNGISHATRERILQIAR
FT                   EIGYTPNLAARALSAGKAGVRIGVCIPREIHFFYDQLWGGVLEEARRLEHMGVAFEFRP
FT                   VRNLGEGDTEALRELIEDGVDGVILTAGNPDGLTPLVNEAEGRNIPVVCVSTDAPESLR
FT                   SSIVCVEPRLNGQLAGELMGKFVPAGSKVAVVAGMLTAMDHLSKTEGFSVTFPKHCHGG
FT                   QIVGVIEGHEDEDESFQKTFDLLGRVPDLAGLYVNTVNCLPVCRALGARQLAGRVKLIT
FT                   TDLFAEMATYFAKGTITASIYQQPHRQGQLAVRLLADNLTANQPFPPTVHLSPGVVMSS
FT                   NLHLFREMRRSETKLPDVVRVASLATKV"
FT   gene            523023..526544
FT                   /locus_tag="Acid345_0445"
FT   CDS_pept        523023..526544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39450"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUK0"
FT                   /protein_id="ABF39450.1"
FT                   /translation="MYCALTRVPELCLRAVHRSRFAILCALVLFFSAHVFGQEATVVGT
FT                   VTDPTGANVPNVTITITHIETGQVRNVTTNSEGQFAAAALPIGHYNITAQSEGFGVAQK
FT                   TNVALNVGDRTRIDFALAVGSTKQTVTVEANAVQVQTQTGEVSTVIDGKQVAQLSTNGR
FT                   SVYTLYALTPGASSVQGDFITPTPVSGDSNVSINGQRPGHNLQILDGGENLDRGGSSAS
FT                   VMPSLEAIAEFTNMTSNYSAEYGLSSAATITTAVKSGTNRFHASAWEFLRNDALDARNY
FT                   FNPAPAKVAELRYNNFGFNVGGQVPLWKDHPTFFFYNQEWRRLVQGGQLNQTVPLASAY
FT                   PDANGTGTGAVIPTTLPNGDPNIITVPTGIANFGANCSGAVRASLIPGQPFPANTIPDC
FT                   LIDPNSQSLLKAGIFPLPTNGVQFQGGNNSPTNVTEEIVRIDHQFSSKFSIFGHWIAEQ
FT                   VSQTYGTTQWSGDNVPTISDVFGNPSFSGVIHTTYTISPTLLNEASFNYNGNRIHIIPQ
FT                   GLVSAPGDFTFNRLFTGPNDQTRIPSIALSGSTGTNYTSNWTPWNNAANDYQVRDDVTW
FT                   SKGAHQLKMGGSWALYTKVQDAFANTQGNFSFNGGFSGNDFADFLLGYAQQYTEDAVKI
FT                   SGNWNNVSWAAYVQDNWRVTHRLTLNLGLRWDGVPHTYEANNQSSNFYRNLYDPANAAT
FT                   FDANGNICSANSVPACPGGPSPGLGTSSNPILSGVGFYVNGIGIGGLNGVPNGLVNNHW
FT                   AAFGPRLGFAYDLTGQGKSVVRGGFGIMYERIQGNDMYNGAVNPPNDLQPLLNSVSLSN
FT                   PGYNIKTGNSITAAALPVLPLVVSGIDSENYKLPVNYQYSFGFQQSLGEASVLGISYVG
FT                   SQSRHQNDYRQINLPAITSLPALLASNGAGINQQMPYLGFGDIRLAENEANASYNSLQV
FT                   DLRGNLKRDFQYQFGYTWSKAIDAATSNGSGGDLNNVTNPYVGWQYDKGPSPFDRTHIA
FT                   FANFVYSIPLFNNNDSRAVRTILGGWQVSGIVTMESGAPLAIGLSGSNVSSLFNGGFVT
FT                   NSGNRPNVNGAVTYPQSVNEWFDTSAFSAPTCTTGPDCWGDLGHNTVRGPGRDNWNLSL
FT                   FKSFTLNDRGSRIEFRADSFNTWNHTQFKGDYNNGGISTNFGSGNFGAVTAAFDPREFQ
FT                   FGLKLVF"
FT   sig_peptide     523023..523136
FT                   /locus_tag="Acid345_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.970) with cleavage site probability 0.962 at
FT                   residue 38"
FT   gene            526694..527827
FT                   /locus_tag="Acid345_0446"
FT   CDS_pept        526694..527827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0446"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39451"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ9"
FT                   /protein_id="ABF39451.1"
FT                   /translation="MARGCFVVVSLFFLPYFVFAQAPDPSAAIAFEQQGKLQEAERTWR
FT                   EVIKQNPKDAGAFASLGVVLSKEQKYQEAAAADRKALTLDPSLPGVQLNLGLAEFKRNN
FT                   FVAAIPPLKAAYAADPASKQAVTLLGLSYYGSKQFAEASKYLGIAAKADPANIELHQVL
FT                   AQSCLSARNYDCALEEFRQISAQNPQSAAVHMLTGEALDGTGHTAAAIEEFKAAVNISP
FT                   REPNLHFGLGYLFWKSHQYDDAKAEFEKELAIDSDHALALGYLGDIAMKQNRLEEASKF
FT                   LRKAISAKPDLRMAYVDLGSVLTEQKQYEEAMEALKHAIKLDPSQPDAHFKLGRVLQRL
FT                   GRSEESRKELAKVRELHEQADAPLATQLPESAAPLPK"
FT   sig_peptide     526694..526756
FT                   /locus_tag="Acid345_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.958) with cleavage site probability 0.946 at
FT                   residue 21"
FT   gene            528196..529512
FT                   /locus_tag="Acid345_0447"
FT   CDS_pept        528196..529512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0447"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39452"
FT                   /db_xref="GOA:Q1IUJ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ8"
FT                   /protein_id="ABF39452.1"
FT                   /translation="MRPRHRCNQPVSDSTTSPSFHFQAFALSALLLLLLGAGMGQTATR
FT                   ITLDEAVDLALAKSPALQAQRTLILQNEAQEITANLRPNPTLGADSQFVPIFSPQDFSG
FT                   DYLDQAQQFDIGVGYLFERGHKRQRRLQAARDQTAVTKAQVADAERTLAFNIGQQFVSV
FT                   LLAESTLDFASQDLKSFQQTVDISETQYKAGYISEGDYLKIKLQLLQFQTDVSSARLAK
FT                   VQALAGLRQSLGYNTVPVDFDVAGDLAFQPLKGRVEDLQILAMRERPDFRASQLGVTAA
FT                   QSQIQLAKANAKVDVNGTYDVSHVAGATSGSIFVSFDLPIFNRNQGEIARTRYALTQAQ
FT                   AQEQAANDTVMTDVLNAYEAVGSNEQVVQLYISGYLKESQDSRDISEYAYKRGAASLLD
FT                   YLDAERSFRSVQLAYRQSLASYMTAIEQLKEAVGTRKLP"
FT   sig_peptide     528196..528324
FT                   /locus_tag="Acid345_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.957) with cleavage site probability 0.640 at
FT                   residue 43"
FT   gene            529509..530675
FT                   /locus_tag="Acid345_0448"
FT   CDS_pept        529509..530675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0448"
FT                   /product="secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39453"
FT                   /db_xref="GOA:Q1IUJ7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ7"
FT                   /protein_id="ABF39453.1"
FT                   /translation="MMIFNRTWQRLAPAAILAALALVLSSCQGGGAKSSNTREGGNPTN
FT                   PELFTVPSDQLSHVQIITVEPTALTRSLRLTGAVAYNSFHTTPVITQVSGPVSRVVVVP
FT                   GQNVHQGEPMLYVASPDFSQLRTNYLKAKDAYALSQKAFARAKDLYDHHAISEQNLEQA
FT                   ESAEVQAGGDLVAAQSALKVLGITDPDELVRTAPTFEVPVKAPISGLVVEQNVAVGQLI
FT                   QPGSTQCFTISDVSTVWVLVNVYQKDLPYVRVGDTVEIQTDAYPDVFHGRISYIAASLD
FT                   PNTRTLQARIETNNPGGKLKKDMYVTATVNAGEIKNALVLPDAAILRDNENQPFVYTET
FT                   ASEQFGRRPVTLGESVNGKTEITSGLKTGDKVVGNGSLFLQFANSLQR"
FT   sig_peptide     529509..529598
FT                   /locus_tag="Acid345_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.585 at
FT                   residue 30"
FT   gene            530733..533816
FT                   /locus_tag="Acid345_0449"
FT   CDS_pept        530733..533816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0449"
FT                   /product="Heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39454"
FT                   /db_xref="GOA:Q1IUJ6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ6"
FT                   /protein_id="ABF39454.1"
FT                   /translation="MIHRIVHAALRQKFFVLMLTAFITVAGILSFQRMPVDAYPDLAPP
FT                   QVEIITQWPDHAAEEVERLVTLPLELEMNGVPHLVVMRSISLYGLSDVRLTFTDTTNDY
FT                   FARQIVFERLAQATLPTGVTPSLAPLFSPSGLVYRYVLESPDRSPQELKTIEDWVVERA
FT                   YRAVPGVADDSGFGGTTMQYQVLLDPARIYGYHLTVPQVTAALTANNSNAGGGFYSQGG
FT                   QFYYVRGIGLLRNTEDIGNVVVGANKGVPIRVRDVGDVIIGHAPRLGQFGFQRNDDAVE
FT                   GVILMLRGEQTQNVLKDVEAKTQELNSRILPPDVKVHPFYDRSDLVDLTTDTVEANLLR
FT                   GMVLVLVVLIFFLVSFRAAVIVALTIPLSLLFAFIVLHAHDVAANLLSIGAIDFGIVID
FT                   GTVVMVENIYRELSLREGQTYSLHEVILTAARDVDRPIFYSVAVILAGYLPIYALSGPS
FT                   GKLFHPMAETMCFALVGALILTLTLVPVLASYWFKKGVREKSNRAFEWMKRIYAVQLDW
FT                   ALERPKTTIVIAALIFGATLLLVPFIGGEFMPHLDEGALWVRATMPYTISFEEASSIAP
FT                   QIRNILMSYPQVTVVGSELGRPDDGTDPTGFFNCEFYVGLKPYKNKAWEGDISDKQELI
FT                   DSINKKLTAFPGIIFNYTQPAEDAVDEALTGLKSSLAVKIYGDDLNVLQDKAIQIKNTL
FT                   SKVRGFTNLTVVRELGQPSLLVEVDRDKIARYGINVSDVQAVISAAVGGQAVTQVIQGE
FT                   KLFDLVVRMQPQFRSSAGEIGNLLVGTPDGQQIPLSQLANIRQGNGAAFIYRENNSRYI
FT                   GVQYSIEGRDLERAVRDGQRAVKQAVTLPQGYSMEWGGEYSQFLDARSQMYFIGPLAVV
FT                   LIFLILFALYGNFKFPMTIAIGVIITEPVGALIALKITNTPFSVSSVLGLLALLGVSVE
FT                   TAVILVSYINKLRKEGLEIRPAIREASLLRLRPIMMTALVACLGLLPAALSTGIGSDTQ
FT                   RPFAIVIVAGLISRLFIGFFVNPVLYEMVARKGDVLQV"
FT   gene            534074..537697
FT                   /locus_tag="Acid345_0450"
FT   CDS_pept        534074..537697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0450"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39455"
FT                   /db_xref="GOA:Q1IUJ5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ5"
FT                   /protein_id="ABF39455.1"
FT                   /translation="MSIRNRLLSATTRVALLLCACSMVFAQAPLIQNRVTAPIENSKTI
FT                   KIRQTVSPLVAKSADKGRLAGDRNLGQMLLMLSPTKEQNTALEAVIKAEHTPGSAKYHH
FT                   WLKASEIATKYGVSEPDTTAVRGWLASQGFEVKHVANSRRFVVFSGTVAQVEAAFHTQM
FT                   HQYELSGNSFIANSQEVQIPAALAPVVRGVVRLTSTPKNNNVKIVGKAAFDKEKGQITF
FT                   TNGEHAITPADFATIYNLNPLYQAGINGAGQSIAIVARSDIYSRDVFDFMSIFGVSFGG
FT                   FYYTINGDDPGYVSGSDVEATLDLTWAAAIAPGATPNIVISQSNFADGVDISAAFIVDN
FT                   NLAPVMSTSFSSCEQQMGPVGTEFYYSLWAQAAAEGITAVVSSDDSGGAGCDLPGSGTF
FT                   AQNGLAVNALASTPFNVAVGGTQFDDTADPSKYWSSTNDSTTKASVLSYIPEKAWNESS
FT                   IDSGNVSLWAGGGGVSTLWTKPEWQIGTGVPADGMRDLPDVSLTAAGHDGYVLCFGGSC
FT                   ESGGIYTVGGTSASAPAFAAIMALVNQQTGSPQGNPNYVIYQLAAQHPEFFHDTTVGDN
FT                   KVPDMNGEFTVGYSTGVGYDLATGLGSFDANSLVTNWNNVTFSGTNTTLSGPAGGLTFV
FT                   HGAGVPVTASVSAASGSKLPTGNVAFFTDNPLGLATPFGVGAAALDNTGDATTSLAAIP
FT                   GGTHSLTARYGGDATFTASTSNAVTVTVTPEPSNTYFVAGVGGSTVTSAEAKYGDPLVM
FT                   AVLVQGNSLVGHPTGSVSLSEGSTDLGTRYLNYGEHEDAEQGSSSVFGVIGFPVGVHQL
FT                   TASYTGDPSFNPSTSTNFQLTIVKSDSTISSLQFQGSALSGAPLPVFGQVSLASGTLMP
FT                   ISGSVTFTAASDKTTVNLGSLTIDATSGTFAGRVSFPSAGSWVLTAVYGGDSNVTGTQT
FT                   QTRVAVDSSEATTMSLSSNAPSVPAGGSVTFTAQVSSPVVLRLPTGTVTFMDGTASLGT
FT                   ATLDGYGIGKFTTTSLTGGSHSITANYGGDAIFRATSASVSQSISDFAVQPTTAAVSIK
FT                   VGQSGTALIALTPQGGFNQAVTFSCSGLPSGASCTFAPATLTPTGTDVATDTMTIATSG
FT                   SGAAAHRAENRRMNWLASSGFGLAGVLLLVPICNRKRRARLVVLAGLMLMLGLWGCGGS
FT                   SSSSPKPPPPNPMVGTYSVTVTATSGTGSAHAADLSVTITQ"
FT   sig_peptide     534074..534154
FT                   /locus_tag="Acid345_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            537782..540094
FT                   /locus_tag="Acid345_0451"
FT   CDS_pept        537782..540094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0451"
FT                   /product="Ig-like, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39456"
FT                   /db_xref="GOA:Q1IUJ4"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ4"
FT                   /protein_id="ABF39456.1"
FT                   /translation="MMKQHGRKQSVRWQLLLVVALLAVLSACGGSSSKTIVPPPTVAVA
FT                   VTPGSATVPVGTSQQFSATVTGSSNTAVTWAVQESDGGTIDAAGNYTAPMKSGSFHVVA
FT                   TSQADTSKSANVGVSVTAPAPVFSTTAPTASAEGTLYSYVLSASDPAGTPVTLALTSAP
FT                   DGAVFSAGTISWTPTWNQSRKSNNFVVTATSDAGGTSTQEWTLAPDGTVYGHYFLHFWG
FT                   SGSDVVIPERDFSVPPISRDPGILLVWAPQSDGSLLPIPGVGFADGTFKFSGVPPGNYI
FT                   VSLEGHADQVQGIWANTSTFYWDADENGYPPLDPSQWWPEALVINTTGLDPFVLATDQF
FT                   SLYDRDGYWDFTGWLPDGETTYTFATPYLLENAPSRTDRWVAVDVEGVPGTDPFTSHVM
FT                   GPAWVQPFSAIDDGTTVNFSGELVRTVPQSMDLNVSFSSFASAFTSAGPGPSTPYIFEA
FT                   MATSEVKVPKSTLSDPSIGQDTPIFADAAIYGPTVEGDPDPWPKDAKGNDIWPDDKSYG
FT                   TLNYNNPFGDGEKTVYIVDARANFSIPFPDSSDPLPWAVDISYATTAPLSGPISSILSP
FT                   PTNGKADDVDFLTGGTVASTTPTLQWDTPATRPNEATDAVTYDIFICEPQSAGGKGGKG
FT                   GGGGVTCVLSLYVSNVDTNSFVVPTGILQAGHSYIVTLTAVSQRDYDPINEQRFSYPVA
FT                   TSQLASAAITVAGSTKNSAHSQANKTAHPIVGVNTAQSRTVLPTVRGSAHSMRFRSPAG
FT                   YAPGFVEKQQPKLPAKQ"
FT   sig_peptide     537782..537883
FT                   /locus_tag="Acid345_0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.825 at
FT                   residue 34"
FT   gene            complement(540175..541611)
FT                   /locus_tag="Acid345_0452"
FT   CDS_pept        complement(540175..541611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0452"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39457"
FT                   /db_xref="GOA:Q1IUJ3"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ3"
FT                   /protein_id="ABF39457.1"
FT                   /translation="MPEPNQRPTWFLISQHWLSVTGVVLVITAVLTWIFILPVQLRGHV
FT                   DNPYAGLVAFVLLPVVFFGGLVLTPIGLFLAKRRIRHGFSSGGFDRKNALRRIAIVVGV
FT                   TTVLNILIGTQVSYRAVSHMETPQFCGGTCHVMAPEYAAYQNSPHSRVECVGCHVAPGA
FT                   SGWVSSKAAGTRQLVETILKSSPKPIPSAIETNRLVPARETCEHCHWPEKFSGVNLRVL
FT                   TKYAPDETNTRTQTVLLMMVGGDKYKGIHGAHVGPGIHIRFAASDPKRQTITRVQYENE
FT                   SSGLKEEFVASDSQKAAPDGTATIEMQCVDCHNRPTHTFEMPEPGLDKALALGEIAVTL
FT                   PYVKKESAQLLQATYTSQAEASEKIPSQLNAYYQQNYPSVYSQRGAEVDRAGKAVLAIY
FT                   NRNVFPELGVTWGTYPNNLGHTESPGCFRCHDGSHTSSSGKTIPQDCNSCHEPLAMDEA
FT                   SPEILQKLGIAERISALQRK"
FT   gene            541899..542531
FT                   /locus_tag="Acid345_0453"
FT   CDS_pept        541899..542531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0453"
FT                   /product="molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39458"
FT                   /db_xref="GOA:Q1IUJ2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ2"
FT                   /protein_id="ABF39458.1"
FT                   /translation="MAASETPKHDDVNVPQDRVQTALSRRDWLRLTIGASAGLALGSLV
FT                   DVKAVRAANESLKLSNVREFTTSCNFCSCGCGMVATVRDNKLITLEGDYDHVVNEGSLC
FT                   VKGMSMFPTHASPQRNQVPRYRAPGSDHWEDITWEDAVERISQKIRKTRDTTWIANEKA
FT                   GDTEVPVNRTDAIAFLGGAQNTNEECYLFQKFARLLGTAYVEHQARL"
FT   gene            542580..545030
FT                   /locus_tag="Acid345_0454"
FT   CDS_pept        542580..545030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0454"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39459"
FT                   /db_xref="GOA:Q1IUJ1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ1"
FT                   /protein_id="ABF39459.1"
FT                   /translation="MTNHWADMQHCKAILVEGSNAAENHVMAMKWIRKAQENGAIIIHV
FT                   DPRFTRTSAGADIFARIRPGADAAFLNAMINHILENKLYDQDYVETHTNALMIGNADFD
FT                   FKDGLFSGYDEEGHKYKTDTWGYQLDGSGKPRHATSLDDPHCVFSTLRKFFARYTLEVG
FT                   ERMSGIPAAQIKLIAETMAKHRPGTILYALGMTQHTTAVQGIRAFTIFQLLLGNIGKPG
FT                   GGVNALRGEPNVQGACDMAVLNNYMPGYLNYPVHTEPTLAAWTVNNGSLRRKYLVNTLK
FT                   AFYGDAATAENEFCYAWLPKRNSAKDYSAYGIFESALAGNMKLLWIAGQNPAVSSPNLK
FT                   LVFEALGNLETLVVQELWETETAAFWKRPGVDPKSVKTEVFLLPAAFFMEKQGTITNSG
FT                   AMVQWRYKAVPPPGQAKPDGEIVDIVYRRVRDLLKDSTDPKDQIVKRAFWTYTTPEDVL
FT                   REINGRALHDIPGTDLKAGTLASRIADLKADGSTSSGCWIYAGVFSKGENLSKRRDHRT
FT                   DPGKLGLYPNFGWTWPNNMRVLYNRASCDRHGKPYPGSKPIVWWDEEAKRWTGYDVPDV
FT                   PVITDGPNTPNGQRAFHMNAEGVARLFAAVYKDPEPASDDLWRDASYVPKDGPLPEMYE
FT                   PVESPVENPMHPKVRNNPMLKYPRVGSIHQPIGTAKDFPYVLMTSTVAEHWCGGSTTRN
FT                   NPWLNELMPEPVCEIPEVLGSKLSVKSGDWVKVSSARGEVEVKAVVTPRMQPLQIAGQQ
FT                   VIIVWMPYNWGFQGLSTGPSVNHLTIDAVDPGAGTQETKACLVNVVKVRDASARRSDPR
FT                   GRRA"
FT   gene            545027..547216
FT                   /locus_tag="Acid345_0455"
FT   CDS_pept        545027..547216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0455"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39460"
FT                   /db_xref="GOA:Q1IUJ0"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUJ0"
FT                   /protein_id="ABF39460.1"
FT                   /translation="MTEPAGGIHTKTTLVDITKCIGCRACQVACKHWNEGEGEATELEY
FT                   NLGFQNPATLSAKTLTLITFHELPNEQAQGGLNYLFTMRRCLHCLEPACTSACPTTALA
FT                   RMADGPVGYDADKCIGCRYCVWACPWGVPTPEWDSLTPKIKKCTHCADREDQPVPLERN
FT                   SVPLTADETDRYKKSITTPACVKACPADALTFGDRDSILQDAHARIAAHPDKYVDHIYG
FT                   EKEAGGTTVVYLSSVPFEKIGFPDVGTKPYPGFSRTALHAVPPAVIAVGAMLGGVYSFM
FT                   KRRTVALIAAAENNSALASKPKFAPLDAPLLTPFNWGLLALMAFGVISLITRFVLGLGG
FT                   STHLSNTYPWGLWIVFDLVWIAVAAGAFATAGIIYVFQRKDLYSLGRSAVLMGLLSYSF
FT                   VTVTLIADLGLPWNSYQLALQSPEQSAMFEVSWCVGLYVTILLLEFLPVPFERWGLARA
FT                   MAIWQKWSGAYVAGAVTLFVFLLSRNYVYAALAAVVFSALAWLFRAKDKKPEPIILAIA
FT                   AVTLSTMHQSSLGSLFLLMPDKLAPQWWSPVMPISFFLSSIAAGTGLVIVIEMWIARGW
FT                   NRPTPMRQLAAMGQITFWSLLVYAIFRLADMGVRGQFAGAFGGTMGALFIAELVVGFVI
FT                   PLALLARQSSRMLPRTLFLGASLTTAGVVFNRINVVYFAMHVKGAMPQVAPEHYAPSIF
FT                   EWGISVGLIATTIFLFGLGVRLMPVLPAKETIQGD"
FT   gene            547220..548068
FT                   /locus_tag="Acid345_0456"
FT   CDS_pept        547220..548068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0456"
FT                   /product="Uncharacterized protein involved in formate
FT                   dehydrogenase formation"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39461"
FT                   /db_xref="GOA:Q1IUI9"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI9"
FT                   /protein_id="ABF39461.1"
FT                   /translation="MLNRDAWLARHPYLVALADLDANVRSTLDGIGIAPAATPNFEDYR
FT                   AEYKSGVPLLHSSALVFDVEAPTSFLLELIERLSRRSDIGELAPQCWELHAQFSMDHGS
FT                   AARAMAALLHRTDESEAQIGVLRFLAWKLMRVYFSPMLRSFDAWRPEEQWLLSYCPVCA
FT                   SLPTMAQLTGQEPGRMRHLHCPCCGTRWRFRRTGCPFCEREDDHRLAVIAIEGEGGLRL
FT                   DHCDSCQGYLKTYDGEGNEALLLSDWASLHIDVLANDRGLRSLGAPLFDLAALSQIASG
FT                   T"
FT   gene            548267..549862
FT                   /locus_tag="Acid345_0457"
FT   CDS_pept        548267..549862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0457"
FT                   /product="porin, LamB type"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39462"
FT                   /db_xref="GOA:Q1IUI8"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI8"
FT                   /protein_id="ABF39462.1"
FT                   /translation="MIAALRGGRPMVARIGVASTLLLLCSLFFCVPSLDAQSAQDLHNE
FT                   LEQMKQQYAQKVAELESRIATLEKQNASIAAATQQNTVTVTDLQTEALRHAEGPADKLT
FT                   RDERTQIEQQDAVNAPRYDLVRDAEMEIAKLKQQAKLFEFHGYLRSGAGINSEGGQMVA
FT                   FQAPGAGAKYRLGNEADTYAELTLVNNWINSQHETDKAWLKTTVTVQADTTQSTNYAST
FT                   DKFRFREAFVQMGNLLESHPEAKFWAGERYYRRVNIDINDFYILDTAGYGGGVEDLNLN
FT                   FAKTSLAYFIGAHEDINTGSGRYVKNMLDARLYDIKAPLGKVGLWYDYSFSKGGTTTDT
FT                   NTDIASVGGWALGFTHTRTEWLGGYHRFTFQYGEGAAANFNSGTADPTPFLPDAKTYRV
FT                   TESVVLQPSKVFAIQPLVIYQEQSTGHPDEGNATWLSFGARPVIFFNQHVSLAFEPGFD
FT                   RTKSPTGAYEGWVRKFTIAPQIGAGREFFSRPVLRAFVTYANWSDGLKGYVGGPVYKDK
FT                   TSGWNFGVQAETWW"
FT   sig_peptide     548267..548377
FT                   /locus_tag="Acid345_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.942) with cleavage site probability 0.713 at
FT                   residue 37"
FT   gene            complement(549937..550455)
FT                   /locus_tag="Acid345_0458"
FT   CDS_pept        complement(549937..550455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0458"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39463"
FT                   /db_xref="GOA:Q1IUI7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI7"
FT                   /protein_id="ABF39463.1"
FT                   /translation="MTFKVDEADLMILNELQQDSGRPIHELADCVGISMPSCARRVKRL
FT                   EEHGVIERYVALLNPSALGLDLDVFISVRLNTQTLKAMDEFKELVARMPEVVECYALTG
FT                   DSDFLLHVRTPGVKEFNSWMQGSLIGVPSIFATHSNISLERIKYSTSLPIPKKKGTSRP
FT                   AKRKADRKK"
FT   gene            complement(550592..554173)
FT                   /locus_tag="Acid345_0459"
FT   CDS_pept        complement(550592..554173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0459"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39464"
FT                   /db_xref="GOA:Q1IUI6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI6"
FT                   /protein_id="ABF39464.1"
FT                   /translation="MGRSISAGIYRNCDRLRFSLLVILSLSLTAFGQSSNNSAAALITQ
FT                   PIDDGNLVELKGNVYPAARASVDQGVADGSLALSRMILILRRSPAQELELQKYLDDQKN
FT                   PKATAYHHWLTPQQFGERFGSNGHDVATITQWLRSHGFTIDSVAKGNNVILFSGTHAQL
FT                   SAAFHTSLHQYKVNGKLQIANATNPQIPAALALAVVGIAKLNDFPLMPMHANFGGVTRH
FT                   KGDAKWRPSKGAPQFNTKISGSDFFAVGPADFAEIYNVKPLWDAGIDGTGQNIAIAGRS
FT                   DINPADVDAFRSYFGLPAKKLNVIYNGGNPGFQFGDEGESDLDIEWSGAIAKNATINFV
FT                   ASASTTTSDGVELSAQYIIDNALAPVMSLSYGECEVGLGDAGNALINELWRQAAAEGIT
FT                   VMVSAGDAGSAACDQGQPFAGYGIAVNGLGSTPYNVAVGGTDLYGTYLNASNYWNATND
FT                   PTSKQSAKSYMPELPWNNSCGNPQLLAAYQSLGYPDKTTEDLCNDVDLAPYVANVVGGG
FT                   GGASACTNSSGGDPTTCTDGYTKPAWQSGVPGIPADTVRDIPDVSLFAGSGLWGSFYVF
FT                   CESDVTPDLACNLDSGDDVQMLAAGGTSFASPAFAGVMALVNQKTNSSQGNANYDLYKL
FT                   AGKQYSGSGAAACDTSAATTVNACTFYDVSLGSNAMPCASGTLDCTLNDSSHFLGVLPS
FT                   YSSNAGYDLTSGLGTINAFNLVDSWSDATTTFSSSTTTLTLDSNSIAYGSTLTGSIAVG
FT                   ASSGGATPSGDASLITAAGTTGVGFGPFALRNGDAAFSVTGTAPGTYSVTAHYAGDATF
FT                   APSSSDPTSITIAKASTSATLNASKAAISAGESVTFQVMLATSSKAMNPTGTVTFTDST
FT                   TGATLGTTSVHADTDASGYSIGRAAINVDGKALNQGANSVVADYSGDGNYNASSASAVS
FT                   VTYTPPFTLASTASVVTVTSGSSATAALSLTANGGPFPADITLSCPSPTPAGISCSFSP
FT                   ATLGAGSSTASSTLTVNAVFPATNGTHRSAPAHKANLHLELISGTGAAFAVVFLCLPVG
FT                   RKPRLASLIVFMAFCLVTFGCGNDSHSPAASTTTLSATPTAGGYGSTFTFKATVSGQGA
FT                   GGTVTFIDGSSQLGTASVSNGTATFTTTTLAYGQHSAVAQYGGDAHNLPSSSAAASVDV
FT                   QYQTTLAVRASDSLGNTTTIQIPITVQ"
FT   sig_peptide     complement(554051..554173)
FT                   /locus_tag="Acid345_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.992) with cleavage site probability 0.384 at
FT                   residue 41"
FT   gene            554601..557975
FT                   /locus_tag="Acid345_0460"
FT   CDS_pept        554601..557975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0460"
FT                   /product="Integrin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39465"
FT                   /db_xref="GOA:Q1IUI5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI5"
FT                   /protein_id="ABF39465.1"
FT                   /translation="MRNGVRTHLPAQPSFKGKIFPFNRPPSSDSSERIRNSALARASSS
FT                   TASMPGLLGAPYVPATIDSDTSGVYSSASTDVDGKSGIDLVTVDYDGTLNVLLNDGHGK
FT                   LALSSSNTSAVALNPGIVYIEVADLNHDGHPDVVAMDASNSAFLVFLNNGDGTFGDASS
FT                   VSVAPASGANYLNGGSFAVGDVNGDGIPDVVAISNLQNGSYPTYTTVFSQQTFLGNGDG
FT                   TFAVPGSSTDVTLPGFQFVQYGQGVVIADLNGDKKADIVTEYYDAINYWVTVAGSLGNG
FT                   DGSFAAIGSGSAVRAVLGIHSALRVLDLNGDKNPDAVFMVGDGNAYVALGNGDGTFRSS
FT                   NTVLHGLPAAQAFQLGDFNADGYLDLLVFNIGSQAVYAGRGDGTFNPEPKAQYGGNQAG
FT                   TQEPSPADFDGDGFVDFVIVDPAYGTASLYYGNGDGTFVAQRAIAPSNSSSTIPNAQEA
FT                   PSNFVAVATGDVNNDGLADVLAYDYTSPFYTDFRMYPDVVLGIGDGKGGFSFTKLVSGY
FT                   QLWIAKGFAVAPIVSDFDHDGKFDLVLETDTGLSIALGNADGTMGAFKAISLPVASSGC
FT                   SFGNFDVGNIDNDSNGNLDMLIAYNGEGPNCIGNDTPSGYFVLLGDGKGGFDAAFTPYG
FT                   GYVSETKLIDFDGDGILDMAVDDGYQTGILICNSCPTPITVLKGHGDGTFDTDGAHLVL
FT                   DGWRISWLVVGDYDHDGKQDLTLLSRGQRDDASGGLVDDTEGILLLKGNGDFTFKDPVL
FT                   IAKDTFATQARYVDLNGDGFPDLIFALDMSFEAVPTYSGLVLMQNLGDGSFSEPMNYLE
FT                   PFGTEQISIADFNGDGAPDVLVAPYFYDGFTPSVLFLNQGGDSLSLTATPNSVTQGEDV
FT                   VLRATLNAVLSGASGSVTFTSNGAVIGTAELSTGSVAELTTSELPAGTDTVTATYAGDA
FT                   NHNAATSAVASVSVQSLAPSFSINATPPSLNLKAGQSGSVTLNLAANAMFSGSVSFTCS
FT                   GLPASASCSFSPASVALDSGKTGTVTLQIKTAGTSQARAITNRSLWTSAAGLALMQCLL
FT                   LVLPIRRRKLARLFARYSAGLLCLLMLVGISACGGSSHDSSGGTPTGNSTITVTGSASS
FT                   GSTTVTQTALISVSVTN"
FT   gene            558664..560775
FT                   /locus_tag="Acid345_0461"
FT   CDS_pept        558664..560775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0461"
FT                   /product="protein of unknown function DUF224"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39466"
FT                   /db_xref="GOA:Q1IUI4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI4"
FT                   /protein_id="ABF39466.1"
FT                   /translation="MSAPLPLAHAHYANVSGYVLFTAISLIALSLFAYTIVRRAIPLLK
FT                   AQADPRFNRAGERLWVAFRCWLLQWKHPRYRWAGLLHVIIFAGFLSLSLRSTELVMSGV
FT                   FDAVSLERHLGEWFAVGYGVLKDYAATAALIAVVLAAVRRFFFRPARYEPRPGDAHHHM
FT                   AEALTVLGFIAALMISESVFGASTYRLSGGEAPATYSLASGVSHLLGALGPGRLESIRQ
FT                   YSFLAHEITFFGFLCFLPFAKHFHVLTSLLNIYFSRLDRGTVKPVRWNVPESDLDKLPS
FT                   LGVRYLSDFTWKHLLDFYSCADCGRCSDNCPANAAGRRLSPRFLTIQARDYIFARYTIF
FT                   GKPVPDMALVGNVYSADEIWSCTTCGACEEECPMQIEYIDKIVDMRRALVEDGEVPSTL
FT                   KKPMKALESRGNPFGKLEKKRADWAKVNDGEASLDVKVLSGTTAAKTLFFVDSVGAYDD
FT                   RIQRVTRTAARLLSETGENFGILGAAEKDSGHDVRRFGEESLFQVLRESNTEAILASGV
FT                   ERIVTGDPHAFNALRHDYRGLPPVEHLSQYLARQVRTEKLQLVGTPEATVVTYHDPCYL
FT                   GRHNQIYDEPREVLDAIPGIKRVEMQRCRDRSFCCGGGGLMLFYEAQEKERMGVLRVKM
FT                   AAEAGANTIVTACPFCLINIEDAIKVAGMEGNMRAMDLTEFVSLHLPVRYLPEETAAIA
FT                   GPLVTTAVH"
FT   gene            560793..561578
FT                   /locus_tag="Acid345_0462"
FT   CDS_pept        560793..561578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0462"
FT                   /product="electron transfer flavoprotein, beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39467"
FT                   /db_xref="GOA:Q1IUI3"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI3"
FT                   /protein_id="ABF39467.1"
FT                   /translation="MNILVCIRRVPDPAENEIRLNRSGTDIERDDLVYSINEWDNYAVE
FT                   EALQITARVGGEVTVVTVGGDEDEEVLRRQLAMGAKHAALLSDDAFAATDAMGIASILK
FT                   AYAQQNSFDLVLTGVQAEGGGAQVGGMLAALLDWPFASLVTAVEVVADKKLKVAREIAG
FT                   GNKEVSEIDLPCVLSIQTGINEPRYVGMRGVRQVASIEIPTLDAAHLRIDSNCLTAKVK
FT                   HAGYFSPVAGVGAEMLSGDREHILDELVERLKGRGGITA"
FT   gene            561575..562573
FT                   /locus_tag="Acid345_0463"
FT   CDS_pept        561575..562573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0463"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39468"
FT                   /db_xref="GOA:Q1IUI2"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI2"
FT                   /protein_id="ABF39468.1"
FT                   /translation="MNPIFLIALQRNGALDDTVAELIATAKTLDPTVQATAIACGYGPE
FT                   LDAVCAALTKSVPTTWKISHEQFATFNAEAIREGLVRILPKGAIVLVAHDHFGMDLAPG
FT                   LSVKLGAAYVPDVLVVEAGQRLVRQEFAGQFNARMECDFSGGAVITVRPGVFKPGSQVE
FT                   VNGVVVDKSSEVSAISVRRRYVTTIPAQVGDVDITKQTVLVSVGRGIQEAENIELAQEL
FT                   ADALGGAVSCSRPVVDAKWLDKSRQVGSSGATVSPKVYLACGISGSFQHMAGIKGSPFL
FT                   VAINKNPAAPIFQFADVGIVDDLLEFLPALTERVRELTERQGTKQTASAAH"
FT   gene            562586..564268
FT                   /locus_tag="Acid345_0464"
FT   CDS_pept        562586..564268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0464"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39469"
FT                   /db_xref="GOA:Q1IUI1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI1"
FT                   /protein_id="ABF39469.1"
FT                   /translation="MIAKKTLKLSLKSLKEFAKKRLPDQLLIELDERDECPVEIVRDMC
FT                   NPGGLGIQLLFIPEEYGGFGGGAFDVYCICEAMAVVDLGIATSLFATFLGSDPLTVGGT
FT                   PEQKKHWLGRIGNEGILFAYGATEPDAGSDLGALRTTADRVMDAERVVGYRIDGLKQWI
FT                   SNGGIADAYTILANTPAGPSWFVVEKGAPGFTHDKPENKHGIRTSNTAALALQNVYVNA
FT                   DRLIGGVEGQGLLQAQAVFGYTRLMVAAFGLGSGWAALDRAIPYSTKRIQGGAPLSEKQ
FT                   GYTHKLIVPNAARLEASRAFIEETAERIDKGEGSLNTEGAIAKYMATEAGNTTAECCIQ
FT                   ALGGYGYTHEYMIEKIKRDVRITTIYEGTSEIMEMTISRDRWQLHLKTRGQHYHDVAKE
FT                   AETLHARHPEVGADVAALALHALAEILERARVARLTRFQHILLRLGELIAYAESAACMA
FT                   RRAARAAEARLHEKANERFSPDALAALARIFAREAALKVSEEGMRWIIGSSTMSATEIA
FT                   TFETGLDLPAIHRAQAGLIADMDFIGDHLYKRAGKQLEAALQQ"
FT   gene            564329..572647
FT                   /locus_tag="Acid345_0465"
FT   CDS_pept        564329..572647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0465"
FT                   /product="beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39470"
FT                   /db_xref="GOA:Q1IUI0"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUI0"
FT                   /protein_id="ABF39470.1"
FT                   /translation="MESTAHRAIAIVGLGAILPDAPDVNTFWSNVQSGRDSISEVPSER
FT                   WDPNLYYDPDPSVPDKTYSKIGGWVRQFNWDPMKWHLPLPPKVSGAMDPAQRWAIACTR
FT                   EALADYGFPDRPLETDRTAVILGNAMAGEMHYMTALRVFFPMYAKELATAPTFAALPED
FT                   LRVEITRQLHERVGERLPEITEDSMPGELANCIAGRIANLYNFHGPNYVVDAACASAMG
FT                   AMNAAIQGLVEHQFDVAVTGGIDRNMGASTFVKFCKIGALSATGSRPYAAGADGFVMGE
FT                   GAVVFLLKRLEDAERDGDKVYAVLRGIGGSSDGKGKGITAPNPVGQILCTKRAWENAGL
FT                   SPADVNYIEGHGTSTRVGDVVEVQSMIDVLSEYSLPSHSIPIGSVKSNIGHLKAAAGAA
FT                   GILKTVLALHHKVLPPSVHCDRPTPDIDFANSPLFVNTKLRPWEMPPDSVRRAGVSAFG
FT                   FGGTNFHTVLEEYIPGRLKPKARNARGAADNPVNAHEIVAAAAPQNGLKAPMRGVLVLG
FT                   AASKSELKGRLRNWNPEGAETPKPPLASDLQADYRIAIDYGAPAELKQKIAAALKAFDA
FT                   DQFAVWKALRAQGIFHGQGPAAKVAFLYTGQGSQYVNMFRSLKEREPIVTQTFAAADRV
FT                   LTPLLGKPLTEYIFVDSKDEKAVEQAELDLRQTAITQPAVLCVDLGITRLLDAYGIRPD
FT                   MTMGHSLGEYGALVASGCLPFEEALEAVSARGREMTRVSVKDKGKMAAVFAPLFEVERL
FT                   LKTVAGYVEIANLNSEQQSVIGGASDAVDEACTKLLAAGFNVVPLPVSHAFHTSIVAPA
FT                   SGPMRDTLERMHLQSPQIPIVANVNGEFYPTGPNVIPQMLDILAKQIASPVQFIKGLQT
FT                   LYRSGARIFVEVGPKKALHGFAEDVLGKDEDVLALFTNHPKWEDTAAFNQALCGLYAAG
FT                   LGRGRTDHAIETVSENKQPSIPALAHTALEELNMPVTTVLSEDRFSRLGHLVAEFLDRA
FT                   SEMREIPSLAPRSNEPIAITGAALGLPGTDRIFDDSNIARLLRGDQFIDVVPNRFRRAM
FT                   VDRHIRRLVKRENGDPTFETIEDVSEAIKLAGRGGAFDLEKEFGVPADRVAAFDRTTAL
FT                   ALGAGIDALRDAGIPLVMRYKTTSTGSQLPEHWALPDAMRDDTGIIFASAFPGSDSFAE
FT                   IMGGYYDDRLRREQLQMLRELRQQVVSNGHGGVAQEIDRRITELAAAMEQNPYSFERRF
FT                   LLRVLSMGHSQLAEYIGARGPNTQINAACASTTQAVSIAEDWIGAGRCRRVLIVSADDV
FT                   TSDNLLPWFGSGFLASGVAATDDSVEKAALPFDRRRHGMIIGMGAASLVVESAAAAKER
FT                   GILPICEVLSTVTRNSAFHATRLDVQHIGGVMDELLLRAEASRGIRRKEIAPHTVFVSH
FT                   ETYTPARGGSASAEVFALRKAFGETADQVVIANTKGFTGHAMATGIEDVLAVKTLETGC
FT                   VPPVANFREIDPELGALNLSRGGSYPIEYALRLGAGFGSQISMSLLRWVKSSDGLRATP
FT                   SALGFQRRIADREVWSQWLEKVANVSNPDLEVVNRTLRIRDSGAPAVVAVTATKGAAVT
FT                   ASQAPQKPVTVAVQPIEPPKPQTIEDPVRQRILQLVADKTGYPSDMLALDLDLEADLGV
FT                   DTVKQAEVFAAIREQYNIPRRENLRLRDFPTLAHVIQFVYDNRPDLSSPAPVAPTVNTP
FT                   AIVVLPLVEEENDEVKDRLLELVVEKTGYPKDMLEMDLDLEADLGVDTVKQAELFAAIR
FT                   EIYSIPRQESLRLRDFPTLKHVVKFVYDMRPDLAQNAPVVPKTNVASPASSEQPTANAA
FT                   VADSITDRILDMVVEKTGYPKDMLDLELDLEADLGVDTVKQAEMFAAIRSIYNIPRDEN
FT                   LKLRDFPTLKHVIQFARERSTIAGPAVETPVVATQAETALASKARSIANFAETNLVPRR
FT                   VPVPVLRPPLELCKPTGVVLGTGTRVIVMPDTGGVAVQLIEQLRALDVEVLTFDTTPDS
FT                   AALDTAIQKWSVAGPIQGVYWLSALDFEGTLTEISSEAWRNAIVVRVKLLYRTMRALYE
FT                   QFASPSTFLVSATRLGGQHGYDSAGALSPMGGAVAGFTKAFKRERMNATVKAVDFGPEP
FT                   SPVQVAESLISETRFDPGAVEIGYKQSLRWTIGLHERPAEDGGAGLELGPQTVFLVTGA
FT                   AGSIVSAITADLAAASGGIFYLLDLVPKPDPINNDLKQFAADKEGLKRTLATRLSTGKK
FT                   RATPAMVEKALAELERQIAAQSAIDAVQSAGGVVHYHALNLTDEQAVEKVIDEVRKEHG
FT                   RIDVLLHAAGLERSHFLPDKEPKEFDLVFDVKADGFFHLLHAIGEMPVSAVVAFSSIAG
FT                   RFGNGGQTDYSSANDLLCKIVSSFRSQRSGTRGIAIDWTAWDKIGMASRGSIPKMMEIA
FT                   GIDMLDPQAGIPLIRRELTMGATRGEVVAAKRLGMLLDEFEATGGLDLEALENSREQLA
FT                   LRGPMVGKITGMGIHNGLTMETQLDPIAQPFLNDHRIDGTPVLPGVMGIEAFAEAALCV
FT                   HPGWHIEAIEEVNFLAPFKFYKDEPRTILVEAVFRQDNDHLITECRLIGRRILATQQEE
FT                   QETTHFTAKVRLHKHPPELSSGVRPHLSPDSIVDSAKIYRVYFHGPAYQVLERAWWDGT
FT                   HLIGEMSINLPFNHQPESLPTQIAPRLIELCFQTAGLWEMGANSKLGLPTRVDQVVAWP
FT                   MANAVPHPLYAVVTPHPEHGTFDAEVVDADGNRYLRVDGYHTTALPAPIDPEVLTSLQQ
FT                   LITPEGVTVPSTH"
FT   gene            572672..578260
FT                   /locus_tag="Acid345_0466"
FT   CDS_pept        572672..578260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0466"
FT                   /product="Carbamoyl-phosphate synthase L chain, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39471"
FT                   /db_xref="GOA:Q1IUH9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH9"
FT                   /protein_id="ABF39471.1"
FT                   /translation="METKFRRIAIVNRGEAAMRIIHAVREFNHEHGTDLRTIALFTQPD
FT                   RQSMFVREADESFCLGPAHERDSVTKQLRSSYLDYELLRNALTESKSEAAWVGWGFVAE
FT                   HADFADLCRHMGIVFIGPSGEVMRRLGDKISAKKLAEKAKIPVAKWSGGPVETVAEAYA
FT                   HAERLGYPVFIKASAGGGGRGIRQVNSPAEMARAFEGARNEAFKAFGDPTVFLERRIDG
FT                   ARHVEVQIIADQFGTIWPLGTRDCTLQRRQQKVMEEAPCPVLTPEQDLALRDAAVRMGQ
FT                   TAAYVNAGTVEFLYLSKTNRMLFMEMNTRLQVEHPVTECTTGADVVKLQLLVAQGQRLE
FT                   GMPPATSGHAIEVRLNAEDPSNGFAPAPGILERFRISTGPGVRVDTGFEVGDVIPAEFD
FT                   SMIAKIVGFGRTREEALARLRRALHVSTVVVNGGTSNRSFLMQMLARPEVHGGNYDVAW
FT                   LDRITASGLLLTDDQGHIALFQSAIDACDAQCAVERTQFYVSALQGRPEVRNELGHRVE
FT                   LRYQGHSYSILVYRLGVKQYRLEVDGSAFEVQIEHLRKYENALTFAGKTFRTVSIEQGS
FT                   TYRVEVDGVSHSVERDEGGIVRAPSPSVVVSIPVKPGDNVQAGDRVAVLEAMKMEIVVS
FT                   APFSGVVRQIVAIANVQVGTGAPLLQIDPASEPESQSVTPRLQVSVLASTIPSSPARPI
FT                   ESFRQMLLGFDVKPEFTNVAAKYQSADEDREPSLYTEENRVLEIFADICALFRNTPRLA
FT                   KELPGESPSAEACLFWYLRSPASEGEGLPPEFTESLRRAVRHYGVESLQPSSELQDALV
FT                   WIYKSHCRIERQVTAILRILQHRLDTLDLNAQPPKDAFSTLLDRLIAITRAAFPLVSDL
FT                   ARELRYRCFEQPQFEAARMRILELVDEHLDTLASSSAEASGGAAKRWLVECPQPLAARF
FT                   SKRFARSSESLQQLMLEVLMSRYYCVRRLDQFRPISLRPSCCVATSFVQDQQTTHVLAL
FT                   HTQFSDVSAALHALGEMVAELPQEDAVLFDILASNGEHHSATELQQELNDALAACRFSQ
FT                   PVQRIVIAVAARNGKPGNTEMQYFTYEPSGTGYQEVQLFRGVHPATGDRLHLWRLGNFN
FT                   ITRLPSIDDIFVMRAIAKSNSKDERLFAVAEVRDLTPIRDESGKIVSLPYFERMFAEAV
FT                   ASIRREQSTRSVRNRLYWNRIFLYVWPTLNLTAEEMDGIVKRLAPSTDGLGLEQVIVRA
FT                   RIPKARNGELRDTVIRISAPGDAGILMTFRPASKLQPMRPLAAYEQKVIKMRQRGLLYP
FT                   YEIIRLLTPPDDGTRSALPPGEFTEYDLDNSGSLVPVAREHGENKANVIVGVVRNFVPR
FT                   YPEGMTRVMLLGDPNRDLGAIAEPECRRIMAGLDLAEQLGVPLEWFPVSAGAKISMESG
FT                   VENMDWIARVLKRLIEFTQAGGEINIVVNGINVGAQPYWNAEATMLMHTRGILIMTPKG
FT                   TMVLTGKRALDYSGSVSAEDNHGIGGYDRIMGVNGQAQYFARDIDEACQILMRHYEHTY
FT                   IAPGESFPRRAITNDPLNRDVRVYRMRDSSDSGFNFVGEIFSDETNPGRKRSFDIRSVM
FT                   LAVSDQDHAPLERFAGMRAAETTVVWDAHLGGYPVCMIGIESKPLARFGFVPADGPDHW
FT                   TGGTLFPMSSKKVSRAINAASNNRPVVILANLSGFDGSPESMRRLQLEYGAEIGRAVVN
FT                   FKGPMIFCVISRYHGGAYVVFSRTLNPQVEVVALEGTYASVIGGAPAAAVVFASEVESR
FT                   TRKDSRLEEINRALSTAEPSQKAHLTAEWDELYRKTYSEKLGEMATEFDAIHSVNRALK
FT                   VGAIDAILPPADLRPFLIAAIERGIMKQQCAADENRLQHETEPTVLA"
FT   gene            578232..578930
FT                   /locus_tag="Acid345_0467"
FT   CDS_pept        578232..578930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0467"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39472"
FT                   /db_xref="GOA:Q1IUH8"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH8"
FT                   /protein_id="ABF39472.1"
FT                   /translation="MRRNQLFWLECTVADLPSDVEWLGENERLRYDQLRLAKRRADWLL
FT                   GRWTAKSVVSDCLGMLRTPSSFRDIQILPDAAGVPVAQIGGSAVLVSLSISHRDGRALA
FT                   VVGAPVFPIGCDLEIVESRGLEFMRTFFTEAEIESCHKANRGGELETLIWSAKESTLKM
FT                   LSVGLRADTRSVSIDIDSRGRAESSWNPFTALVVDGHIYTGWWRVLASQVRTIISSRQS
FT                   KMPRETSAIS"
FT   gene            complement(579318..580229)
FT                   /locus_tag="Acid345_0468"
FT   CDS_pept        complement(579318..580229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39473"
FT                   /db_xref="GOA:Q1IUH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH7"
FT                   /protein_id="ABF39473.1"
FT                   /translation="MAASRLQPRKKISAHRLLVTVAICASIALVLAIVMYGFDYYWLSM
FT                   SERPFSPKHFLLKPSGKIGIGFGLFGFGLFLIIFLYPLRKRIKWLAVRGSARHWLDFHV
FT                   IAGCLAPVIIMFHASFKFQGIAGMAFWFMSAVALSGIAGRYVYAQIPPTLISAENSLKE
FT                   TERIYADPLLETAFFEMAALQNMPRADEIRRMSPITALRSMLWLDLRRPFLVARLRAHS
FT                   QGRNGMVGTLVGFLPSSDAQLEVAIVAARKRAGLAKRVAFLAKTQQAFHLWHVIHRPFS
FT                   YSFAVLAIIHLIVVFALGYVAL"
FT   sig_peptide     complement(580131..580229)
FT                   /locus_tag="Acid345_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.888) with cleavage site probability 0.771 at
FT                   residue 33"
FT   gene            complement(580237..581043)
FT                   /locus_tag="Acid345_0469"
FT   CDS_pept        complement(580237..581043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39474"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH6"
FT                   /protein_id="ABF39474.1"
FT                   /translation="MKRAAFWLALAGLALWASQRCAAQSDAPLDLLLDQAAKNVSGFLD
FT                   KISDVRCTETVRQVKLDKNGKTEYAEDGVYDYFVLLQGSNDELLLDESRIPKREARDRK
FT                   NTPMLISNGFSMLYLIFHPYYRNSFQFQLEADGLIDGHLYHRVRFTHISGNRTPVAVSV
FT                   RGREYPLDLTGEAWFDSEAGMIVRLEATLNRDMQDIGLRTLHAQIDFARVSLSGWSQSY
FT                   TFPTVATIEVESLRQHWRNVHRFIDYKRFMVDTQQAVAESELTKHE"
FT   sig_peptide     complement(580975..581043)
FT                   /locus_tag="Acid345_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.792 at
FT                   residue 23"
FT   gene            complement(581040..582755)
FT                   /locus_tag="Acid345_0470"
FT   CDS_pept        complement(581040..582755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39475"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH5"
FT                   /protein_id="ABF39475.1"
FT                   /translation="MRNTFRSVIAIWLSMTLVHAQSADEVKTEFHIRYVAGGSVYIDGG
FT                   RNAGLTAGMRLNIALPPSPSSEAAQQQNAVAASAELKILSVAENSAMCEVLSASRDLVV
FT                   GDVVTLGHEDAAALVTRRTLSNSRMYPAVISFTDGDPMDEDVREETPRPPLPEVNRAQG
FT                   RIGLEYSGIFNSGQYGGGSSELGVVFRGDITRINGTYWNLSGYWRGRIGAQSYSGPSTI
FT                   QNLMSRTYHLTLSYDNPNSKWVMGMGRMYLPWASSLDTIDGGYAGRKLSEHTVAGVFAG
FT                   STPDPTSWNYSPHREIAGGFVSFDHGSFEAVHTMTTIGMGVAMEQWSIDRPFVFAENTI
FT                   AYKQVFSVYDAVQIDSPKAQPYMPAVSMGLKQAFASVRVLPSHRIGLDLNYSYFRDIPT
FT                   YDPALIGTGLLDKYLFQGLSGGVRVEGPKRLTFYTEVGRSTSSRDSGSSWNTMYGVSLA
FT                   RLWKTGARLDARYSTFNSAFARGSYRSFSISRNLGDILMLQVQAGQQSFNSSFSRDNGS
FT                   RFLNSMLEWNFGSRYFVDNGFTIQHGATQNYNQFYVTFGYRFDNRSHQRPEALP"
FT   sig_peptide     complement(582693..582755)
FT                   /locus_tag="Acid345_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.852 at
FT                   residue 21"
FT   gene            complement(582758..585130)
FT                   /locus_tag="Acid345_0471"
FT   CDS_pept        complement(582758..585130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39476"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH4"
FT                   /protein_id="ABF39476.1"
FT                   /translation="MTTFRLTVAVVLAFVSGATVLSPAQHEPPRAKIVSPHGALGLACE
FT                   NCHTYTAWRPLRAVPEFNHDKTKYPLRGTHVNVSCRQCHTSLVFSNVGMKCSDCHADFH
FT                   RRQMGANCESCHTVKGWKVGIQAIQNHQNRFPLVGAHATTQCEDCHVGAASGKFAGLST
FT                   DCYSCHSKQFATPVLDHRSSGFPVTCESCHTMDTWLGAKFDHLKFTGFALTGMHAKLDC
FT                   TACHLNGKFSGTPASCYGCHTKEYNGTTNPSHVNAGFPRDCGMCHSTSSWLRATFDHNK
FT                   TKFPLTGGHKTVKCESCHIGGNFKSLPTDCSSCHLSLFKTTTNPSHTKAGFPTDCSICH
FT                   TTANWTSASFDHGKYTKFPLTGTHQTLKCVDCHVGGNYTGTPASCSGCHMKDYTGAKTP
FT                   NHAAAGFPTQCQMCHSTTAWKPSSFDHSKSKFPLTGAHSSVQCASCHVGGNYTTLPTDC
FT                   VGCHLSQFKSVKDPNHVTLGWPTDCTICHTTATWADAHFDHTTYTKYPLSGKHATVACL
FT                   SCHVGGKYAGTPADCASCHIKDYNGTTDPNHKAAGFPTDCSICHATAGWKPATFDHNKT
FT                   KFPLTGQHTKVDCIACHKNGVYAGLPTTCVSCHLNDFNKTTSPNHKTSGFPTTCEVCHS
FT                   TNGWIPASFDHSKTSFPLTGQHTKIKCDDCHKGSYNGSLPKDCYSCHKTDYNATSNPNH
FT                   KAAMFPTTCNTCHNTTTWLGAVFNHTWFPIYSGSHAGRWTSCGDCHTNSANYAVFSCIT
FT                   CHQHSQANTDPHHKDVRGYSYGPTTCYSCHPTGTAGD"
FT   sig_peptide     complement(585065..585130)
FT                   /locus_tag="Acid345_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.974) with cleavage site probability 0.468 at
FT                   residue 22"
FT   gene            complement(585199..587193)
FT                   /locus_tag="Acid345_0472"
FT   CDS_pept        complement(585199..587193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0472"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39477"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH3"
FT                   /protein_id="ABF39477.1"
FT                   /translation="MAPENPNGLRTNASIHHPEPGASEGGPRLPLPLVWFFGLLTLLLL
FT                   LPLAAKAQISPGPLSQAHQDLSSSASCTKCHSVSPSSPNFRCLDCHRDIAARLQQKRGY
FT                   HPALVGSQPGSSSCVKCHSEHNGANFALVKWDSKHFDHAKAGFELDGKHAALDCAQCHS
FT                   AKNITPSERLTLSARNANDTYLGLSTACTTCHEDKHNGRQGANCQQCHDERSWSAASRI
FT                   DHAKTRYPLTGAHAQVKCQSCHVPQADGKVKYVGLRFDGCESCHKDVHQGEFSNRACQS
FT                   CHSTGGWKQTSFAREFDHSKTKFMLAGKHAEVACNACHRAGDFKAPIAHDLCADCHKLD
FT                   PHNGQFAKRADGGKCESCHTVEGWKTSRFLAADHANTGFPLRGKHSSVDCAKCHVPAGK
FT                   ATLFKVKFALCTDCHKDAHQAQFAGAPYLNKCEKCHTEKSFHAPTFTLAEHQKSGFVLT
FT                   GGHLAVACIECHKAAGDSQSVAYHFNRLTCATCHSDPHRGQFRARMERITEHGEAAGCE
FT                   ACHTTKRWNDLQRFDHSSTKFDLSGAHKAVECIGCHRPPAMERKLMNVDFQAAPTSCEQ
FT                   CHNDPHGSQFAHADRVTRCAECHDANRWRPSHFDHEKTLFSLKGAHQNTPCKGCHTQFR
FT                   EVANKQVLFYKPTPTKCASCHASSAIRAS"
FT   gene            complement(587324..588040)
FT                   /locus_tag="Acid345_0473"
FT   CDS_pept        complement(587324..588040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39478"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH2"
FT                   /protein_id="ABF39478.1"
FT                   /translation="MKRVLRTVVVAYLFAVGALAWSQASSTDATSLPFGSAVVSDVKGE
FT                   VSVTLAGNSVSNTAQKGQVLGPNTTIECKKGSALLALADGSQVLLKPNTRVILRAPEQS
FT                   KGSFLEELIGKITATVKKRSGNEQPFKMGTPTAVITVRGTKFVVEVSKRQQTFVQVMEG
FT                   LVEVDGFGPMGHPVYLQPGYTTQVGANLSPENPRKLFEDSERGSNSSASRSRKESEGRT
FT                   GKQSSGASGSGSEVDD"
FT   sig_peptide     complement(587960..588040)
FT                   /locus_tag="Acid345_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.434 at
FT                   residue 27"
FT   gene            complement(588037..590316)
FT                   /locus_tag="Acid345_0474"
FT   CDS_pept        complement(588037..590316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0474"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39479"
FT                   /db_xref="GOA:Q1IUH1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR017181"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH1"
FT                   /protein_id="ABF39479.1"
FT                   /translation="MSDFGSKSERLRSCALHAIALTAIAAVLSFAPAVHELNRRISDSY
FT                   LRLQPRGAESPVLVVSIDDASLQRYGRWPWSRDTIARLIRTISAQQPAAIGVDILLSEP
FT                   QSNAQDESLRSAIQQARRVVLVDKIAEFPDGPRWMEPLPGLAGAAAAVGHAHAVLDGDG
FT                   LCRSFPPRELSLAGPRDAFSLEVVRQIDSAKVDAFLAGYGLHTTTGSENVLIAHPVLIP
FT                   IAFRRDPLTTISAAEVMDGSESTALRGKVILVGFGAVEIGDRITTPVSRNLPTPGVEIH
FT                   AQIVDSILAGRKLKPISASLSGLVLFALGFGGSMLFRLWRGWWILPALLAAGLTVYGIG
FT                   FAAFRYGGVIAPIGTGLTVIALTPLMVYGVELAGVEASITRQMRLLQTWLAYRQSATGA
FT                   SAKDISWRLRVLTELQQELGLRFELYRTLLEATRDLVAVFDRAGQLLFANQAFNLAWGD
FT                   GPPPGTIGDVRSRMVESKEAPLTIGAALSEGEATIQGELYSVRLVPLPATSLTPRGGTL
FT                   LSMTNLHLRVERDRAREEALGFVTHELRTPLVAIQGFAEMMTRMPNAKASAQAPKTILR
FT                   ESRRLLALINSYLDVLRTDAGARPLRPAIIPVRKLILQVFDLMSPLTYTSDVQLTLNCE
FT                   PQIFVQADEPLLTGAILNLVSNAIKYGRRGTEVQVSAGISGTKLQISVHNFGEPISDTG
FT                   SVFDPFVRGSKDEDRQQGWGLGLALVKRIVDKHGGETTVQSNEAAGTTFTITIPGATAA
FT                   LEVSKS"
FT   gene            complement(590313..591674)
FT                   /locus_tag="Acid345_0475"
FT   CDS_pept        complement(590313..591674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0475"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39480"
FT                   /db_xref="GOA:Q1IUH0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUH0"
FT                   /protein_id="ABF39480.1"
FT                   /translation="MPKPSLHIVVVDDDPGTCVYIESVFAELGHTCKSFVRPEAAEEYI
FT                   LTHPVDLAIVDVYLGSTTGVEVLRRCRVHRPKLYAVIITGQISLEMAARSIAEGAVDYI
FT                   QKPIDIDALLNIAERALEHKERSGETPAEQEESESKIVGSSPSMLEVYKLIARVAPSNA
FT                   NVLITGASGTGKELVARAIHEHSRRAEMPFTPVNCGSFAETLLESELFGHEKGAFTGAD
FT                   SVRKGLIESTQGGTLFLDEITETSLGFQVKLLRVLQEQQLRRIGSNKIIPIDVRILAAT
FT                   NRDVPSLIREGKFREDLYYRLAVVQIKIPMLAERQSDIPSLVTHFLRQFNERNQARVSI
FT                   EQSAVELLQKRSWPGNVRELENTIYRLAIFASTGRITGADVEREQESQKNGPKAEPVSA
FT                   PDRLVEMERHQILRILKDVHGNKSEAARRLGIERKTLYKKAVRLGITLDASEYQ"
FT   gene            591915..593282
FT                   /locus_tag="Acid345_0476"
FT   CDS_pept        591915..593282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0476"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39481"
FT                   /db_xref="GOA:Q1IUG9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG9"
FT                   /protein_id="ABF39481.1"
FT                   /translation="MVYLLMPGWVGSETVVPALLGLLLTLFFMRRYLKKLRVIEESARH
FT                   AAEQGAMFSEGPQAQHPLIDESRCIGCGTCSTACPEGDVLGIIGGKAAIVKPYKCIGHG
FT                   FCAEACPVGAITMTTASPRVNSQLPRLTPEYETNLPNLFIIGELGGLALIKNAVTQGRQ
FT                   VIDVVFERLQQRDLSRHPDAYDVVIVGAGPAGISASLRAIEQNLNYLTLEEGEIGGTVA
FT                   RYPRQKLVMTSPVDFPIYGRFNRVELSKEELVAFWSKVMHRADFKARTGEKVLGISLQE
FT                   DGRYCVTSSKSSYKARSVILALGKSGTPTKLEVPGENLPKVMYRLIEVDHYRDSDILVV
FT                   GGGDSAVEAAMGLAAKGNRVTISYRKTNFNRIKERNAQRIAEFLANGKLNALCNSRVLE
FT                   IRHSSVLLEQEGTISEIPNHYVWIFAGGTPPYDFLKEIGVSIGTPEAVQPLSALTP"
FT   gene            593309..593587
FT                   /locus_tag="Acid345_0477"
FT   CDS_pept        593309..593587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39482"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG8"
FT                   /protein_id="ABF39482.1"
FT                   /translation="MQASEAPFPVPCLLALTRVVSPFWGKGDITLCGTNEQGAATTMKI
FT                   FGVEILNEGSGVSIDDAVQKMQATFVGASSSLPGRRPFSHLRLGSSV"
FT   gene            complement(593737..593955)
FT                   /locus_tag="Acid345_0478"
FT   CDS_pept        complement(593737..593955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39483"
FT                   /db_xref="GOA:Q1IUG7"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG7"
FT                   /protein_id="ABF39483.1"
FT                   /translation="MAAEFHWDDAEDLGIELSEKFPDQNPLEVRFTDLHKMITALPTFV
FT                   DDPQKSTEGKLEAIQMAWYEEWQDKNS"
FT   gene            complement(593955..594368)
FT                   /locus_tag="Acid345_0479"
FT   CDS_pept        complement(593955..594368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0479"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39484"
FT                   /db_xref="GOA:Q1IUG6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG6"
FT                   /protein_id="ABF39484.1"
FT                   /translation="MAEETKSGNTITVEGINPEKLVRVTFMPENKSVEFEHGNLAYQEH
FT                   GKRESILDVALNFGIHLDHACGGNCACTTCHVVVKKGAELLSELDDDEADRLDGAADLQ
FT                   LASRLGCQVQIEKPGEIVVEIPAWNRNYVSEGH"
FT   gene            complement(594375..596279)
FT                   /locus_tag="Acid345_0480"
FT   CDS_pept        complement(594375..596279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0480"
FT                   /product="Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39485"
FT                   /db_xref="GOA:Q1IUG5"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG5"
FT                   /protein_id="ABF39485.1"
FT                   /translation="MAEERVVGIDLGTTNSLVAYMEGDRPVVIPGEDGANLVPSIVALD
FT                   PAAQIIVGNAARKYLIETPERAVYSIKRLMGRGIEDIQDELKLFPFRVADDLAAGEVIR
FT                   IHLGERTYTPPEISAFILRQLKKNAERYFGAPVTKAVITVPAYFNDAQRQATKDAGRIA
FT                   GLEVLRLVNEPTAASLAYGLDKKRNGTVAVYDLGGGTFDISILKLHDGIFEVMSTNGDT
FT                   HLGGDDIDNLLISTAVLDIAGDMGADIRHRAEAIQAVRKAVIDAKIALSSQASTKIDVE
FT                   IQGGKHYQREIARDQFEQLIEPVIQRTVGPVKQALRDAGLEPEDVDEAVLVGGSTRIPK
FT                   VRALVEKQFRRKPHSELNPDEVVALGAAVQANILSGGSEATKEMLLLDVTPLSLGIEAL
FT                   GGVVAKIIHRNSTIPASATEHFTTGVEGQTSVAIHVVQGERELAADCRSLARFDLKGIP
FT                   PMPAGLPRIEVKFLIDANGILHVSAKEQRSGKESEINVQPTYGLTDDQVENMILDSFDH
FT                   AEDDFAKRQVIEARNEAETILTALDKGRRGDAWTVLSEDEKVLIDECESVLRTDMATED
FT                   YKKIRTAIDALNKATMRLAELMMDSAVTSALKGKDMAKTDMGEGPAAPHPFAPAEFEK"
FT   gene            complement(596279..597043)
FT                   /locus_tag="Acid345_0481"
FT   CDS_pept        complement(596279..597043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0481"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39486"
FT                   /db_xref="GOA:Q1IUG4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG4"
FT                   /protein_id="ABF39486.1"
FT                   /translation="MAEAKQNTYSAIPVLNGDSAGRTTVGCWSCGDMRAAHFCNNCGSV
FT                   QPAVPTDYFSFFGLPKKLNIDLGQLERGFYELSRKLHPDRYAQAASQEQQWSLEKTSQL
FT                   NDAYRTLKDPIARTEYLLRTEGVNFGEQSKSATEEARTSGKQKQQAIPPDMLEEVFELN
FT                   MQLEEARMNKKMGEEDADLAKQLEQTRADLVGRYKALDQELKKDWDEWDAVVAEGASDA
FT                   KRGAVTAKMVDLLNRRTYIRNLVRDVNDVLGY"
FT   gene            complement(597167..597538)
FT                   /locus_tag="Acid345_0482"
FT   CDS_pept        complement(597167..597538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0482"
FT                   /product="HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39487"
FT                   /db_xref="GOA:Q1IUG3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG3"
FT                   /protein_id="ABF39487.1"
FT                   /translation="MTTIETQQAQSAPPKGIQITEKALEKVRVAMVKENVSPTEGGLRL
FT                   GVQGGGCSGLSYNVRFDTQPRERDRIFQYGDIRVFVDPKSFIYLNGMTLDYEETLMNQR
FT                   FVFVNPNASKSCGCGSSFA"
FT   gene            complement(597609..597995)
FT                   /locus_tag="Acid345_0483"
FT   CDS_pept        complement(597609..597995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0483"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39488"
FT                   /db_xref="GOA:Q1IUG2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG2"
FT                   /protein_id="ABF39488.1"
FT                   /translation="MAYSEKVLDHYSNPRNVGSMDKNSAEVGTGLVGAPECGDVMKLQI
FT                   KVNPETNIIEDAKFKTFGCGSAIASSSLATEWVKGKTVDEALGIKNTDIVKELSLPPVK
FT                   IHCSVLAEDAIRAAIGDWKKKNNQ"
FT   gene            complement(598115..599368)
FT                   /locus_tag="Acid345_0484"
FT   CDS_pept        complement(598115..599368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0484"
FT                   /product="cysteine desulfurase IscS"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39489"
FT                   /db_xref="GOA:Q1IUG1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG1"
FT                   /protein_id="ABF39489.1"
FT                   /translation="MSTNGNGNKAVKLPIYMDNHATTPMDQRVLDEMLPYFIEKFGNAA
FT                   SRNHEFGWVAEQAVDQARERIAKVIGATSKEIIFTSGATESDNLAIKGVAQMYREKGNH
FT                   IITQVTEHKAVLDTCKRLEKEGFRVTYLPVQKDGRIDLDDLKRAMDDKTILVTIMAANN
FT                   EIGVLQPIREIGALCHEKGVVFHTDAVQIIGKVPFNVIQDNVDLASISGHKLYGPKGVG
FT                   ALYVRRKNPRVQLVAQIDGGGHERGMRSGTLNVTGIVGLGKAIELAGQEMAEEGKRMTA
FT                   LRDRLKDKIFSELDEVYVNGSWEHRLPGNLNISFAFVEGESLLMGINDIAVSSGSACTS
FT                   ATLEPSYVLKALGAGDDLAHSSIRFGLGRFNTDAEVDYVANKLIDVVKRLRELSPLYEM
FT                   HKEGIDLTKVQWAAEGGH"
FT   gene            complement(599409..599846)
FT                   /locus_tag="Acid345_0485"
FT   CDS_pept        complement(599409..599846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0485"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39490"
FT                   /db_xref="GOA:Q1IUG0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR014290"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUG0"
FT                   /protein_id="ABF39490.1"
FT                   /translation="MLKLTKKADYGLIAMRHLAANADLGACSAKDLAEMYGLPQEALAK
FT                   LLQRLTKAGLLQSQQGTNGGYTLARNPRSISALDVIRALEGPLFMTSCTTAKGSCEQTS
FT                   KCTVREPLRKVSKSIEDVLGRLTIAEMCESEEPVRDLVTLQ"
FT   gene            600385..601527
FT                   /locus_tag="Acid345_0486"
FT   CDS_pept        600385..601527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF9"
FT                   /protein_id="ABF39491.1"
FT                   /translation="MRTSILLLGLSLLAIPAFAGSAADLPKVEVLPTAAPKEPVYSVVA
FT                   GIDGEIYPVFANYASLKNVSERKWGTIAVTVSNPTNTALRARISVQVQGWSDEEIQLAQ
FT                   LGAGASKTYVFAPTFLPRFYNNQEIAAATTVVNVSDMGGQTLYLQTVPVKIRSAEDMFW
FT                   GSKFQFAPFIASWITPHDERVEEILRKAKEFMPGRRLPGYEPEKDAVGQEQMTYSEARA
FT                   IYRALQDAGVSYVKSSMTLGGHQDASERVRMPESSLRDVSANCIDGVVMYASLFENLGM
FT                   EPVVLLLPGHAYVGVRVSPKSDKYLYIETAITGRASFEDSIASAARGVASLKSNDQIRV
FT                   SVADARTMGIFPMPRPIVQSAPSSESVSAALQLQIPATHQ"
FT   sig_peptide     600385..600453
FT                   /locus_tag="Acid345_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.655 at
FT                   residue 23"
FT   gene            complement(601540..601899)
FT                   /locus_tag="Acid345_0487"
FT   CDS_pept        complement(601540..601899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF8"
FT                   /protein_id="ABF39492.1"
FT                   /translation="MRWPETTVAFTVRNGGCGTLHFRRVAFFDVHIFELAGLEDLAALK
FT                   ALDEFGVLVTRDDRDARVAARLWHGVVERLGGLVGQSDRIHTEARERGEFLAECGVFFN
FT                   RRRGLSSGWKRNLRT"
FT   gene            602176..602547
FT                   /locus_tag="Acid345_0488"
FT   CDS_pept        602176..602547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0488"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39493"
FT                   /db_xref="GOA:Q1IUF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF7"
FT                   /protein_id="ABF39493.1"
FT                   /translation="MIRTALVVDDSMLIRHTVCRFLEDRGYTVESATNGADALQILRGI
FT                   RPDVLITDMMMPKMDGSQLITELKKDAEMSTIPIIVLAGRQSAAGLPPEHRANATIWKD
FT                   IDIVTQLDKALRDTLGPES"
FT   gene            602579..603625
FT                   /locus_tag="Acid345_0489"
FT   CDS_pept        602579..603625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0489"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39494"
FT                   /db_xref="GOA:Q1IUF6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF6"
FT                   /protein_id="ABF39494.1"
FT                   /translation="MKLLFVALLLAATSSAQTTAAQAPTKDTSFVDADGTARITRVIPV
FT                   PPDLSPEAKKLLSRPDSDANTPEPLAQRRSRTDEWQEGAGKKSQQIYPVNIEKTTIAGV
FT                   PVRVFTPIHPTTSNADRVLINLHGGGFNSDSGSLTESIPLANLAKVKVVAVLYRLAPEH
FT                   PYPAALDDAIAVYKDLLKTYKPEHIAIYGTSAGAILTAEVAVKLKQLSLPMPGALGIFS
FT                   GMGDLDRMGDSMAMYALRGLSGHLDPPTGQHDKDYLAATSPRDPVVSPVYADLHGMPPS
FT                   LFITSGRDLLLSGTTILHRAYLRAGNDAQLIVFEGLPHAFWNQTGLPETEECYDYMSKF
FT                   FIAKLGLK"
FT   sig_peptide     602579..602641
FT                   /locus_tag="Acid345_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.778 at
FT                   residue 21"
FT   gene            603968..606157
FT                   /locus_tag="Acid345_0490"
FT   CDS_pept        603968..606157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0490"
FT                   /product="peptidase S9, prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39495"
FT                   /db_xref="GOA:Q1IUF5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF5"
FT                   /protein_id="ABF39495.1"
FT                   /translation="MRTKFVFLLLIAASFSFAQSHRPITEKDLFRFQWIGDPQLSPDAT
FT                   QVLYVQISVNDKKDNYDTSLWTVATNGQSAPVRLTSGKRDSSPRWSPDGKWIAFIRGSA
FT                   EPPKEGKPPATQLALLPVKGGEAAIITDLPRSVAQPVWSPDSKHIAFLCDANSDDLAKK
FT                   QKKDAGAEPEHESDVRVINRAVYRFNGQGYLDPKHHAHIWITDLPTASDAKVTPKQLTT
FT                   GNFDEQEATFTPDGTRILFHADRNIEPYYTLPVSDILTVPVTGGDVQLINQVKLGGLLG
FT                   GVSSMVLSPDGKRIAFIGSAPEPVRSYSEPDLWTLELTPGATPKNLTADYDFDVNSGVG
FT                   GDNRAPRAAGGLDPLWSHDGSTILDVVAKQGRAILVKFDVTGKKQPQEITRGDQAVEQF
FT                   VASEDSKTVILSVSTPTLLDDLFALQPDGSQRQLTNVNRTLFSELNLTAPEELWYTSFD
FT                   GKKIQAWIQKPPDFDPKKKYPLILNIHGGPHSAYGWVFDHEFQWMAAKGYVVLYPNPRG
FT                   STSYGQDFGNIIQYKYPGDDFKDLMAGVDEVIKRGYIDDSKLGVTGGSGGGLLTDWAVG
FT                   HTKRFRAAVSQRDISDWAAWWYTADFTLFQPHWFKAPPFDDPQDYIARSPITYIHDIDT
FT                   PMMFILGEADYRTPPASGGEELFRALRFLHKPALMVRFPGESHELSRSGQPWHRVERLE
FT                   NIVGWFDMYLQGASKPEYRMPSDETSTTPDKEKKP"
FT   sig_peptide     603968..604030
FT                   /locus_tag="Acid345_0490"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.584 at
FT                   residue 21"
FT   gene            complement(606388..606864)
FT                   /locus_tag="Acid345_0491"
FT   CDS_pept        complement(606388..606864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39496"
FT                   /db_xref="GOA:Q1IUF4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF4"
FT                   /protein_id="ABF39496.1"
FT                   /translation="MNNLHASERRNDRAIAFLRIAVGGLFLIFAQYKVFGTQFTLHGGF
FT                   QMWINRFLEDGAYPFMVPVLRGFVLRFATPIAFLAAYGELAIGISLVLGIWVRVASAFG
FT                   VIYMMMLLFSSNYPGAHAPVWQYFGASLDHSVLALCFVAFVIGQSDAMWAVRKK"
FT   gene            complement(606907..607923)
FT                   /locus_tag="Acid345_0492"
FT   CDS_pept        complement(606907..607923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0492"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39497"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF3"
FT                   /protein_id="ABF39497.1"
FT                   /translation="MKRLLTFLLLFSASMLAKSSNDLRVYFVDVEGGQATLFVTPKGES
FT                   LLIDTGWPGNEGRDADRIAAAAKSAGLSRIDYVLITHFHDDHVGGVPNLVEKIPVGTFV
FT                   DHGPNRETTDEITENRYEAYQEVLATGKYKHITMKPGDKLPIKGIDVEAVSADGALIEK
FT                   PLKGAGEANTFCAASEKREADKTENLRSLGVVITFGKARLLDLGDLTWDKEMEMMCPTN
FT                   RIGKIDVLIVSHHGWMQSSSPALVDAVRPRIAIMDNGEKKGGSKPTVETVAKIPGLEAL
FT                   WQLHYSEDAGGDNAAEKFLANVQGPDGGHGIELTVDAKGNLVVKNDRTGETVEYAKK"
FT   sig_peptide     complement(607864..607923)
FT                   /locus_tag="Acid345_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.930 at
FT                   residue 20"
FT   gene            complement(608205..608555)
FT                   /locus_tag="Acid345_0493"
FT   CDS_pept        complement(608205..608555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF2"
FT                   /protein_id="ABF39498.1"
FT                   /translation="MNKKYLFVLFGLILAVAMAAPAKANAQVSFGVSVGTPYAGGYVAV
FT                   APYPAYRGYCASPYYFSSGYCYSPSYYRPYYRGYYRHEYHGHYAPRAYRYERERVPYYR
FT                   HDDRDYRGDYRR"
FT   sig_peptide     complement(608481..608555)
FT                   /locus_tag="Acid345_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.646 at
FT                   residue 25"
FT   gene            complement(608625..609770)
FT                   /locus_tag="Acid345_0494"
FT   CDS_pept        complement(608625..609770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0494"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39499"
FT                   /db_xref="GOA:Q1IUF1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IUF1"
FT                   /protein_id="ABF39499.1"
FT                   /translation="MADAVILGIESSCDETAAAVIRNGAEILSSVVFSQIYTHMRYGGV
FT                   VPELASREHLKAIVPVVRQAVEDAGQSYDKIDAIAVTRGPGLAGALLVGVSYAKALSFA
FT                   LDKPLIGVNHLEGHIHVVLLEQKQQGVGEIQFPVLALVVSGGHTHLYLAEKKDAGWTYR
FT                   DVGHTRDDAAGEAYDKVAKLLGLGYPGGPILDGLAKHGDPRAVRFPFAQIKHRDRNPQN
FT                   RHEDDDARVDFSYSGIKTAVLRYVETHEMKAAIEARRTALKEIEKPSQDDYLRVCDRQT
FT                   LDLIASFQRAVVNDLVSKALHAAAENNAATLLVTGGVAANSELRETFERRAGELGLPVY
FT                   FPSRPLSTDNAAMIAAAAYPRFLSGEFAAPDLSAEANLRLR"
FT   gene            609838..611148
FT                   /locus_tag="Acid345_0495"
FT   CDS_pept        609838..611148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0495"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39500"
FT                   /db_xref="GOA:Q1IUF0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUF0"
FT                   /protein_id="ABF39500.1"
FT                   /translation="MLLYLLAGTTVSTGFMVIAWLAIAAALLVLFSGLFGPGLRYKISA
FT                   AKPADNRSDEFLHTLEALTDSKVHRGTSFTVHTNGNDFYEEELRAMAAAQHSINLEAYI
FT                   FQKSEIAQRYVDTMTERARAGVQVNIVLDAIGSAATHEKFFTDLRQAGGKIAWYNDSTW
FT                   YKLPQFNHRTHREVLVVDGRVGFIGGAGVADHWYKARPNKPRWRDTMVRVDGEAVPNLQ
FT                   ATFAENWLESCGEVLTGEDYFPQPHAEQGSGEAMVINSTPTAGGSTRARLLFQMLLASA
FT                   QHTIHITTPYFLPDRSMMDELVRAVKERGVEVVLLVPGKKSDHMLTRSSSRRAYGRLLE
FT                   AAARIYEYQPAMIHAKILLIDGLWGVVGSTNFDNRSFGLNDEVNLAVRAEDFVERLEHD
FT                   FERDLANSELITLEKWKHRPVLERAPELLGWVLDRQQ"
FT   sig_peptide     609838..609912
FT                   /locus_tag="Acid345_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.964) with cleavage site probability 0.775 at
FT                   residue 25"
FT   gene            611148..611888
FT                   /locus_tag="Acid345_0496"
FT   CDS_pept        611148..611888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0496"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39501"
FT                   /db_xref="GOA:Q1IUE9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE9"
FT                   /protein_id="ABF39501.1"
FT                   /translation="MRLRIATYNVHKCRGLDRRTDPERIATVIRELDADVIAMQEILDV
FT                   RDGHPGHDQARRIATNLQEYEWRFGENRSLHGGAYGNMTLSRLPITASENYDITWRHRE
FT                   RRGCLRTDVSLTDRSVLHLFNLHLGTSFVERRHQARKLLTEAVLRRAEFTGPRIVLGDF
FT                   NEWTRGLASRLMGTEFEAIEPRTHLRYARTYPGVMPLLHLDHFYFDRTLSLESYCIHRS
FT                   RTALIASDHLPLVSEFSLAERTKQ"
FT   gene            611909..613273
FT                   /locus_tag="Acid345_0497"
FT   CDS_pept        611909..613273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0497"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39502"
FT                   /db_xref="GOA:Q1IUE8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE8"
FT                   /protein_id="ABF39502.1"
FT                   /translation="MQPKAAAIEIVKTLRGHGHQAYLVGGCVRDLLLGRDPADYDVATD
FT                   AIPDQVMKIFPKTWAVGAQFGVVLVPVPDEPECDPEATHPQSHHHGCIEVATFRSDGVY
FT                   SDGRHPDEVRFSQDPREDVQRRDFTINGMLLDPLNHDEVLDFVGGRADLAAKIIRTIGD
FT                   PRQRFEEDKLRMLRAVRFAARFEYEIAPETMAVIQQLSPQISVVSHERVRDELTKMLTE
FT                   GHARRAFELLDESGLLIQVLPEIAKMKGVQQPPQFHPEGDVWIHTLMLLEQLPPNCSPT
FT                   LAWGALLHDVGKPPTFRRAPDRIRFDGHVDVGVRMTEVLGKQMRFSNEQLDQVSALVEN
FT                   HMKFAEVTHMRESTLKRFMRLPKFDEHMELHKMDCLASHRNLGSYDFLKQKMEETQPKE
FT                   IRPEPLVTGADLIALGHRPGPLFKEILSSVEDGQLEGRLQSREQAMAFVQAEFPL"
FT   gene            613504..613863
FT                   /locus_tag="Acid345_0498"
FT   CDS_pept        613504..613863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39503"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE7"
FT                   /protein_id="ABF39503.1"
FT                   /translation="MPPPEAPAFRCYNRFFARLEPVMEHVRQTLQQILVDAVRRAPAED
FT                   VPLLAWPLACGTAVSEKTRALAFENGELVVQVPDAAWRVQLLALAKEYLRHLSEITGGR
FT                   VERLRFVLPGEMETR"
FT   gene            613860..614186
FT                   /locus_tag="Acid345_0499"
FT   CDS_pept        613860..614186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0499"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39504"
FT                   /db_xref="GOA:Q1IUE6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE6"
FT                   /protein_id="ABF39504.1"
FT                   /translation="MKVTEKDVKYVADLANLELTEAESKRFLKDLNSILEYIDNLNELD
FT                   TTNVEPMAQVAARYGGEGKSEAERYGYALRPDELRPSLPHDVAMKNAPDTDGTYFKVPK
FT                   VIER"
FT   gene            614183..614482
FT                   /locus_tag="Acid345_0500"
FT   CDS_pept        614183..614482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39505"
FT                   /db_xref="InterPro:IPR031796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE5"
FT                   /protein_id="ABF39505.1"
FT                   /translation="MKELAAPPDANRVADAVEVLRAWIINQGLQVSLAPGSFGGGENEI
FT                   IVWSILLTDITRHIADALHKSEGLDPKETINKIQAHFNLELDEPTAEAKGDFIV"
FT   gene            614484..615926
FT                   /locus_tag="Acid345_0501"
FT   CDS_pept        614484..615926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0501"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39506"
FT                   /db_xref="GOA:Q1IUE4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IUE4"
FT                   /protein_id="ABF39506.1"
FT                   /translation="MDINVLTIDATRIAIQERQATATAIAESFYKKIEAEDGEINAYLT
FT                   LSRDRALAQAAKIDAIADRGDDLPRLAGLPVAIKDVISTKGVRTTAGSKILEEFIAPYD
FT                   ATVVQKLEAAGAVILGKTNCDEFAMGSSNENSAYGPVRNPRDKSRVPGGSSGGSAAVVA
FT                   AGTAVTSLGSDTGGSIRQPASFCGVVGLMPTYGRVSRYGLIAFASSLDHIGPFAKDVKD
FT                   AAIMLEVIAGRDPMDATSAEVAVPKYSDEIGKPVRGMKIGVAKEYFGEGLDPEVKASVE
FT                   ASIQNLAKAGAEIIEVSLPHTKYAIPTYYLVATAEASSNLARFDGVRYSHRSKEAKTLS
FT                   EMYRKSRDEGFGAEVKRRIILGTYALSAGYYDAYYLKAQKVRTLLAQDFDEAFAKVDAI
FT                   VTPTTPTPAFKLGEKADDPLAMYLADIFTVTADLVGIPGISVPCGSSKDGLPIGLQVFA
FT                   KHFQEATMIRVAHAVEHALAAV"
FT   gene            618048..618779
FT                   /locus_tag="Acid345_0502"
FT   CDS_pept        618048..618779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39507"
FT                   /db_xref="GOA:Q1IUE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE3"
FT                   /protein_id="ABF39507.1"
FT                   /translation="MPGNFRSGEAHFASIGWVNNGRSDLKRTADFEIRLVELSSAPLFF
FT                   SWSGSQIYEWTRRNIRLFAHWDQIDKNGSLHPKQWGFPYIRESYWHENWLTTGKTKAPF
FT                   YVGTDDALGNGNPSKTDFQPSSLVNLHRLTRQTKLIDSLSSGSHDARTLVEALIVSVPP
FT                   QAEGNNGVDRNNSNRPQLKSNFAILSFLLITGFGFYGFYRFGWYLERVGENWRVVIGFY
FT                   LSLGGFCYGVCMILHFISNHF"
FT   gene            complement(619444..620028)
FT                   /locus_tag="Acid345_0503"
FT   CDS_pept        complement(619444..620028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0503"
FT                   /product="formylmethanofuran dehydrogenase, subunit E"
FT                   /EC_number="1.2.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39508"
FT                   /db_xref="GOA:Q1IUE2"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE2"
FT                   /protein_id="ABF39508.1"
FT                   /translation="MKTLDELLEEAKLAHGHLCAGQVLGVRMALCGMQKLGIEDPRGRD
FT                   RKRLVTYVEIDRCATDAIGVVTGCRLGKRALKFRDWGKMAATFVDLEAGRAVRVAARES
FT                   SKELARQLHPELDNKNAQQMLAYRELSDEDLFTMQWVSVEVGPQEMPGFKGERIACDQC
FT                   GEGINYHREVIRDGRTLCRGCAGENYYTPVE"
FT   gene            620494..621777
FT                   /locus_tag="Acid345_0504"
FT   CDS_pept        620494..621777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0504"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39509"
FT                   /db_xref="GOA:Q1IUE1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE1"
FT                   /protein_id="ABF39509.1"
FT                   /translation="MGFAGGELLEGAVHVETADFHVHGFVFGGAEEELDRHGFAEGDDL
FT                   RLARRRCESGEHNRELEECDTSAHTTRLSPQAPALQPKPAPGAIQPIQSRTLRKDVTHE
FT                   FPAKRSQHILVVDDSPELAMLMQELLAAHGYLVQLAYSAAEAEREIAGRPPDLILLDVQ
FT                   MPGKNGYDLCRELKDNPETRLIPIVMITGLTDRENRIRGIESGADEFLNKPIFPEELFA
FT                   RVKSLLRLKEFTDELDNAEAVLCTLGLSVEARDPYTEGHCERLSQYASELGAFLRMGAD
FT                   AILALKRGGYLHDLGKIAIPDEILKKGSDLTADEWSIMRQHPIIGERICQPLRSLRKVL
FT                   PIIRHHHEHWDGSGYPDQLVGLEIPLLARTLQVVDVYDALRTARPYKAAQSHEQARETM
FT                   LREAERGRWDRELVRAMFAMLTERRKAA"
FT   gene            621880..622668
FT                   /locus_tag="Acid345_0505"
FT   CDS_pept        621880..622668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0505"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39510"
FT                   /db_xref="GOA:Q1IUE0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUE0"
FT                   /protein_id="ABF39510.1"
FT                   /translation="MEYVSYSIVIPAYNESDRIQESLTKIVAFLAEQSWTAEVLVVNDG
FT                   SRDNTAEVVKRFAAQHRFIRLIENPGNRGKGYSVRNGMLQAVGDVVLFTDADLSAPITE
FT                   APKLFSEIQKGVDVAFGSRWLVAKMQTERQSIMRQIAGRMYNVIMRIVLGLNFKDTQCG
FT                   FKAFNRKALETIFTRQHVERWGFDVELLFLARKFKLKIEEVPVEWAHDDRSKINPLVDG
FT                   IKMFGEMLSIRWNSIVGRYTNPHLPKPVVTDATPVVKIAK"
FT   gene            complement(622679..623152)
FT                   /locus_tag="Acid345_0506"
FT   CDS_pept        complement(622679..623152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD9"
FT                   /protein_id="ABF39511.1"
FT                   /translation="MLVPELTNARDTMLRCCGDIWRAEIQSSCRISPYNFLSRNELGTE
FT                   FPHLKSKLAQDRSFFSPNFCSYPELSMMSKCANPNCSSVFRYLRDGKLFQVPAGASLRA
FT                   AATVASDAPKPPTRDEFFWLCGTCSKELTIVVDPVVGVQTVRRTETRVMRAAG"
FT   gene            623241..623317
FT                   /locus_tag="Acid345_R0006"
FT                   /note="tRNA-Pro1"
FT   tRNA            623241..623317
FT                   /locus_tag="Acid345_R0006"
FT                   /product="tRNA-Pro"
FT   gene            complement(623407..624843)
FT                   /locus_tag="Acid345_0507"
FT   CDS_pept        complement(623407..624843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0507"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39512"
FT                   /db_xref="GOA:Q1IUD8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD8"
FT                   /protein_id="ABF39512.1"
FT                   /translation="MRSSARQLGRYVVVVLVLVAVVFIYRHVPANPTTVALTFLILVLL
FT                   TAAFWGFRVAMALSVLATAAINFFFLPPVGTFTIADPQNWIALLAFLVTAVVASNLAER
FT                   ARNEAEKATEQRQNVEHLYDLSQKLLTVETVPELMNAIPVFVLESFGGSGVALISNVKP
FT                   TIYRSTADVSIDAETLRNTLARGESTQQNGVNYFPVRLGVRSVGALAIKGLEIPRQTAD
FT                   AIGSLVGTAIERTRAVDELATSRAARESEQLRSALLDSVTHEFRTPLTSIKASVTTLLE
FT                   GSLADAAARAELLTIINEETDRLNRLVGEAAEMARLDSRVITLQRRQFALSEVVETVLD
FT                   EQISTLRKHPVTVELPKGLPPVYADFDRIRQVLTHLVENAAKYSENDTPIRISAELKGD
FT                   FIVTSVADRGPGIDSFEQTLIFDKFYRGEKQRYAAAGTGMGLAISKVLIEAHGGTLTVV
FT                   SQIGQGSVFSFTLPISGERS"
FT   gene            624891..626012
FT                   /locus_tag="Acid345_0508"
FT   CDS_pept        624891..626012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0508"
FT                   /product="Osmosensitive K+ channel, histidine kinase
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39513"
FT                   /db_xref="GOA:Q1IUD7"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD7"
FT                   /protein_id="ABF39513.1"
FT                   /translation="MQKTPDQWLDEVSPEKKVGLLKLFLGYAPGVGKTYSMLSEAIRRM
FT                   SRGEDVVIGVIETHGRRATAELSSKLDIIPKKQLEYKGTVFQEMDVDAILARKPQVVLV
FT                   DELAHTNIDGSKHRKRYEDVLELVDANIDVLTTMNVQHIESLGPSVLQFTGIQVRETVP
FT                   DWLMQRVDEIVLADVTPQALEKRMKRGDVYPTDRAERALSHFFRPGNLIALRELALRQV
FT                   TQVVDRSLDAYLAKENVEQAPAVRERIAVCVSSNPAAQYLVARASRMAHAIGGEFYVIY
FT                   VDVGRDTDPKDQKSLAENIRFAENLDAKVLRTKGKSVAEEVAKVVKENHITQIIFGRSA
FT                   RTGYQKYLYLSAIHKFLRDAPSVDVHIVTQEAR"
FT   gene            626012..626710
FT                   /locus_tag="Acid345_0509"
FT   CDS_pept        626012..626710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0509"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39514"
FT                   /db_xref="GOA:Q1IUD6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD6"
FT                   /protein_id="ABF39514.1"
FT                   /translation="MIARILVVDDEQQITRVLRTTLSAKGYEIRVANDGETAFEIMKDW
FT                   VPDLVITDISMPNMDGLALCKELRARSQVPIIVLSVKEDERTKVKALDLGADDYITKPF
FT                   NINELLARIRANLRRAPVAEIATILELGDFVIDTAAHLVKVRGTEVRLTPKEFDLLLYL
FT                   ARHPGKVVPHRTLLSSVWGADHAEQSEYLRVFVGQLRKKIEGENSNKRYILTERWIGYR
FT                   FIPEGEPIAA"
FT   gene            627349..629124
FT                   /locus_tag="Acid345_0510"
FT   CDS_pept        627349..629124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0510"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39515"
FT                   /db_xref="GOA:Q1IUD5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IUD5"
FT                   /protein_id="ABF39515.1"
FT                   /translation="MSANGWFQILLFLGLILAVTKPLGVFMARVFNRERTFLDPVLRPI
FT                   ERLIYRCTAVDESQEMKWTEYAIAMLLFSAVSMLMLYIMQRVQLHLPFNPQKFGAVDPA
FT                   HLAFNTAASFTTNTNWQAYSGEAVMSYFTQMAGLAYHNFMSAAVGIAIAIAFIRGIARR
FT                   QSETIGNFWVDMTRAVLWVLLPFCIMGALALVSQGVVQNLKPYDTVKLVEPQQVTTTGA
FT                   DGKSSTQTITTQTIAQGPVASQEIIKEWGTNGGGFFNANSSHPYENPTPLSNLIEMFSI
FT                   FAISAGLTYTLGRMTGSQRHGWAVWGAMAALFLVGVSVVYWAEASGNPLLAGVDQHTSA
FT                   MQAGGNMEGKEVRFGIANTALFATITTDASCGAINGWHDSFTPLGGMVPLVNIMLSEVI
FT                   FGGVGAGMYGMLIYIVLAVFIAGLMVGRTPEYLGKKIEAYDVKMAMLVALIFPLIILVF
FT                   SAISSVKTFGTGSILNPGPHGLSEILYAFVSGTGNNGSAFGGLTVNTPWYDVAIGIAML
FT                   GGRFLMIIPMLAIAGNLAKKKYVPASAGTFPVTTPLFSVLLIGTIIIIGALTFFPALSL
FT                   GPILEHLQMHAGKAF"
FT   gene            629127..631160
FT                   /locus_tag="Acid345_0511"
FT   CDS_pept        629127..631160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0511"
FT                   /product="Potassium-translocating P-type ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39516"
FT                   /db_xref="GOA:Q1IUD4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD4"
FT                   /protein_id="ABF39516.1"
FT                   /translation="MSPTQRKSLWDPKIVRRASLEALIKLNPKKMTGNPVMFVVEVGSV
FT                   ITTALLVVHPHTAFKFNLQITLWLWFTVLFANFAEAMAEGRGKAQADTLRKARSETIAH
FT                   RLLPNGNTEEIASSKLRANDIVLVVAGQMIPGDGEIIEGVASVDESAITGESAPVIRES
FT                   GGDRSAVTGGTRVLSDQIKVKITSNPGETFLDRMIALVEGAERQKTPNEIALNILLAGL
FT                   TIIFLLAVVTLQPFAIYSGAQQTIFVLVSLLVCLIPTTIGGLLSAIGIAGMDRLVQHNV
FT                   LAMSGRAVEAAGDVNTLLLDKTGTITLGNRQASKFMPAPGVTEAELADAAQLSSLADET
FT                   PEGRSIVVLAKEKYNLRGRELGNHEAHFVPFTAQTRMSGVNLNGFEIRKGSVDAIERYL
FT                   VDNSKPIPDEVKATVEQVARTGGTPLVVAERSRGALGVIELKDIVKGGMRERFDQLRAM
FT                   GIRTVMITGDNPLTAAAIAREAGVDDFLAQATPKDKMDLIRKEQADGKLVAMTGDGTND
FT                   APALAQADVGVAMNTGTQAAKEAGNMVDLDSNPTKLIEVVEIGKQLLMTRGALTTFSIA
FT                   NDVAKYFAIIPAMFAATFPVLQALNVMRLKTPESAILSAVIFNAIIIIALIPLALRGIK
FT                   YRPMGAAAMLRRNLVIYGVGGVIVPFIGIKLIDMLITAARLA"
FT   gene            631168..631749
FT                   /locus_tag="Acid345_0512"
FT   CDS_pept        631168..631749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0512"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39517"
FT                   /db_xref="GOA:Q1IUD3"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IUD3"
FT                   /protein_id="ABF39517.1"
FT                   /translation="MKKNLITSVLMTVVTTVLLGLVYPLLITGLAQVFFKDKANGQIIS
FT                   ANGHAIGSRIIGQPFTGPAYFHSRPSAAGNGYDASNSGGTNLGPTNQKLVDRVKQDVSA
FT                   LQPEANGKPIPVDMITTSASGLDPHVTPANAEFQVARVARERGMSETQLRQLVARHTEG
FT                   RQVGFLGEPRVNVLELNLDLDGTQPMPTPR"
FT   sig_peptide     631168..631230
FT                   /locus_tag="Acid345_0512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.873) with cleavage site probability 0.579 at
FT                   residue 21"
FT   gene            631850..632542
FT                   /locus_tag="Acid345_0513"
FT   CDS_pept        631850..632542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD2"
FT                   /protein_id="ABF39518.1"
FT                   /translation="MRVYRILQLFVCVAILTFCVHAQETVFNVPSGDILDRSKVYGELD
FT                   FGYMHSTGIASFTPRVVAGMGHRIEVGVNFNGLNNSDFPQLILSPTIKWKAYDGGKNGW
FT                   SFMVGDNLFFPAYNKTYDAGNYVYAEFVKTWHSGTRATFGGYHFTADVVSSGQRAGGQF
FT                   AFEQPINKRLTAAVDWYTGAQSLGYVTPGAVVKVTSKLTWYASYQIGNSGVSQGNHQFL
FT                   TELGWNFN"
FT   sig_peptide     631850..631918
FT                   /locus_tag="Acid345_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(632535..634850)
FT                   /locus_tag="Acid345_0514"
FT   CDS_pept        complement(632535..634850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0514"
FT                   /product="alpha-1,2-mannosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39519"
FT                   /db_xref="GOA:Q1IUD1"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD1"
FT                   /protein_id="ABF39519.1"
FT                   /translation="MFDRRTFLRGLSLLPFLRTPDLPLMAQSSAPKSSDDDLTRFVNIF
FT                   IGTGGHGHTYPGATVPFGMVQLSPDTYNDGWDWCSGYHHSDASIMGFSHTHLSGTGAAD
FT                   MLDFLLMPGTGSAKLVPGSRENPGEGYRSRFSHADETATPGYYSVLLRDYNIRAELTAT
FT                   ERVGMHKYTFPASDSSHFILDLAHVIGIDPKVIEWAELKVTGPDTIVGGRSINGWATGR
FT                   ELYFAMKFSKPFASVELFSDDKKVDGRETRGNILKLLVHYQTAAGKPIFVKTALSGVST
FT                   EGALKNLESEIPSWDFDGVRRTAHESWRKSLARIRIETKDARQREIFYTSLYHTMVAPT
FT                   LFDDVDGQYRGMDGKVHQLSKGAHNYSTFSLWDTFRAAHPLYTLALADRVPDFVNCLIR
FT                   MCEESPAGPPVWPLQAKETGTMTGYHSASVIAEAYVKGFSGIDFAKCYPAMRRRAMDDD
FT                   YRGMPYYRKLGYIPCDKEEESCSKQVEYSYNDWAVAQIARAAGASADEKLLLQRMHNYR
FT                   HLFDKSVGFIRPKLENGEWSEPFTSNEMGHSKQWRDYTESDPWQTTFTVQHDVGGYMEL
FT                   FGGRKAFVAKLDKLFTENSQLPPDAPPDIAGMVGQYAHGNEPCHHMAYLYCYASAPQKT
FT                   QALVRRLLEMEYDNQPNGLAGNEDCGQMSAWYVMSALGFYAVDPVSGNYVFGSPLFDRA
FT                   EIQLRDKTILRIEVKRTSPADVYIQSITLNGEPYDKIWFRHADIAHGGTIVFTMGGAPS
FT                   PQFGKTDSTLPPGLPPAN"
FT   gene            complement(634987..638430)
FT                   /locus_tag="Acid345_0515"
FT   CDS_pept        complement(634987..638430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUD0"
FT                   /protein_id="ABF39520.1"
FT                   /translation="MALFSRSLTTLSLVSLLFTTTFISAQDSQPTPSPTSAQTTKEKGK
FT                   KKGDSDVAATTPPASKPDQKKQSDKKAAEKNKTEEPKKPADPFSEGTFAGLKLRNIGPA
FT                   IFSGRVIAFAVDPNDKSTYYVASASGGVWKTTNAGTTYDPIFDDQGSFSIGAIALDPKD
FT                   PNVVWVGTGELNSQRSVSYGDGLYKSEDGGKSWKKVGLEKSEHIARIVIDPRDSNVVYV
FT                   AAQGPLWGPGGDRGLYKTTDGGKTWKNVLIISENTGVTDVAQDPSNPDVLYAAAYQRQR
FT                   RVWTLIDGGPESALYKSTDAGATWNKLKNGLPSVDMGRIGIAISPVDNNVVYATVEAAE
FT                   GKGGIFRSRDRGASWEKRNPYDNTAMYYAQIVADPKNVDRIYEMGFAIMVSDDGGKTLK
FT                   PLPTKSKHVDNHAIWIDPDNTRHYLVGCDGGVYESWDRAETWNYKANLPLAQMYDVAVD
FT                   NSEPFYYVYGGTQDNQSMGGPARTRSASGIINTDWFMTAGGDGFRSQVDPADPNTVYAE
FT                   SQNGGLIRFDRATGNFVGVQPQDPKDGPPNRWNWDSPIYVSFHQHTRLYFAANRIYRSD
FT                   DRGDTWRFISPDLSRQIDRNTLPVMGKVWGPDAVAKNASTEFYGNIVAFAESPKDENLL
FT                   YAGSDDGLIHVTHDGGGSWTKFDHFIGVPDNSYVSRLIASRFDVNTVYAAFDNHKNSDF
FT                   KPYLLKSTDAGKTWASLVANLPERGQVMAIAEDSIDRNLLFVGTEFGVFFSSNGGAKWI
FT                   KLTGDMPTTSIHDAVIQQREGDLALASFGRGFYVLDDISPLRGMSAEKVGKPALLFPPR
FT                   RTMLYLPSFLLGGDGKATQGESFYTAPNPPYGVTFTYYLKEKSKSLKEQRQAAEKDAEK
FT                   NKQSFKYPSNDELRTEAEESAPQVFLTVYDAAGNAVRRIEGENAPGMHRVAWDFHYSEP
FT                   TLPQPRGEEDEGFNIPNSAVVMPGTYTVRLAQRIRGVTTELGEPQTFEVFADGVNKMPD
FT                   VDRKALTDFQQKLGKLYGAVQGAAKSADELKAHLREVHEALKLAPGADRSLTESADRLT
FT                   QQTNDLLRTLRGDNVLRARNENTLASISDRVESVMGDTRFAIVKPTQTDLDAYEVTADE
FT                   FTTTLAKLHQLVEVDFANLQKQMNAAGAPWTPGAVPNWTK"
FT   sig_peptide     complement(638353..638430)
FT                   /locus_tag="Acid345_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.960 at
FT                   residue 26"
FT   gene            complement(638532..639086)
FT                   /locus_tag="Acid345_0516"
FT   CDS_pept        complement(638532..639086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0516"
FT                   /product="protein of unknown function DUF1697"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39521"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC9"
FT                   /protein_id="ABF39521.1"
FT                   /translation="MPVYICLLRGVNVTGYNKIKMEELRALCTKLKFEGAQTFIQSGNV
FT                   IFRCPETNEAALAKKIGDAIEKKFGFRPEIMLRTADELRAVVAANPFKKRKDVPPDRML
FT                   VHFLLSEPLEEVRTKLNGTEKIEEVHFKGREIYIYFPDGIGRSDLRSVLDRTLKKTATA
FT                   RNFNSVMKILEIAETLESGTN"
FT   gene            complement(639107..639538)
FT                   /locus_tag="Acid345_0517"
FT   CDS_pept        complement(639107..639538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39522"
FT                   /db_xref="GOA:Q1IUC8"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC8"
FT                   /protein_id="ABF39522.1"
FT                   /translation="MSKRTERERQAIQGPVDTTQIQKRADSGWRMVAVEWEREVDAEAP
FT                   VREEPPFGMRLEPETASLELNPNEWQALILMMDMTVQEGPYWTIAEELNRRGYRTRNGD
FT                   PWTPISVFQMLPRLIELGPRIFATDEWKKRRQQLHHAGD"
FT   gene            complement(639676..640368)
FT                   /locus_tag="Acid345_0518"
FT   CDS_pept        complement(639676..640368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39523"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC7"
FT                   /protein_id="ABF39523.1"
FT                   /translation="MGFRSWRSLLVVCIFATCGFAQTVHVTGRVEITGKKGPAKDASNV
FT                   VVWFVPRGTPAPPPAPKQYRLTQQNKRFSPHLLIVPVGAAVEFPNKDPFFHNVFSVYEG
FT                   TPFDLGLYESGSSKMVHFNRPGASYIFCNIHPEMSAIVLALKTPYYDTSNAKGEYSLDL
FT                   PAGEYELGVWYERTRPEDLKTLSRRVTISADAPEVSRITLTESPSLAEGHKNKYGQSYE
FT                   GESPYSVH"
FT   sig_peptide     complement(640303..640368)
FT                   /locus_tag="Acid345_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.993) with cleavage site probability 0.417 at
FT                   residue 22"
FT   gene            complement(640368..641864)
FT                   /locus_tag="Acid345_0519"
FT   CDS_pept        complement(640368..641864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC6"
FT                   /protein_id="ABF39524.1"
FT                   /translation="MRRMAVTISALLFCVSTSLAQQNATTDPDLQELKQQLRDVVSSLQ
FT                   ETRSELKESQRQIQALQTEVASLRATNAPPSNTPSASPETTPTSTELADRVTTLQEQQA
FT                   LLSTRVDQQYQTKVESGSKYRVRLSGMVLFNASGTRGEVDDQDVPMLAEGHTPGHSGGN
FT                   ISATMRQTFINLDLFGPDLAGARTSASMQFDFMGGFPNTLDGVAMGIVRMKVAKAQLDW
FT                   QNWSLSVGQDKPFISPYSPTSLATIGTPSFGYSGNLWTWTPQIVAERRWKPSESLSTKL
FT                   QFGMLDPLSGELPGDSFGRYPESGERSRVPAFAARQSFDFGSGTEKSSIGFGGYYARHD
FT                   FDFNRTVDGWAATLDWKVALGRYFEDSGAFYRGRAVGGLWGGIGTTAVMDGYLSDPLTH
FT                   VYPVNSIGGWSQLKYKPAPKWEINAAFGEDSPFAADLRLDNAPYSYRPYLRNWTTMFNV
FT                   IQRPRSNLMFSLEYRHLNSVEFSGQRDTAEHVNLGVGVIF"
FT   sig_peptide     complement(641802..641864)
FT                   /locus_tag="Acid345_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.915 at
FT                   residue 21"
FT   gene            642001..644256
FT                   /locus_tag="Acid345_0520"
FT   CDS_pept        642001..644256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0520"
FT                   /product="periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39525"
FT                   /db_xref="GOA:Q1IUC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC5"
FT                   /protein_id="ABF39525.1"
FT                   /translation="MPSSSPVEESQAQSASREEIRKFSGASLRAKFMLAMVLVTSGLTI
FT                   GALVIVRARVTQHIQEQVQRDLKNSSEYLRSYEGRRAELVDRMAKLVADTPLLKALLTT
FT                   RDAATIQDGTKSIAAVSGAQLFVATDPGGKILASHGTQASDRAQIEKSIQASMQAGRQR
FT                   DWWLVNGHLYDVVLTPVSAGAGAETLDVGMLACGFEIDPNLVREIASLTDADVVVRYKD
FT                   SIILSTLPTGADTSEVRKVQAAGVHDIRVGDERFLLTEVILGQEASSPILVLLKSYDRA
FT                   TAFLTVLNWIVISIGLIAVLAGLGLAYVISNRFTMPLRELLTGVQALQDGMYDYPLEAR
FT                   GNDEAAQLTDAFARMRTALQTSQEQLLRSARMEALGRLAGGVAHDFNNLITIISGYGEL
FT                   ALDKSSGDPQLTSFIQEIRKAGERATGLTRQLLAFSRKQVLQAQPLDLNAILSNINKML
FT                   RVLVGEDVQLVIVQGAGMPTVMADPGQIEQVIMNLTANARDAMPGGGTLGMTTSVQSGD
FT                   ALTVPSGEKAAERYVVLAISDTGTGMTQDTIKHIFEPFFTTKAPGKGTGLGLATVYGIV
FT                   QQSGGFLEVQSELGKGTTFRVCLPAVETKPKTVADVVVAAPKQRASGVILVVEDEEPVR
FT                   RLAIAGLQERGYTVLAAANGREALAVIAAQNRPVDLIVTDVIMPEMGGRELFDVLKRDY
FT                   PGVKVLFMSGYTDRSLAELGAELEASLMPKPFTPTALAQKVGDILEPNKARTEVKIS"
FT   gene            complement(644260..644604)
FT                   /locus_tag="Acid345_0521"
FT   CDS_pept        complement(644260..644604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39526"
FT                   /db_xref="GOA:Q1IUC4"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC4"
FT                   /protein_id="ABF39526.1"
FT                   /translation="MESTRKYARYPVDGSADLIDHTNGRCWGHLGDISLGGFYVSTFAP
FT                   WPINTDVRFKLEIDDHPIYGTGIVATSHPGVGMAVVYREMESDDRHELEHVIGTLDHTG
FT                   TEAACVGLRV"
FT   gene            complement(644704..645069)
FT                   /locus_tag="Acid345_0522"
FT   CDS_pept        complement(644704..645069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39527"
FT                   /db_xref="GOA:Q1IUC3"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC3"
FT                   /protein_id="ABF39527.1"
FT                   /translation="MDNTRQHPRYTCHGGVEIHVPETTKRLWGHLGDISRTGCYLHGAE
FT                   PWDVGTEVEIQIDSGSANIFGRGIVATCHPGVGLGINFTEIYPEYHDEFEALLKNLERR
FT                   ASGDTKVHTLPFPISTE"
FT   gene            645247..645702
FT                   /locus_tag="Acid345_0523"
FT   CDS_pept        645247..645702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39528"
FT                   /db_xref="GOA:Q1IUC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC2"
FT                   /protein_id="ABF39528.1"
FT                   /translation="MSSQVQPAPDANPKSQDPPTGRLGVTLLGFGSFALAAAESLCVAA
FT                   VGLSGIRVAIGMSSLISATAAGPAHGFHRNFLRILFLVAGGIGSTLVLLLVWNEGRMRK
FT                   NPAAAWRLQPLTAQQKRSRRIQVVLSVVSLLLIAAEVLTHPWFHHEL"
FT   gene            645681..645950
FT                   /locus_tag="Acid345_0524"
FT   CDS_pept        645681..645950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39529"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC1"
FT                   /protein_id="ABF39529.1"
FT                   /translation="MVPPRTLSLSSGWCGLNQLRQPIVQTVAVADGQLERPLVGDEHQY
FT                   VPRGVEHCGAVSAVGEVVFDIGTHFRIDCALDVIRDLAPNVLAT"
FT   gene            complement(645947..646615)
FT                   /locus_tag="Acid345_0525"
FT   CDS_pept        complement(645947..646615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0525"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39530"
FT                   /db_xref="GOA:Q1IUC0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUC0"
FT                   /protein_id="ABF39530.1"
FT                   /translation="MSQPLKSGEAADEIACRESAMIGRVLAGERELFHELIRPYEKSLY
FT                   FSAFSLLRNAEEAEDVVQESLMKAYRALHSFRSESKFSTWLASIVLNEARGRLRHERVI
FT                   PFTSIDESPDPDEDFTPAVIADWREVATETLERKEIREMIRRAIRELPNIYREVFVLRD
FT                   VQELSIAESAKALGIAEGLVKVRLLRARLMMQKFLAPMLQTGRGGLFGFLRKGAGASWF
FT                   "
FT   gene            646849..647151
FT                   /locus_tag="Acid345_0526"
FT   CDS_pept        646849..647151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB9"
FT                   /protein_id="ABF39531.1"
FT                   /translation="MKNTSMKALLLSAAMTGLLAGASAAQTPSTNDGTNAVKASNGSSV
FT                   LLAKADKDKKDKHSCAGKNDCKGKGGCKSSDNGCKGKNSCKGKGGCATDGSKMPS"
FT   sig_peptide     646849..646926
FT                   /locus_tag="Acid345_0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.928 at
FT                   residue 26"
FT   gene            647224..648102
FT                   /locus_tag="Acid345_0527"
FT   CDS_pept        647224..648102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0527"
FT                   /product="protein of unknown function DUF692"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39532"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB8"
FT                   /protein_id="ABF39532.1"
FT                   /translation="MAANRFNGFTDYGIGIGLRIPHYRHILDNKPVVDWFEIISENYMI
FT                   DGGRPLAVLDAILEQYRVVQHGVSMYFGSVDPLNREHLKRLKNLTRRTKTPWLTDHLCW
FT                   GSVDGRYTHDLMPLPYTWEAIDVTVAKIKQVRDYLEIPVAVENVSSYAEFHESEMTEWE
FT                   FLNEVVERADCGILLDVNNIYVSSMNHSFDPHVYVDSVPAERVAQIHIAGHSKYEKYIL
FT                   DTHDHPVIDPVWQLYAHAIRRCGPTATLLEWDDHIPSFEEVHNEALKAKKFLAENAEPV
FT                   EKKIAAAEARV"
FT   gene            648099..648932
FT                   /locus_tag="Acid345_0528"
FT   CDS_pept        648099..648932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39533"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB7"
FT                   /protein_id="ABF39533.1"
FT                   /translation="MSTLREIQHRWAAAVMHPLTSKDETPRRLHSEAEAIIKPNDRLSS
FT                   LERLEIYSRSYWFRVLDSLVEDFPGVRAIAGVSEFHAMSRDYLAQHPSTSFTLRNLGSH
FT                   FVAWLERNQERVHPHEQFALDMARLEWAHIEAFDASQRPTVTPEMWARGGENAELKLQP
FT                   YIRLVKASYPVDDILLEIREIEDSNRKIANWHRTRLPQLAKSESFIVVHRVDYSVCYRR
FT                   VEREAFDLLNALHSGAPLGVALDAAFRDSSVPEDQWPTLVQQWFGAWMSLGWFSA"
FT   gene            648960..649454
FT                   /locus_tag="Acid345_0529"
FT   CDS_pept        648960..649454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0529"
FT                   /product="DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39534"
FT                   /db_xref="GOA:Q1IUB6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB6"
FT                   /protein_id="ABF39534.1"
FT                   /translation="MSLNTLVSRGYGLLINVANRLQSPFLLLVRLYWGWQFAQSGWGRL
FT                   HHLDTATEFFASLGIPMPHLNAIFISNLELVGGILLAFGFGSRLVSLLLVGDMTVAYLT
FT                   AERDALKMIFSDPGKFYNADPYTFWFASLMILVFGPGLFSIDYLIRKRMAGDAPLSSND
FT                   I"
FT   gene            649631..651886
FT                   /locus_tag="Acid345_0530"
FT   CDS_pept        649631..651886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0530"
FT                   /product="glycoside hydrolase, family 3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39535"
FT                   /db_xref="GOA:Q1IUB5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB5"
FT                   /protein_id="ABF39535.1"
FT                   /translation="MKPRCYRVAFLIFCFCLSLNLWSQSPALNSPQVEKRIDQLLKQMT
FT                   LEEKIGQLNQYSQGAATGPGTGRSGYPEMVSKGEIGSIFNLTGAKETNQMQRIAMEKSR
FT                   LHIPLIFGLDVVHGYRTTFPVPLALSATWDPALIERAARIAAKEASTDGVRWTFSPMVD
FT                   IARDARWGRITEGAGEDPYLGSEIAKAYVRGYQGSLDSPDSIAACMKHFVGYGAAEGGR
FT                   DYNTTEISDRTLREYYLRPFKAGADAGALTFMSAFNSLNEVPASANLFTLRQILRKEWG
FT                   YKGMVVSDWQSLLELKNHGIANDDRTAAAKSILAGVDMDMEGNIYHTEMLDLVKSGVVP
FT                   VSVIDESVRNVLRVKIALGLFEHPYADDTKSAFDGPIPAAYRQEARKAAEESFILLKND
FT                   NAGGHAVLPLTDVHKIAVVGPMADDAEDMLGAWGAKGNAKDVVTLKSALTEYASAHNIA
FT                   VTFADDANSIPADADVVLVAVGENASLMTGEAGSRTHLDLPGHEIAEAAAKSGKPVVLL
FT                   AFNGRPIVLTDVAPKMNAILEAWFPGVEAGPALVETLFGVANPSGRVTASFPRSVGQEP
FT                   LYYNALSTGRPATGVDLTHPPTKSEEKYHTRYIDEQNAPLYPFGYGLSYSSFEYSAPKL
FT                   SAASASAKAINAGDANAAIKVSAMVKNTSNRPGDEIVQFYIRQRGTSVARPVRELKGFQ
FT                   KVTLAAGETKNVEFTLSRKELAFWNIDMKEVVEPAELSVWIAGDSVSGTPAKIEIKP"
FT   sig_peptide     649631..649702
FT                   /locus_tag="Acid345_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.970 at
FT                   residue 24"
FT   gene            complement(651950..653302)
FT                   /locus_tag="Acid345_0531"
FT   CDS_pept        complement(651950..653302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39536"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB4"
FT                   /protein_id="ABF39536.1"
FT                   /translation="MSKKDESGNLQGVTRREFISSSGAAMMLVPIASLSWLGSCSGGSK
FT                   ESTAVTPPASYTGTDEQLLDEVEKGSFQFFWEQAHPDTGLIKDRAKTSGSDNYTVASIA
FT                   SVGFGLTALCIGDKRGYIPSDQIKARVRLTLQTMLSKADGHEGFFYHFLDWSTGKRAWN
FT                   CELSSIDTALMLCGVLTARQYFASDAQIVDLATKLYNNVNWPWMQNGGKTLTMGWKPES
FT                   GFLDARWEHYCELMMIYLLAIGSPTHPIAPDTWKAWTRPTYTYQGITYISSGDPLFTHQ
FT                   FSHIWYDFRNKRDDYADYFDNSVKATKAHKLFCLSLHDKFSDYTDSLWGFTASDSMQGY
FT                   TAWGGPPAMGPIDGSIVPAAAGGSLPFLYDDCMKVLRTVRGGYPNAWCRYGYIDVFNPL
FT                   KNWYNPDVIGIDVGPTMLMAENKRTNFVWETFMKNPEATRAMQLAGFKVTA"
FT   gene            complement(653386..656871)
FT                   /locus_tag="Acid345_0532"
FT   CDS_pept        complement(653386..656871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39537"
FT                   /db_xref="GOA:Q1IUB3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB3"
FT                   /protein_id="ABF39537.1"
FT                   /translation="MSRRFTEITLFLSVLCLLLGTAYAQYGASLEGTVTDKSGAVVPGA
FT                   NVTITDQATSVSRNTVTSGSGFYRVTAMPPGMYTVSVEASSFGKSETKNVDVQAEKVRG
FT                   LNITVSPAATQQSVDVSTEAAGLETESANVDGTITTKQVDRLPTYGRDPYSLLRLAPGV
FT                   FGDASLAGNGTANWFPNSPGPGQNDQPGIFQNENFVQATANGQRASGNNFMIDGTSVNS
FT                   LTWGGAAIITPNQESIQEITVVSSTYSAEDGRNSGAQVKVVSKSGTNNFHGSGFFKYDE
FT                   PGLNAQNQWGGPTPGTPTEKVNVKARDFGGSIGGPIVKNKLFFFFSYEGGRYSNTNYST
FT                   QWVETPEFDQLLAATYPNSLIGQAVTLPGNAPRILNVIPQTDCSAVLGQGYTAPGCHVI
FT                   NGRLDVGSPIGTYGDYAPVFTAGSLGSGFDGVPDLEEAFIALPGTSKGNQYNLRVDYNL
FT                   GSKDLLAFSGYMVPRNDVVATNSGRPNEDLTFEPRNKYGAILWNHTFSATLLNEFRVNA
FT                   TRFFTNQYDTNKNAYWGIPYLQIEQIPNNRINYGATQGTNAPLMAAQNQFEFRDNLSKN
FT                   MGRHAFKMGGSFAMNQDNNDYEFGSQRPIFVYHELWNFFNGAPIYEGIDADPRSGQPTD
FT                   VHKYFRQNDWALYFQDDWKITPKLTLNIGIRYEYFAPLTEKYGRLSNLYLGAAGPDALT
FT                   TATVKTTDQLYPPDRNNFAPRLGFAWSPFSDAKTVIRGGVGVSYNRITDTMTGISRVNP
FT                   PYLFRYGICCGTETGAFGTPYVGGQIDPNVVGTNYQSMYNYGPNPVLTNNFDPTTGLPI
FT                   TGSVEVWGAPQNMATPYIWNYSLDVQQELPWNMVLDIGYAGSETRKLLRIVNLDYIYSN
FT                   AGSDTASHANPVYFPSTSANGNYSALLVNLNRRFSNGLQFIGKYRFSKSMDTVSGEGAG
FT                   FETNQFWPLNQTWDYGPSDFDSTHNILFTALWDLPIYRNRHDWVGTLLGGWHVDGTYQY
FT                   HSGFPWSPVQSNDCPTIPLIGSAPCPALVTAQYMNGKSGLANDDFLHGGIFPNALVTVT
FT                   CPGGATATINQYFQPADCSQPPAGPPFIHRNSFRGPNYSTVDLAIGKTARLPWFGGESS
FT                   QIDFRANLYNAFNRLNFEPFGYSSSATSINSNTFGQPQAALAGRVIDFQVRFTF"
FT   sig_peptide     complement(656797..656871)
FT                   /locus_tag="Acid345_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            657088..658173
FT                   /locus_tag="Acid345_0533"
FT   CDS_pept        657088..658173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0533"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39538"
FT                   /db_xref="GOA:Q1IUB2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB2"
FT                   /protein_id="ABF39538.1"
FT                   /translation="MPRRKTMPPPRTSSDHKKPISLKRLAEHLGLSSATVSIVINRKPL
FT                   SDMIPEETKTRIWEAASRFNYRPNIIARSLRQQRTYSIGVLLPEFSDGYSALVLSGIED
FT                   YLLGKGYAWLAASHRHKDELIREYPHLLYTRAVEGLITIDTPYDEHLPFPVVSVSGHQT
FT                   IEGVTNIVLNHDRSAELAIGHLHELGHRRIAFIKGQSFSSDTQVRWDSIRKACRSFGIT
FT                   VDPQLVAQLEGVSPSPEPGYQAAKRILANKVDFTALFSFNDVSAIGAIRALQEADLHVP
FT                   ESVSVVGFDDIAVAAYHIPALTTIRQPLGHMGSLAAETLVERIAARGNEGPALLEVEPE
FT                   LVVRESTAPLSTAKAVPSGKG"
FT   gene            658170..659345
FT                   /locus_tag="Acid345_0534"
FT   CDS_pept        658170..659345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0534"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39539"
FT                   /db_xref="GOA:Q1IUB1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB1"
FT                   /protein_id="ABF39539.1"
FT                   /translation="MKRFLITIHAIYVLVGIANTMLGPLLPLLAARWQLSDRQSGMFFL
FT                   VQFVGGFAGAICSTNLAKRFPLHSIASAGLFLTAIGFAGLAAPAQLVAYVSIFANGFGL
FT                   GLVSPTLTAAVSEAVPQHRAAVLNLLNFVWALGAITAPNLVLIALRQSGFSVPGMLRGF
FT                   GLVLAITALLVPRVITTRPAEEAVAAELPSSTWRLIVACGVLIFVYVGIENGVAGWLPT
FT                   FATRVHRFTVERSALLQDTFWTTFLIGRFCAPAVLRVVAERMLLTLSVCLAAIGTALLL
FT                   TTNSPQILFVAVMAIGVGCAPVFPTAIALLSHRLSGQSGTKLGYMFASAGLGAAFFPYC
FT                   IGALSSATNSLRIGMCLLLFYECALLMAHFTMSYFAARTTSSAIQIRTQGA"
FT   gene            659452..660660
FT                   /locus_tag="Acid345_0535"
FT   CDS_pept        659452..660660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39540"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUB0"
FT                   /protein_id="ABF39540.1"
FT                   /translation="MLRKSLTVIAVCLLPLSASLAQTTPPSCHSAAAGQNGSLAGYVPF
FT                   GPSSPWNQDVSKATVDPNSSAIIGYVGTTKPLHPDFGAGLYQGSTMGIPYIVVTSATPN
FT                   ATIHFTDSPGESDPSPMPVPKTAPIEGYPAPGSGDRHVLVLNTTTCWLYELYSAYPNTD
FT                   GSWNAGSAAIFDLSTTAYRPWGWTSADAAGLPIFAGLVRYDEIVNGHIDHALRFTLHNS
FT                   KQAMISPARHWAANSSDTLAAPMGLRFRLKASVDISKYSKTNQIILTALKKYGMIMADN
FT                   GTSMYLSGTPDDRWSNDDLHNLTQLTANDFEVIKPTAVYTTLPTGASPVITSFTASAYS
FT                   ITAGTKVTLSWAATGATYYSVAPLGMQRGTWMTVAPTKTTTYTLYATGSYGRTQATLTI
FT                   TVH"
FT   sig_peptide     659452..659517
FT                   /locus_tag="Acid345_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.878 at
FT                   residue 22"
FT   gene            complement(660752..663082)
FT                   /locus_tag="Acid345_0536"
FT   CDS_pept        complement(660752..663082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39541"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA9"
FT                   /protein_id="ABF39541.1"
FT                   /translation="MAASAAIFLCTLSSNIHEGAVFAFCLSILKFSRLRSQSLPLRVFQ
FT                   TSGRTRNAGPFVTEKNNQEQSVRTLQVVCLAVLLCCVAFAQETMQASSAQPVVPHLIRF
FT                   TGQVKAASGTVGITFSLHKAQEDSKPLWIETQNVKLDADGKYSVLLGATKTDGIPLELF
FT                   SSGEAQWLSIRVEGQPEMPRVLLVSVPYALKAAEAETLAGHSLSEFVTTEKLSAMQQQG
FT                   APSSSDTTVKKSPGTRNAVGSGPTNFSGTTTDQIVGVTQIGTGAGVSSAAASGYAIYGK
FT                   SSGTAIYGFSTATSTAGYGLYGATTSTSGYGVFGANNATTGTAVGVRGTSLSNGGIAVY
FT                   GTANTPTGTATGVKGITQSPDGYGVFGQNTATTGNGIGVRANSSSTSGIALLANELAAS
FT                   GTTIGIQATAASANGTAAVLGNSNSAGKLISGRSGGSNTEVFSVNALGSGTFSGNGAPA
FT                   IIGNVGCGAPSAGISFDALDGCFSYTLLQQNSDVFLNRPTGGILHIREGNKEEMSVGSG
FT                   GSLTIAPTARVPGLNTYGGVDPTDFESEVGVYSTGGASTNGLGGDGMFTTGGASTNHYG
FT                   GHGIVAIPGHGAAGDGLAGLFLGNVTVNGTFTNGAQRFQIDHPLDPANKYLSHASVQSS
FT                   EMKNIYDGVAAFDANGEAIVQLPDWFEAENGNFRYQLTPIGASFTPYIATKVLGNRFKI
FT                   AGGLPGKEVSWQVTGVRKDAYAQAHPLQVEEQKPEGERGYYISPELYGAPPEKQTEWAR
FT                   RPGTMKRMRDNAKPNRGEAFATK"
FT   gene            complement(663104..664858)
FT                   /locus_tag="Acid345_0537"
FT   CDS_pept        complement(663104..664858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0537"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39542"
FT                   /db_xref="GOA:Q1IUA8"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA8"
FT                   /protein_id="ABF39542.1"
FT                   /translation="MAELTTPDHIHWVDGSDEENEKLCADLVQNGTFIKLNEKLWPNCY
FT                   YARSDASDVARVEDRTFICSLSKDAAGPTNNWENPYEMRKKLRGLFAGCMKGRTMYVLP
FT                   FSMGPIDSPMAQIGVQLTDSPYVVVNMRIMARIGIKVFKEIDKDTKRVVPCLHSVGMPL
FT                   APGQKDVPWPCNKEKYIVHFPEAREIWSYGSGYGGNALLGKKCFALRIASTMARDEGWM
FT                   AEHMLIVGVESPEGEKTYVAAAFPSACGKTNFAMLIPPKGFEGWKVWTVGDDIAWIKPD
FT                   ANGKLRAINPEAGFFGVAPGTSMKTNPNAMASLAKNTIFTNVALTPEGGVWWEGMTDEP
FT                   PAECTDWQGRKWTPQIGKETGAKAAHPNARFTAPARQCPTIDPHWEDPEGVPISAFIFG
FT                   GRRATTMPLVYQAFNWSAGVYAGATMGSEMTAAAAGTIGKVRRDPMAMLPFCGYHMGDY
FT                   FRHWLKMQRNLSVTPRIFHVNWFRKGADGKFLWPGYGENMRVLKWIVDRVHGRGFGKET
FT                   PIGWIPVYDDIHWKGMEFPREQFEELERVEREDWKKEVIGHEELFIELHDHLPSEMVYE
FT                   RELLICRL"
FT   gene            complement(665151..665549)
FT                   /locus_tag="Acid345_0538"
FT   CDS_pept        complement(665151..665549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39543"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA7"
FT                   /protein_id="ABF39543.1"
FT                   /translation="MHNELTLISAFIKRSKRDRYREFVSDPRLRRKFTSQLAHFSDFDP
FT                   KYRVDIPSSKLSVDKIAVELRKRHSPNIVAAISEDPNLDQKWEMVRVLERNGIYIQKIK
FT                   TDKPGYVVYEDEWQLVAEPFRKGTMTRR"
FT   gene            complement(665584..667578)
FT                   /locus_tag="Acid345_0539"
FT   CDS_pept        complement(665584..667578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39544"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA6"
FT                   /protein_id="ABF39544.1"
FT                   /translation="MSKLYSRWEISRRIVLVLGVLLLIAVPASAGDSVPDWFRQLAHAP
FT                   LPKYSDEANAVVLLHDEAVTVRDNGDMYVNVRRAVKVLRPKGKEEGVFVVQFDKDRKIE
FT                   SLKAWSISPNGQEYELKEKDAIEGSPYEDALYDDHRVKVIKVPAVEVGSYVAVEYQQKR
FT                   RPNVYSDRWDFQENVPVKTARFTINLPSSWEYQYRFSNWAEQKPQNIGANNWLWEVHDI
FT                   EGISEEPDMPYPGSLAGMMAVTLFSSSIPQATPMKAWSDVAKWANTLNASRRVTTPKMQ
FT                   AKVAELIAGKTDAVAKIHAIASYVQHNVRYVEISIGKVGGWQSHMAGDTFANGYGDCKD
FT                   KATLLVTMLQEAGIESYLALVDSERGVVNPAVPTPWTFDHMIVAIKIPSNTDATSLFAR
FT                   VDDPKLGPLLIFDPTDDMTPFGLLHSTEQDSYALLVTGDSGELVKMPLLAPSLNRLLRV
FT                   AHLQLTPEGALNGEVEEIRWGYEASVMRARLVNSDRDKRVKVIEEFLSEFLDRSQLTYA
FT                   SIQGLDKYDEALILRYKFEAPDYAKTAGDLLLVRPRVLGSKSSSIAEDKKRKYPVTLYP
FT                   TASMQSDMIEIKLPAGFKVDELPEPTQVTAPFAEYKSKVEAKDNVLSYSRTYTVKDLVI
FT                   PVDQLGALQKFMRGIAADERNTAVLKKTP"
FT   sig_peptide     complement(667486..667578)
FT                   /locus_tag="Acid345_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.995 at
FT                   residue 31"
FT   gene            complement(667547..669514)
FT                   /locus_tag="Acid345_0540"
FT   CDS_pept        complement(667547..669514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39545"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA5"
FT                   /protein_id="ABF39545.1"
FT                   /translation="MKKFWFARNTTLCAVVFLGLGLARAIDFPPVTPEQLAMKDNPAQP
FT                   GAKAMILYRAIERDDRMGSQAEYAQIKIFTQEGKDYGDVVLDFDRGAYTVESIKGRTIH
FT                   PDGTVIPFNGKAYEKVIAEGQGFKVHRKAFTMPDVTPGSVLEYKYVVRWEASDPATHQY
FT                   YYFPRSEWEVSKELYQQSAHFVFKPLTMDGLYWSLRSNRLPPDAKFNHEQLTDKVTLDL
FT                   VNVPGVEKEEFMPPSSETKARVLFFYSDTHIPEPDQYWKDHGKKWHGWAEGFMDKKGAI
FT                   QKDLASVISSSDSTDVKLRKIYEHVQSFENLEFESAKSDKEIKALKIRDIKSIEDVING
FT                   KAGYRNELNRTFVALARGAGFDATLVAVTERDTAIFHKEWPSSSQLAYEIPLVKVNGAD
FT                   IYLDPGSPFCPFGVVPWEDTAVSGLKLDKNPPVWAQIPLPPSDDSSIKRVAKMTLGDDG
FT                   SLTGEVEVTFTGQDAFHHRLWERNEDDAGKKKDMEELLQDWMALKADIELEKVNDWKAS
FT                   NVPLVATFKVTVAGYASQAGKRVLIPCTLFAAAYRNPFTPTKRVNPIIMHYAYDRSDDV
FT                   TIKLPANFQVESMPKPVAEQNNIADLNVKCDSNNGTLHLVRDFKLKGLFIDQKYYGAVR
FT                   GYFQQVQAGANEQAVLKMGN"
FT   sig_peptide     complement(669437..669514)
FT                   /locus_tag="Acid345_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.916) with cleavage site probability 0.799 at
FT                   residue 26"
FT   gene            complement(669853..670359)
FT                   /locus_tag="Acid345_0541"
FT   CDS_pept        complement(669853..670359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA4"
FT                   /protein_id="ABF39546.1"
FT                   /translation="MKKTLYVGTLLALLTLSLSVFAQNRSERPRHDQPMISGRDVVTNI
FT                   ATTPYSGVLVYNFTILNSTPTVNPVTCSVSTYVSGDTSGRQFYETAYGRATPISGGYAK
FT                   CTVKIYYTWQLASAGSDMITGSANFSANTAATAGTTQRSAQQSLVSIPVPATGVTTTTT
FT                   LSGRL"
FT   sig_peptide     complement(670291..670359)
FT                   /locus_tag="Acid345_0541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(670448..670957)
FT                   /locus_tag="Acid345_0542"
FT   CDS_pept        complement(670448..670957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39547"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA3"
FT                   /protein_id="ABF39547.1"
FT                   /translation="MKRTLHVCTLLALLTLSLSVFAQDKTDQSRNDGASGISPKEVVTN
FT                   IVTSPYSGVLVYNFTILTSTPIVDPVNCEVQVYVSSDSSGRQYYENANGKATPISGGYA
FT                   KCTVKIYYTWQLASAGTDMITGNYYLWGYTSATAGTTERQTQGNLVSFTVPATGVTTTT
FT                   AISGRL"
FT   sig_peptide     complement(670889..670957)
FT                   /locus_tag="Acid345_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(671225..671722)
FT                   /locus_tag="Acid345_0543"
FT   CDS_pept        complement(671225..671722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39548"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA2"
FT                   /protein_id="ABF39548.1"
FT                   /translation="MKKAICTLAALFTLSLTTFAQNKAQTPRYESAISPKTEVANVAAV
FT                   TYTGVFVYNFTILLTSPITDPPSCTVSVVTTDAASGRQFEETAIGTASAPSGGYAKCTV
FT                   KIYYSWALGSGGSDMVTGQYSVLGFTTNTVGTTERTASSNVVSFPVPANGTTTTTAISS
FT                   RL"
FT   sig_peptide     complement(671660..671722)
FT                   /locus_tag="Acid345_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            complement(671999..672766)
FT                   /locus_tag="Acid345_0544"
FT   CDS_pept        complement(671999..672766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39549"
FT                   /db_xref="GOA:Q1IUA1"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA1"
FT                   /protein_id="ABF39549.1"
FT                   /translation="MSTHEQFEEVVLYALGSLDATQKQAFEAHLQACASCRRELQSVQE
FT                   DLGLLAMSASGPRPPGRSRERLLAAMTNEPKRIARPQTVGKGWMWIPWFTTLAFALAAA
FT                   LMFFTNLRIKNEAAAIRANAQEQEIQLRQAREMLELLKSPDAMRVTLMPANEKPKPQAK
FT                   TIYSMKMGKMIFMASNLPPAPPKKAYQLWLVPMEGAPIPAGTFWPDASGNATMVETSMP
FT                   SGMQPKAFAITLENAEGSKTPTMPIIMSGGAGD"
FT   gene            complement(672763..673290)
FT                   /locus_tag="Acid345_0545"
FT   CDS_pept        complement(672763..673290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0545"
FT                   /product="sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39550"
FT                   /db_xref="GOA:Q1IUA0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IUA0"
FT                   /protein_id="ABF39550.1"
FT                   /translation="MVLIARVRGGDQSSMAVIYDRYSPIVYAAALRILGDAAAAEDVLQ
FT                   EIFMQLWRNPAAFDASRGNLAAWLGVIARHRAIDVLRKRKPQTDFEDVVIASTYDLRKE
FT                   AEQNAIVEKVRAALAEMFPEQRRCMEMAYFEGLTHSEIAAKTGEPLGTIKTRIRSALIQ
FT                   LRKKLGGAGESS"
FT   gene            complement(673563..676058)
FT                   /locus_tag="Acid345_0546"
FT   CDS_pept        complement(673563..676058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39551"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU99"
FT                   /protein_id="ABF39551.1"
FT                   /translation="MDIPKEAQVPVPATTQLKIAAGRGVARNLFALSRYVRLFGLGHSR
FT                   TTEQMESAFQHVRGLIPTVGLTLELTGDRLTVDGIPLEQGPAELAFARFLRQTRRMNLS
FT                   LDETFTIEALEDIISAMAFDAPRDEATPKKMVVAPGEDPRDWLNDPSRLLYFINVALQE
FT                   TAAASASSLHPGPLTEVAAEEIAELLHVLGKFGTSQTEGAALGAARQLQRVGPALVYLV
FT                   RELLAEYSEDHAHPAGDALLLKLGDDIVIRFVLTKLENERIAAAEIPGLLDRLGRQLNT
FT                   LRTMMPSYEEKMARGGIALDSYLETLEQELWSAAPDAAKRMVLLFETPYYVPATCIVPY
FT                   LERLIAHGEELVAGTILRNYGNAVDGRDAEGRRRSAKGVSDLAELYALVVPDYVPKLLK
FT                   SVSRQLMRESDLRMQSLLSAALIRLSYTVQQQRDFVASAAASDALEEIVHRRPVLGMEL
FT                   RPRISVENRLPEYLDEALTANHITDDLVSLLQRYAAPVAQQLCNRFLNSSLREESSRLT
FT                   NLAGRMGEETHQELLRRLQSGSSEDALGAVGLLSSVNPEEVAAILPARTREWTRVQQDT
FT                   LVRQLSISASPKRGTVLLKLLPDLDALIIPGAIDEIGMSGDVDASHSLLDIAMAGESPR
FT                   FSGYSKVKAIEALGRLRAEKALAALNELLQERKVLHWAQPHELRIAALQAMHMIDPERA
FT                   AALTPQMGVSERELSIGPLAVDPSNPFARQRRYQRVFPMKPMTAVATSNAGKAGLDIMT
FT                   LSLGGGKARRQGKMQPGSDVTLQLQLALRKLNSQILVREVMGNEITFEIADIGLSDRSR
FT                   LRHLLLAQSPVAPQPQAAA"
FT   gene            complement(676139..676675)
FT                   /locus_tag="Acid345_0547"
FT   CDS_pept        complement(676139..676675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0547"
FT                   /product="Hemerythrin HHE cation binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39552"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU98"
FT                   /protein_id="ABF39552.1"
FT                   /translation="MLHGIKSLNPTTKNETAVDLLVGCHDRIRNFTSVVRKLAHAEGST
FT                   LEEISTAASSAHRYFTVSLPLHEADEEESLRPRLRENGSAEIVAALNAMTHQHHGIDDL
FT                   VERLIPILVLLSSNPAKLPEVHGEMCSLSKALDEVFRGHLDLEETVLFPAVSNRLSPVE
FT                   QGAMLAEMKQRRKQG"
FT   gene            complement(676769..677308)
FT                   /locus_tag="Acid345_0548"
FT   CDS_pept        complement(676769..677308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39553"
FT                   /db_xref="GOA:Q1IU97"
FT                   /db_xref="InterPro:IPR005819"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU97"
FT                   /protein_id="ABF39553.1"
FT                   /translation="MSFYDNTLYGRDDEMDEFGDSNAFDESLDEDFEDEEEDEEISASE
FT                   PEEDDDMDDEDETEMTSGAPAAAAPAAAETPKPAPAKKALAKKAAAPAAPAKKAPAKKA
FT                   PAKKAPAKKKAAAKKPAKKAAKKAAPKKAAKKAPAKKKAAKKAAKKAAKKPAKKAAKKG
FT                   GAKKAAKKAAKKGKKR"
FT   gene            complement(677608..679524)
FT                   /locus_tag="Acid345_0549"
FT   CDS_pept        complement(677608..679524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0549"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39554"
FT                   /db_xref="GOA:Q1IU96"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU96"
FT                   /protein_id="ABF39554.1"
FT                   /translation="MRIRSFWSLCLLGAMIITTACETDNPKKAATTPPPQATAPTLATP
FT                   QSDAAPATAPVATAAPAGDSVTELIAKAEKEFKAGQSNYAAGHLEAAKDNFDQAFKTML
FT                   SSNLDVHSDERLENEFDKIVESVHELELQALKEGDGFTEQKSEPAPIDEANEVTFPVDP
FT                   NIKAQALAEIRQTRSDLPLVMNDQIAGYISYFSSRAKGTLANGMARSGMYREMIQRVLK
FT                   EEGVPQDLIYLAQAESGFRPLALSRAGARGMWQFMASRGGQYGLDRNWWVDDRQDPEKA
FT                   TRAAARHLKDLYHMFGDWYLAMAAYNSGPLTVQRAVQRTGYADFWELYKRGVLPGETKN
FT                   YVPIIIAITIMSKNPAQYGLTEVQFDAAIQGDSVTIDYPVDLRLVAECVDGSVSTLQEL
FT                   NPSLLRMTTPKDQSFTLHVPTGTKDKFEQNIAAIPLEKRVLWRFHRVQPGDTLASIAHK
FT                   YHVSSDAIAEANDLPDEEVRTDAKLIIPVASSKGSQSASNEGGGYSKKPVSYKVRKGDT
FT                   IASIADDFGVPADKIRRWNHISGDSVKQGRVLHIYKPTGDEEEASSTRSRSSSKKAAPE
FT                   LSSKSQAKSSDEKKQSAMHHTVKRGETLSSIANQYNTTVAELKKYNPNTSKLRPGDVLV
FT                   IRR"
FT   sig_peptide     complement(679462..679524)
FT                   /locus_tag="Acid345_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.995) with cleavage site probability 0.608 at
FT                   residue 21"
FT   gene            complement(679677..680603)
FT                   /locus_tag="Acid345_0550"
FT   CDS_pept        complement(679677..680603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0550"
FT                   /product="peptidase T2, asparaginase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39555"
FT                   /db_xref="GOA:Q1IU95"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU95"
FT                   /protein_id="ABF39555.1"
FT                   /translation="MNASPVLLVHGGAWAIPDDAVEAHERGVRAAAETGWRVLEKGGSA
FT                   LDAVEEAIVAMEDDETFDAGRGSFLNEDGRVQLDALMMDGATLQAGGVGCVERLMNPIR
FT                   AARKVLSDSPHIYFVGEGAERFAEEHGIALCANEELIIERELVRWKDAKKQQFLKVPSE
FT                   FAGPGMDTHDTVGAVALDAQGNIAAGTSTGGTLNKAAGRVGDSSLIGCGGYADNLSAAV
FT                   SVTGWGEPMMKLVLSKWAADRVEMGDAPQTVATAAIERLYTRLNGHGGIILLDSKGRIG
FT                   LAHNTPRMAWAWKRPNAQESGVVVAGS"
FT   gene            complement(680745..681416)
FT                   /locus_tag="Acid345_0551"
FT   CDS_pept        complement(680745..681416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0551"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39556"
FT                   /db_xref="GOA:Q1IU94"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU94"
FT                   /protein_id="ABF39556.1"
FT                   /translation="MMTWTNAVGKACGSLLYKIVDGLSLTRINPNVLTFLGLVINIVAA
FT                   VFFGYARIENQQRMFFYAGLVIFGAGIFDMVDGRVARATNQVTIFGGFFDSVIDRYSDV
FT                   ALFFGLLVYYARANRFLYVVLAAFVMVSSVMVSYTRARAESLIESCKVGFMERPERIVL
FT                   IIIGALFNKMAPVLWVAAVISTVTVIHRVVYTYQQSAILQAAVAKSHEQSSAAETSPVR
FT                   G"
FT   gene            complement(681413..681883)
FT                   /locus_tag="Acid345_0552"
FT   CDS_pept        complement(681413..681883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0552"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39557"
FT                   /db_xref="GOA:Q1IU93"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU93"
FT                   /protein_id="ABF39557.1"
FT                   /translation="MTDHIRQKLQQEIEVLEHELQHELPAELKKAVAMGDLSENAEYHM
FT                   AKQRQEFVRARLGQMKRRMAELSLVNMANIPKDRAAIGSTLKVHDLTKDEKIDYKLVTS
FT                   EESDVSKGLISTTSPIGRALLNKREGDVVEVVTPAGKRELEILKLTTIHDEA"
FT   gene            682130..682690
FT                   /locus_tag="Acid345_0553"
FT   CDS_pept        682130..682690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0553"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39558"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU92"
FT                   /protein_id="ABF39558.1"
FT                   /translation="MGLVVRSAMNNTLSFIVGDKVVYPNHGVGIIEQISSRTIGAAVQK
FT                   CYWLKIKASSLRVMVPFDSVHLVGLRRVVRNGEITKIIEYLSDGKCESNHDWKDRFKEN
FT                   SDKMRTGSLMEVAGVLKSLLLLGQSKPLSFREKKMLERARYLLVSELAMAKSCEEPEVE
FT                   ELLGRALQKCKLRFPEASSIAEA"
FT   gene            682778..683041
FT                   /locus_tag="Acid345_0554"
FT   CDS_pept        682778..683041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU91"
FT                   /protein_id="ABF39559.1"
FT                   /translation="MSGILHVFRTQPDVYQVNYTLGVYSWVRTMPREELEHLLVTPVAL
FT                   EEDFLDKVLDELNAKENITIADVSITENEASALGFEPMPSDA"
FT   gene            complement(683108..684250)
FT                   /locus_tag="Acid345_0555"
FT   CDS_pept        complement(683108..684250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0555"
FT                   /product="protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39560"
FT                   /db_xref="GOA:Q1IU90"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU90"
FT                   /protein_id="ABF39560.1"
FT                   /translation="MEDDPIDFAPQTEDGVPEIPQVALDRSTAEELELRKMQKTQTTCL
FT                   FILALATGLGLAYVAKMVLVVLFVSILVAFVLAPVVDFGVRFGVPRSLASLFAVFLLIG
FT                   VIYGITFMSYSKGVDFMQDLPKYSRRIREVGQRWERRAEAFRRSTQDIVPQSEDDKRAV
FT                   TIRQQSSLSDTVTTALGSVGEIFFTISFIPFLAFFMLSWQEHVRSATVMLFKMENRNTA
FT                   YVTLGLMSSMIRSFLVGNLLVGLFVSVVSMIIFGLLGVPFFYFVGFISGYLSMVPYLGI
FT                   VLALIPPVITGMGVMSLEKLVVIIVSILSLHLFAMNVLYPKVLGKRLQLNPLTVTIALL
FT                   FWGWLWGAMGLILAIPVTAAIKIVLDHVEGFEGYGQWMGE"
FT   gene            684316..684777
FT                   /locus_tag="Acid345_0556"
FT   CDS_pept        684316..684777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0556"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39561"
FT                   /db_xref="GOA:Q1IU89"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IU89"
FT                   /protein_id="ABF39561.1"
FT                   /translation="MKEPSAVHGRILALDFGTRRIGLAVSDPLGITAQGLQTLLRKNKR
FT                   TDLAALRSVIEQNEIREIVVGLPLRLSGADSSSTEKAREFAAWLEKEFALPVHMWDERF
FT                   TSVEANRVLRESEMSIKKRGEAVDRLSAVLILQAFLERRGIDREEPLSS"
FT   gene            685027..686007
FT                   /locus_tag="Acid345_0557"
FT   CDS_pept        685027..686007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0557"
FT                   /product="aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39562"
FT                   /db_xref="GOA:Q1IU88"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU88"
FT                   /protein_id="ABF39562.1"
FT                   /translation="MRKFFSFVLLLVLAVAGWLAWALYLPVAPSEPKFVLLRPGWTTRH
FT                   IARELKDNGIIRSDKAFLFMHILRGERSLKAGEYKFDSPANALNVRDRLTRGDIYVRQV
FT                   TVPEGYNMFDIAQAVEQAGLGTAAEFLNAARQDLFLLKDVDPTAKSLEGYLFPDTYSFT
FT                   RTMSSHDMATAMVHRFKQEAKALNLDSDVHRVVTMASIVEKETAVPDERPQVASVYYNR
FT                   LDKNMTLAADPSVIYAALLNNRYRGTIYQSDLQYDSPYNTYKYAGLPPGPIANPGRAAL
FT                   AAAMHPAQTQYLYFVADAQGHHRFAATLDEHNRNVLAYRRAIAAK"
FT   sig_peptide     685027..685095
FT                   /locus_tag="Acid345_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.934 at
FT                   residue 23"
FT   gene            686150..687082
FT                   /locus_tag="Acid345_0558"
FT   CDS_pept        686150..687082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39563"
FT                   /db_xref="InterPro:IPR025634"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU87"
FT                   /protein_id="ABF39563.1"
FT                   /translation="MRLRPHIQVVAIFSLLLSSSGCLFRSKPVTVRMSDAPLKDATREQ
FT                   LVQQLNEEASKINTMNATVDILASTGGSKKGKITEYQEIRGYVLAERPNYLRMIGLLPI
FT                   VRNKAFDMVTDGDTFKLYIAPKNRFYVGHNQINKPSPNALENLRPQHINDALLLHEIDP
FT                   KDEIAVLEGSNEIIQDTKTKKDVEQPNYILDVVRHDKETDKWFLARKIYFSRTTLKPYR
FT                   QVVYDKNGYVATDASYDDFRPADGTEFPYQIRIWRPQEEYTVTLKIVKLDLNKPMTQDQ
FT                   FALEQPPGSTLVNLDNHVHSANGGAGMGK"
FT   gene            687295..688455
FT                   /locus_tag="Acid345_0559"
FT   CDS_pept        687295..688455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0559"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39564"
FT                   /db_xref="GOA:Q1IU86"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU86"
FT                   /protein_id="ABF39564.1"
FT                   /translation="MRDWGRVPYNREDMMNRMIVSNLVHRPLRSVISIVAIAIEVTLIL
FT                   LIVGLSVGMLNDSRKRTAGIGADVMVQPPNASALSTFSTASVPIKVAGALEKLPHVIAA
FT                   VPVVMSTNTSGSIEVIYGIDLTAGSPYNFDNTGRPFRYIAGGPFQGPNDMLVDDYFASD
FT                   KHVKVGDQLELFNHKFRVSGIVENGKGARKFLPISTLQNLMGVEGKASMFYLRLDNPAN
FT                   ADLVVQEIKNTPGLETYTARSLQAFLSMMTVEKLPGFSNFIKVVVGIAMIIGFIVIFQS
FT                   MYTAVMERTREIGILKSLGANKVYIVRLILRETLTLAVCGIALGIGFSYAARLGIRAKF
FT                   PLMTVQMTAPWIGYATLIAVVGAMMGAIYPAVKAAQKDPIDALAYE"
FT   gene            complement(688548..689606)
FT                   /locus_tag="Acid345_0560"
FT   CDS_pept        complement(688548..689606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0560"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39565"
FT                   /db_xref="GOA:Q1IU85"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU85"
FT                   /protein_id="ABF39565.1"
FT                   /translation="MTGKRRTTEALSVTNPSRPCQRTLPPQHCFRTHRGPVSRLQGIVA
FT                   ENRVQTKDFRPYNTPVVKRLPGILALLALLATVPAFPQPSANDQSLPFGNILKNKLLIL
FT                   RGFYGSEKLEFDADGRALPDARLGFGPTDGTFHVISIHYPPGKVVLEGDLPLLNYHLDT
FT                   NSVSYAEGIVKRSVTIDVPDSTDQNAVEHALWSVFYRPGKSITPSCTAEEKADFAAHMR
FT                   RERERQGKKPKQQAESSGPIPPSGICFPLGEHVLHHVGKTEGVSAPISIHTPDPSFPDN
FT                   APKGVFDDTVNVAAIIDESGRVTTMTVVKSLGLSFDQVAVAKIRTWTMQPALMNGKPVA
FT                   VSVTIEMRFSRH"
FT   gene            689686..690114
FT                   /locus_tag="Acid345_0561"
FT   CDS_pept        689686..690114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0561"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39566"
FT                   /db_xref="GOA:Q1IU84"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IU84"
FT                   /protein_id="ABF39566.1"
FT                   /translation="MSTYFPKGEVARKWFVVDADGQTLGRLASRVARILSGKDNPKYTP
FT                   FIDTGDHVVVINAEKIKITGLKADNKKYYHYSGYPGGMKEEEFLKRLERRPELILETAI
FT                   KGMLPKSKLGKAMGGKLKVYRGADHPHIAQKPEVLANA"
FT   gene            690144..690539
FT                   /locus_tag="Acid345_0562"
FT   CDS_pept        690144..690539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0562"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39567"
FT                   /db_xref="GOA:Q1IU83"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU83"
FT                   /protein_id="ABF39567.1"
FT                   /translation="MAELVQYYGTGRRKSAVARVFLRPGSGEFKVNGKGFEEYFVTEAQ
FT                   RQSAKSPLVLTETIATFNVVANVSGGGVNGQADAVKMGLARALQEFNAELRGKMKAEGF
FT                   MTRDARMKERKKYGQKGARKRFQFSKR"
FT   gene            690743..691648
FT                   /locus_tag="Acid345_0563"
FT   CDS_pept        690743..691648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0563"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39568"
FT                   /db_xref="GOA:Q1IU82"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IU82"
FT                   /protein_id="ABF39568.1"
FT                   /translation="MANITMKELLEAGVHFGHQTKRWNPKMKEYIFGERNGIYIIDLQK
FT                   TLKMFKEASKFVSDVAAEGKLVLFVGTKRQAQDAIAEEAKRCGMFYINQRWLGGLLTNW
FT                   VTVQKSVKRLKELDEMATDGRYELLPKKEVIKLERERKHLQANLAGIKNLNRLPDCLFV
FT                   IDSNKEQIAVKEARKLGIPVVAVVDTNCDPSEVDYVIPGNDDALRAIRLFASKIADSVA
FT                   EGSQLADKSMIESTNVSNAAEVIPQSYIGDDEEHGLAQPTEEAAPVEEEINMEEVLGKG
FT                   VRKQPVSENENVEAAAAEQK"
FT   gene            691759..692175
FT                   /locus_tag="Acid345_0564"
FT   CDS_pept        691759..692175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0564"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39569"
FT                   /db_xref="GOA:Q1IU81"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU81"
FT                   /protein_id="ABF39569.1"
FT                   /translation="MSAEFYPMPMFVRLAVADVEASKQWFHTVLEFESVFDIPHSMAHL
FT                   RGRRYQDVLIVKGEVPEQVGQGVTLSFSWKEPVDEIVPRLKAAGGKIVDGPVDRPWNAR
FT                   ELVIEDPNGYRMSFSRQLANKEFGEVMSGVEADK"
FT   gene            692277..692936
FT                   /locus_tag="Acid345_0565"
FT   CDS_pept        692277..692936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0565"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39570"
FT                   /db_xref="GOA:Q1IU80"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IU80"
FT                   /protein_id="ABF39570.1"
FT                   /translation="MNISAAQVKDLREKTNAPMMDCKKALTEANGDIEQAIVILRKKGI
FT                   ASAAKKAARVTSEGSVVSYIHAGGKIGVLVEVNCESDFVARTEQFKELTHDIAMHIAAS
FT                   DPKFVRKEDVTPEYMEKEKEIYRDQAAKTGKPAPVIEKIVEGKMAKFYEEVCLLEQPFI
FT                   KEQTISVGQLIATTIGKLGENISVKRFARFKVGDVGETVAISKASNEGEAEAPAAK"
FT   gene            complement(692983..694167)
FT                   /locus_tag="Acid345_0566"
FT   CDS_pept        complement(692983..694167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0566"
FT                   /product="protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39571"
FT                   /db_xref="GOA:Q1IU79"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU79"
FT                   /protein_id="ABF39571.1"
FT                   /translation="MRTQLRAGILFPPCLPCSHLARNAICRIQTNGERVIDLLDRRAVR
FT                   VLTTVLVFAAVLAFIYVAHKTLILFLFALLFAYLLEPVVSRLAGWMRNSRGLAILIVYV
FT                   LLFVAVTIAGALIGPRIFSEGQKLGQQLPDLYDKVASGNIAFTLGSRHGWSAETSQRLK
FT                   TLLVSHQDEIVSAISSAGTRTAAMLTNIGWIIIIPILGAFLLKDKRDLRLSLQNIVGEP
FT                   RKREFFGQLITDVDAMLSQFVRAQLLLAIISGLVYTAALSVLQVPYAYILGAVGGLLEF
FT                   VPLVGPAIAAVGIVGVCFGTPNFHHTLWVVVFLGVWRLLQDYVISPRLLGGKVELHPLL
FT                   TIFGVLAGGEVAGVLGIYLSVPVMATIRILFIHWHRYRASAELASDTAPVLVEK"
FT   gene            694213..694716
FT                   /locus_tag="Acid345_0567"
FT   CDS_pept        694213..694716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0567"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39572"
FT                   /db_xref="GOA:Q1IU78"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU78"
FT                   /protein_id="ABF39572.1"
FT                   /translation="MSEPVKQVIGIYPGSFDPVTNGHLDLIHRGAKIFDELVVAILRNP
FT                   EKDPLFTVPERREMLQEMTKNLPNVRVDEFQGLMVDYARSQGAAAVLRGIRAISDYEYE
FT                   FQMALMNRKLDSTLETIFMMPAEKYSYLSSRLVREVARLGGSVDGLVPEMVVQKLVLKV
FT                   KGTK"
FT   gene            694732..695931
FT                   /locus_tag="Acid345_0568"
FT   CDS_pept        694732..695931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0568"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39573"
FT                   /db_xref="GOA:Q1IU77"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU77"
FT                   /protein_id="ABF39573.1"
FT                   /translation="MSSATSQLTLSPAARMNRIEISATLAVVNEAEKLRSAGVDLVDFG
FT                   AGEPHFGTPQHIREAAIAAIHNNFSKYTAVAGTAELRDAIAKRHATDFATDYKREEVIA
FT                   SVGGKHALFNAIQVLVDHGDEVIIPVPYWVSFKDMVQYSGGKPVFVEADESQNFRLTAA
FT                   MVEKAVTPKTKLIILNSPSNPSGAVMAPEDMKSIARFAYERGIWVISDECYVYLNYTGE
FT                   EFSLGSLTEVKERLLVVGSLSKTYAMTGWRLGYTLAPAAVVSQMQKLQSQSTSNPTSIV
FT                   QKAAVAALNGPQECVAEMRADYIKLRDEIVSGLRSIPGVKCTMPQGAFYAYPDISCAFG
FT                   KAGMNSAADVAKKLLHEAHVVSVPGEAFGTTKHIRLSYAASHENVARGLERMHKFFASL
FT                   "
FT   gene            696042..697019
FT                   /locus_tag="Acid345_0569"
FT   CDS_pept        696042..697019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0569"
FT                   /product="mannose-6-phosphate isomerase, type 1"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39574"
FT                   /db_xref="GOA:Q1IU76"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU76"
FT                   /protein_id="ABF39574.1"
FT                   /translation="MADLHPFLLAPEFHERIWGTRDLRPIYTRIVGDNPIGEAWLTGEK
FT                   CKVASGPLKGETLETLCKRFGAALTGNKAKPADRFPLLAKFLFPHEKLSVQVHPDDARA
FT                   QAIGQPWGKTECWYVASAEPGAQVMLGFKAGVTKQEFEQAIHEKRAEHLLNAVPVQTGD
FT                   MIYVDAGTVHAICPGAVIIETQQNSDTTYRLYDYGRPRELHVEAGLASTKEKTHAGKVK
FT                   VSRNGNHDVLIASPSFCVERYSLKSPLKMSAEERGASVQVLVSEKGTGVLHHAGIEPIA
FT                   FTPGEAVVVPAECDEFEVQPQWECELLRMNLPAHAVPEPTTTLL"
FT   gene            697016..698131
FT                   /locus_tag="Acid345_0570"
FT   CDS_pept        697016..698131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0570"
FT                   /product="mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39575"
FT                   /db_xref="GOA:Q1IU75"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU75"
FT                   /protein_id="ABF39575.1"
FT                   /translation="MKKSKANFYPVILAGGRGTRFWPLSRKRMAKQLLPLNSDKSMIQE
FT                   TVERLSALAEKKNFWVVTNDDLLVPIAKQLRALPIKQLIAEPVGRNTAPAIGLAAFILE
FT                   RLDPSAVLGLFPSDHVTSKPEAFKKDIAKAVQIAAAGENIVVLGIKPTRPETGYGYIEV
FT                   GEQYERGVMRVRRFTEKPNAEKAAEFVESGHYFWNSGVFVWGAKTLANALREHLRETAP
FT                   FLEKIAASYGTKEFAKTFAKLYPKCENISVDYAVLEPRSAKGEKSSNIFCIPADWGWND
FT                   LGSWAALFEHRAAEQQLSEHENVLTSKGAFTHDAGGNFVHSPRKFIAVVGVKDLVVVET
FT                   DDALLITTRQKSQDVGKVVKFLDEKKLKNLV"
FT   gene            698134..699552
FT                   /locus_tag="Acid345_0571"
FT   CDS_pept        698134..699552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0571"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39576"
FT                   /db_xref="GOA:Q1IU74"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU74"
FT                   /protein_id="ABF39576.1"
FT                   /translation="MPQQIKFGTDGWRGLIADDYTFENVRRVAHAMAHYIHKHEDASKG
FT                   VYVAYDTRFGSRRFAEAASEAMASTGLRVKLADDYTPTPALSYAIKKFGAAGGVMITSS
FT                   HNPANWNGVKYKAKYGGSGTPTIMKQIESYLDAPVIMKSGGKVEAFDFKAPYFEVLKSF
FT                   VDLDAIAKANFRFCIDVMYGAGRGVLSKIFSERGISHVEIRGEVNPLFPGINPEPILPH
FT                   IAALQEATVREKAHAGLATDGDADRIGAVDERGRFVDAHKCFAVILKWLLEKKQWPGAI
FT                   TRAFNTTSMLDRMAKKHGRELVEHGIGFKYVCDVVLSGKEVLVGGEESGGIGIPRHLPE
FT                   RDGILNSLVIANVMANYGMSLGQLVDSLQAEYGEHHYGRIDMHLDNAVKEDAMRRAGER
FT                   PAKIGKLQVSRIEDMDGMKFFFETPNNGNGADAWVLIRASGTEPLLRVYSEASSPEMVQ
FT                   DILGEAEKFVHRRA"
FT   gene            699667..700836
FT                   /locus_tag="Acid345_0572"
FT   CDS_pept        699667..700836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0572"
FT                   /product="Ste24 endopeptidase"
FT                   /EC_number="3.4.24.84"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39577"
FT                   /db_xref="GOA:Q1IU73"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU73"
FT                   /protein_id="ABF39577.1"
FT                   /translation="MNTVSTLKPDSLEARRYNRLKRWLEVSDLIVGFVLLLALVLTHGS
FT                   ARLRDLAYLASRQYYSIAVFMFVLFLLLISKVLSLPIDYYGFRLEHEFKLSNQKPGAWL
FT                   WDELKGWLVGLVILTILVEVLYATIRLYPDYWWLVVWAVFIGFTVLLAQLAPVVLFPIF
FT                   YRFEPLKNDALRERLVKLGEKAGTKVRGVYEWKISEKSKKANAALTGLGKTRRIIIADT
FT                   LLENYSDDEIEAVLAHELGHHVHGHIAKGILVQVGITFVGFWASHIILRYVVDQRQMFQ
FT                   SMSDFANLPLLALIAAVLGLVLTPVLNAYSRYNERQADSYAWKSIPSVEPFVTSMHKLA
FT                   SQNLAEENPARWIEVLFHSHPTIAKRVEAAEKWRERQAVPPSETPATSV"
FT   gene            complement(700906..701694)
FT                   /locus_tag="Acid345_0573"
FT   CDS_pept        complement(700906..701694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0573"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39578"
FT                   /db_xref="GOA:Q1IU72"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IU72"
FT                   /protein_id="ABF39578.1"
FT                   /translation="MPPRVSRFNLPEPAPRVETGTVKAIAVIPARIASTRLPRKILREI
FT                   DGRTMLDRVYNAAKGAPMLADVIVATDSQEIMDVCNRHGWNARLTSDQHRSGTDRVHEV
FT                   AQTVAADVYVNVQGDEPLARPEHLNTLLELMRDETVQVGTLKTPCGKEDVANPNAVKVV
FT                   TDKTGRALYFSRSTVPYDRDNRGDIAYFKHLGFYAYRKPTLDRFCGWPESSLERSERLE
FT                   QLRFLENGVDIYVAETPYDTIGVDTEADLKRVEEILRSRN"
FT   gene            701716..703608
FT                   /locus_tag="Acid345_0574"
FT   CDS_pept        701716..703608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0574"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU71"
FT                   /protein_id="ABF39579.1"
FT                   /translation="MKKHSPSQDGITRRDFLNSTLLASGAMLLNQVTPAELLAQQNGDD
FT                   FTGYGGVGDYANSNGNTEAILKAGHGIRDGAYDTLKDVADTGETFDCLIVGGGISGLAA
FT                   ALLFQRGTQNQCTSLVLENHPIFGGEAKQNELEVDGQRLTAHQGSAVFWVPYPYSFIGR
FT                   FYDSIGLRAPRFEYQRWGSKEPEIPLSKTPYDMSGEMPKTYGFYFGKKFGGSGTWLIDP
FT                   WGKKLEGAPITAQQKADLLEWRNGHHHRPKPKYHGDPITRQLDSITLEEHMMQRFGISR
FT                   ETIRTLLSPVEGGGSGLGPDALSAYAEYAADFLYPLPEDDADQMFPGGNTGIARHMMKT
FT                   LAPDSITGAATIEGVQRGRVNFAALDRKDQKARVRLNATVVSVEHEGAAEKSKAVLVTY
FT                   LKDGKLYRVRARSVVVAGGCWTAKHIVRDLPATHREAYDQFYRSPCLMANVAVRNWRFL
FT                   YKMGVSGCRWFEGLGNYMEVRKLPVFGAPSATIGPDSPTVLTLKCLYSYPGLPTQEQGI
FT                   RGRTEMIGTSFHQYEQQIRDQFNEMFGHVGFDAKRDIAGIILNRWGHAYLNPQPGFFFG
FT                   KDGKPAPSEVLRAAPFGRIAFANTDLAGIMDHRTSIIEADRAVRQLLDHVITQS"
FT   gene            complement(703611..704447)
FT                   /locus_tag="Acid345_0575"
FT   CDS_pept        complement(703611..704447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0575"
FT                   /product="Polyphosphate:AMP phosphotransferase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39580"
FT                   /db_xref="GOA:Q1IU70"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU70"
FT                   /protein_id="ABF39580.1"
FT                   /translation="MKFSKELAVPPHKKVRLKDYDTCETLGYETEHEKGDDNDKVDVLM
FT                   EKTIRRLDDLQYTLYAEGKRSVLIVLQGMDTAGKDGTIRHVMSGASPQSCKVTSFKVPS
FT                   TRERLHDFLWRIHQATPENGEIMIFNRSHYEDVLVVRVHDLVPKKVWEDRYDEINRFEK
FT                   YLTENGTTILKFFLHVSKGEQKKRIEARLADPSKHWKLSEADLKEREYWDDYTEAYEAA
FT                   LGKCSTKYAPWFIIPADHKWFRNLAVSKIIVEALEDMDPKYPTPQIDIARMKRLLK"
FT   gene            704565..705704
FT                   /locus_tag="Acid345_0576"
FT   CDS_pept        704565..705704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0576"
FT                   /product="aspartate-ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39581"
FT                   /db_xref="GOA:Q1IU69"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU69"
FT                   /protein_id="ABF39581.1"
FT                   /translation="MATTLSKVADLAGPGIGNYTELEKILPKDYHSLLDRKQTQKAIYA
FT                   VKTYIEEHLCQELNLIMTSVPLIVDMESGVNDYLDRDGSRTPITFHIPNDHDVHPIDAQ
FT                   VVQAATKWKRMALKQFDMKPGEGLCTDMHAVRKDYFLDHDHSVYVDQWDWERTITAQQR
FT                   SLEFLKTIVSKIWTVIVGAERFALNKFPELNDPRCPKLPEKLTFLHAEDILEMYPDLPR
FT                   KQRETMILQKYPAVFIIGIGWTLKDGYPHEMRAADYDDWVTETESAEGKMMHGLNGDIL
FT                   VWNPVTKRRHELSSMGIRVNAETLKQQLKATNQEHFLNFPYHKAILDGTIPLSIGGGIG
FT                   QSRTLMQILRKAHLGEVTVSVWPKILKEICAKKNIFVLE"
FT   gene            complement(705756..706727)
FT                   /locus_tag="Acid345_0577"
FT   CDS_pept        complement(705756..706727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0577"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39582"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU68"
FT                   /protein_id="ABF39582.1"
FT                   /translation="MKYRTFGRTGFEISDVAYGLWGMSGWSGSADEQSLSSLQMSVDLG
FT                   CNFFDTAWAYGNGHSDELLGQIIARNANKRLYAASKIPPKNDRWPATPEYKYQDVFPAD
FT                   HVFHYANAIREKLGVNSIDLLQYHVWDDSWTDEPEFRSTVEKLKSDGIIRSFGLSLNRW
FT                   EPANGIKAIRTGLVDAVQVIYNIFDQNPEDELFPICDEFDVGVIARVPLDEGSLAGHLT
FT                   LDTKFPEGDWRAGYFGPENLAPTVERVEALKKILPEGMVLPEMAIRFILSNPTVSTTIA
FT                   GMRKPEHVKHNISDSDAGGLNPALLAELKKHRWDRLPTPWSD"
FT   gene            complement(706761..708002)
FT                   /locus_tag="Acid345_0578"
FT   CDS_pept        complement(706761..708002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39583"
FT                   /db_xref="GOA:Q1IU67"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU67"
FT                   /protein_id="ABF39583.1"
FT                   /translation="MPPTSRRILQYLLSLLLVALVCGLACSHRFYIESIVSAYFAAALA
FT                   GAAIIYACIRRPKELIHVVAVALVLWALEYGIAGTRAAGIFLVVPTISLVGLAAFLVLG
FT                   LRAIWSQGDEQRMLLYAFIPAVIFAGSDWFASELLAITEKLHPQVFDYYLFSFDASLIW
FT                   QASPEMGKIFATYTWFRISSTIVYVGLALPIALVYGLNLRRRGGAALPVMYAFLLTGPI
FT                   GVIFYNLLPAMGPAHVFGASFPFYVPDFTQAARLVPTVVTLPGPRNAIPSLHMGWVLLA
FT                   WWNSKGLHWFWRAIVLYFVLFTVCATLGTGEHYLVDLIVAYPFALLLQAISKTSLPIAD
FT                   RQRWVPLVASVATILLWFALLRFDNHVFWLSPSIGWLMSLVTIAGAIGLHYWLQMDPTQ
FT                   IAGEQPALSSAVAE"
FT   sig_peptide     complement(707919..708002)
FT                   /locus_tag="Acid345_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.978) with cleavage site probability 0.823 at
FT                   residue 28"
FT   gene            complement(708066..709859)
FT                   /locus_tag="Acid345_0579"
FT   CDS_pept        complement(708066..709859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0579"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39584"
FT                   /db_xref="GOA:Q1IU66"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU66"
FT                   /protein_id="ABF39584.1"
FT                   /translation="MPTTHRTQRRSVLIVLVLFAAAATAFAQTPLIANIHARQITDLSG
FT                   TWSTIIDAYHVGERNRFYEDRHQTDPSELIEYNFDHSPTLKVPGDWNSQRPELFLYEGT
FT                   LWYRRIFSYHPAQGKRQFVYFGAANYHATVYLNAQKLGEHSGGYTPFNFEVTGKLKDGE
FT                   NLLVVEVDDRRSKDAIPALNTDWWNYGGLTREVSLVEVPSAFIENYFIQLAKGSPNEIA
FT                   GWVQLNSAAGGSEVTIEIPEAKLRQSAKADEHGRAAFRFPAQLTPWSPDNPKLYEVRIS
FT                   SGTDHLTDQIGFRTIEARGTKLYLNGKPIFLRGISIHEEAPFRGGRAFASEDDKTLLGW
FT                   AKELGCNYVRLAHYPHHESMVREAERMGILVWSEIPVYWDIDWKNPDSLAQARQQLHEE
FT                   IARDQNRAAIILWSIANETPIDPDRLEFLKALASDVRSLDNTRLLTAALNRTGREGKTR
FT                   LIDDPLGAVVDVLAINEYIGWYESRVEDADTTEWKSSWEKPLLFSEFGGGAPYGRHGAT
FT                   NERWTEEYQANLYRHQLTMLRKIPALAGLSPWVLMDFHSPVRLLPGVQDMRNRKGLVSD
FT                   QGQRKQAFYVLQEYYREMGAH"
FT   sig_peptide     complement(709776..709859)
FT                   /locus_tag="Acid345_0579"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            complement(709948..710877)
FT                   /locus_tag="Acid345_0580"
FT   CDS_pept        complement(709948..710877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39585"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU65"
FT                   /protein_id="ABF39585.1"
FT                   /translation="MQRVPPIGGELGPLADTFAEDFMKKVLGLMVAVSLLAWTLGCASS
FT                   KQLGPLNHGGGSGGGGGNGTVASGNWAFVGSGTNGPMHIGGSLTGSGTSVSGDMFVVGG
FT                   NGYAIGNSTGPMTVSGSVSNGTLTMTGVIGSSTITLTFTDVTSSGATSLPNGTFSVVGG
FT                   TDAGDSGTMTGVMASSFSGTWQGNEPVTTGLVSVEFTQASTATSTGGRAGSYPLTASGT
FT                   GVVFSGIAGCTVTGTLDSALSFTAGDIVYLKIDTTDNIIAGHMIYLGFANDPTAPSMIS
FT                   GGGYVYAGGTNCMLQNDNTQHPLSLTKQ"
FT   gene            complement(711015..711647)
FT                   /locus_tag="Acid345_0581"
FT   CDS_pept        complement(711015..711647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0581"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39586"
FT                   /db_xref="GOA:Q1IU64"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1IU64"
FT                   /protein_id="ABF39586.1"
FT                   /translation="MVALTRRQREMYDFLCSFTDSHGYSPSFEEIAEGMGLSSLATVHK
FT                   HIGNLESKGLLKRDYNRARSIEVLRPKGQLKKSMAAAAAVATAGLPFLGRIAAGQPIEA
FT                   IENPETISLGDFTGSKEVFVLQVSGESMQDEHIVDGDYVLVERINTARDGEIVVALVEN
FT                   SDTTLKRIYREGETVRLQPSNAKMQPIRVPAGSVQVQGRVIGVLRKY"
FT   gene            711988..712344
FT                   /locus_tag="Acid345_0582"
FT   CDS_pept        711988..712344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU63"
FT                   /protein_id="ABF39587.1"
FT                   /translation="MNLESNAAKTIAALAVLNIGLFFSHHVPVKAIYTPTVQASVVSQR
FT                   AEMCKVRTEARLAAMEARLQARAAAREMVRARRQVKQATVMAPNATPTKCNMSVTDYVR
FT                   GIVSSGMRTLASGI"
FT   gene            712481..715093
FT                   /locus_tag="Acid345_0583"
FT   CDS_pept        712481..715093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0583"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39588"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU62"
FT                   /protein_id="ABF39588.1"
FT                   /translation="MPKVHPVKMSDISKHLEKAEKYLQKGKHEDALEEYLQVLDEQPSN
FT                   QGVRQTAAELCVSLGRTSDAATMFGQIFDSQCSIGDNARAVITYKKLVRVGKPSLQQML
FT                   QFAHIQERTNRKEALEAYVNLGSEYRTAGKLSDLLEVYRRISSLDPSIENYAQEGDLAA
FT                   ELDDPKTAAVSFVQAGILVEKSGGDASEWYEKAYHYDPTNPGAAFGHGHALLLRGEAEE
FT                   AVTILEPLANYPSSPIEAREAYARALLLAGHLEKAEPVVWKLYEFDSRKLDDILELIGD
FT                   YVDLQKTDNALRLTKKLEEQMSKTGRRREFVQIMQEMLEQKSPSIEFLYYMVELYNSNN
FT                   REHDYCHTLLRLFELHYAAGEFLRAGDCLDRAAEVDPYEPGHTNRIEMLRGKLEDNRFN
FT                   AIANRFGSVIKVEQQGGQSSNNNNISTHAASDNETTVLEDLILQSEIFMQYSMRSKAVE
FT                   RLERIHKLFPHEEERNEKLRSLYNNAGFFPQYSDHPSAQQMVVAPVTRGVDQQPAPPIP
FT                   NAVAAENSVDNISRVTEITRNIYRQGNVKAVLFASVNDIGRHWNSSRCVAGLCSPGKPP
FT                   SAALEYCAPGIPQSDVAAIVKLIGVLHPLAVAMGMVSISNARSAHELAPVHDVIETLGI
FT                   ESLLAVPLSEGDEQAGILILQQCTPRLWGQTDVVVLRTIADQMVLAVHNARLRSLVKNL
FT                   AVTEEKSGLLKRSSYLDVLLSEVKRALQANAPVTLMLVEIGKAAGLIRDVGEAAVDSVL
FT                   QQVGQVVQAHLRQNDVPVRYDLTQIAIVLSDTNDKNAFFVADKLRKVLGGTKIPGRDQA
FT                   LPISIGIAEAVMNPHYDPVDVVTEVINRLESALEAAKASGGNKSHSIAPAFLTAAAGD"
FT   gene            715120..716067
FT                   /locus_tag="Acid345_0584"
FT   CDS_pept        715120..716067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0584"
FT                   /product="Thiamine biosynthesis enzyme ThiH-like
FT                   uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39589"
FT                   /db_xref="GOA:Q1IU61"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU61"
FT                   /protein_id="ABF39589.1"
FT                   /translation="MSSVTMKPAVHPFRTDDPRLQTIHEKVLAGKELDLNDVTVLFASK
FT                   DILAIGWLANYMREQMHGHATQYGVDTMAFANGAESGEAAEFVVLGSDVDRVGAAVANL
FT                   RKHSASAVVSAMTVEQIAGNSAKGTLQKLRDAGVSSLLGSGAELFLPAVRKVIWNTTNT
FT                   AEQRAEARSLAAEARIQVPAYVVQRTASPEQQARELLSFRNVQAKAFSSISFDPDATTD
FT                   LNLVMTTGMQEMKQIAIARLALGHIPHVRAYLQMLGGKLAQIALRFGASSLDGTLLDAS
FT                   EPQAARAAELAREITVAGREPHELSTVRRLIVTA"
FT   gene            complement(716064..716339)
FT                   /locus_tag="Acid345_0585"
FT   CDS_pept        complement(716064..716339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU60"
FT                   /protein_id="ABF39590.1"
FT                   /translation="MSTDPDAKKGAVEQDRPDQPTNTSLSGQNPHRNKGKALQGQDTDL
FT                   PEPGENEEHSMEGSFKKNPEGELNDQDPGERQKRNQNDQREDPLAS"
FT   gene            716784..717107
FT                   /locus_tag="Acid345_0586"
FT   CDS_pept        716784..717107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0586"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39591"
FT                   /db_xref="GOA:Q1IU59"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU59"
FT                   /protein_id="ABF39591.1"
FT                   /translation="MSSPGPLYRPFDRLVHIEISGRVFEVPENNTLLRALQYLSPEDVA
FT                   MGRFCWNEDCQYCRVSYDTGEGTAKRAALACKVGVQDGMRLQELSLELRYCLRALKLPS
FT                   VTE"
FT   gene            717150..717713
FT                   /locus_tag="Acid345_0587"
FT   CDS_pept        717150..717713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0587"
FT                   /product="sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39592"
FT                   /db_xref="GOA:Q1IU58"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU58"
FT                   /protein_id="ABF39592.1"
FT                   /translation="MDSGGNVLAVRFWTKTSDETALESCVREHGQMVYRIAFSVLRNPH
FT                   DAEDAAQETFLRALRSGRVEDVNDSRAWLAKIAWRIALDHRRPEDLELSAIVEPASGAV
FT                   NAESSLLAGERTKILHELIISLPRDLQDVVTLSTVQELSGTDVAAILGIPEASVRTRMH
FT                   RARELMKEKLQSRYGTKSARGETR"
FT   gene            717710..718228
FT                   /locus_tag="Acid345_0588"
FT   CDS_pept        717710..718228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39593"
FT                   /db_xref="GOA:Q1IU57"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU57"
FT                   /protein_id="ABF39593.1"
FT                   /translation="MIETRDRFDGWLDTALAEYSNVEPTLGFESRMLAAVRGRKQRAVW
FT                   MWSTGLAAAAVVVISFLTALNQPVPSAPPVVSARISVPAIERVTAQAAAEPKQRKTRPQ
FT                   DVQTSIRGVPVVASPFTPQEEAVLRLVRNSRAKQLAGLVAQPRDLSKEVDLLQFKEMEI
FT                   PVLGREEEQ"
FT   gene            718225..718716
FT                   /locus_tag="Acid345_0589"
FT   CDS_pept        718225..718716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39594"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU56"
FT                   /protein_id="ABF39594.1"
FT                   /translation="MIRRTALIAAVFLFVVGGFAQEAKTDQHAKYKLDFVLKQMDRGKP
FT                   LSTHNFTMSAEASGGSSQIRTGNRIPVDIGGDKGLQYMDVGFNCDARIIQSGSSNVGLE
FT                   VGWEISTMPGTSGSEKMVRQVRSRSTPLVTFGKPTVVSSVDDINSGQQFELDVTVTPES
FT                   "
FT   sig_peptide     718225..718287
FT                   /locus_tag="Acid345_0589"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.845 at
FT                   residue 21"
FT   gene            complement(718780..719664)
FT                   /locus_tag="Acid345_0590"
FT   CDS_pept        complement(718780..719664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0590"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39595"
FT                   /db_xref="GOA:Q1IU55"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU55"
FT                   /protein_id="ABF39595.1"
FT                   /translation="MRIRHVVLGSALVAVTFLPAPSFGVSKEIIQLQTQVQQLQDQMTA
FT                   MSTTFNERMGVIRNLIEQSTDNMNKMTQQMDTLTRTLQQQQQDGGNKADQLSGQIQSLH
FT                   DSVDELKARVAALSKKLDDMSQQSQNLNANAGNMPNNGGGNGGGGGGAPVANQAPPADV
FT                   LYNNALRDYNAGKYDLASGEFGDFMKFYADNDLAGNAQFYIADIEYRQGNFDNAVKDYD
FT                   KVLEQYPSGNKAPAAQLKKGFALLELGQKDAGVRELRSLINRYPRSIEAQQARDRLARL
FT                   SGGAAPATKRKPS"
FT   sig_peptide     complement(719590..719664)
FT                   /locus_tag="Acid345_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            complement(719798..720523)
FT                   /locus_tag="Acid345_0591"
FT   CDS_pept        complement(719798..720523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0591"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39596"
FT                   /db_xref="GOA:Q1IU54"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU54"
FT                   /protein_id="ABF39596.1"
FT                   /translation="MKWAMMVVVLAMMIVGSACSNKKPTPPPAAPPPPPAPAPTATITA
FT                   NPNTVNAGQPTTLTWQTTNATDVTIDVLGSVDPNGSKQVTPVESTTYHLVAKGSGGTQD
FT                   ATARVTVSGGGASQPDEISLSDQQAFAKYVKDIYYDYDAYTVRAADQAVLQANANFFKQ
FT                   HPNIHFTIEGHCDERGSTEYNLALGDNRASAAKNAIVQAGIPASSVRTISYGKEKPFCT
FT                   ESNEQCWQQNRRAHFVISK"
FT   sig_peptide     complement(720455..720523)
FT                   /locus_tag="Acid345_0591"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.991) with cleavage site probability 0.509 at
FT                   residue 23"
FT   gene            complement(720670..721986)
FT                   /locus_tag="Acid345_0592"
FT   CDS_pept        complement(720670..721986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0592"
FT                   /product="TolB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39597"
FT                   /db_xref="GOA:Q1IU53"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU53"
FT                   /protein_id="ABF39597.1"
FT                   /translation="MLRKLFLPALLLIASLPLTAQTDWIKTGTNLGVEKVRLAVPDFKA
FT                   GQGSESLSAAFDQTLWNDLYQAGLFDLVSKSFNPTQAPGQPSEVELNTWGAPPPNASML
FT                   AFGNINVANNEVTVQGWLYDVKNPQTPQVLGKQYKNGATVENTRLIAHKFADEIIFRLG
FT                   GGIQGIAESKIYFISTRTGHKEIWAMDYDGSNQKPITHLGSIVLSPRASPDGARVAYSW
FT                   MTNGWEIGIYSTELGRSVNFARLGGTNSAPAFSGDGNRLAFSSSRSGDPEIYTSDISGA
FT                   NLKRLTNVKGPDTSPTWNPKTNAQIAFVSGRTGLPQIYTMDVDGSNVIKMTDQGYAISP
FT                   SWSPNGQFLVFAWTRHYGPGAPGAQDIYIMDVASHQWVQLTHDGGRNDFPSWAPDGRHV
FT                   VFQSSRSGREEIWSMLADGSQQTQLTNSGANSMPNWSSK"
FT   sig_peptide     complement(721924..721986)
FT                   /locus_tag="Acid345_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.935 at
FT                   residue 21"
FT   gene            complement(722111..722914)
FT                   /locus_tag="Acid345_0593"
FT   CDS_pept        complement(722111..722914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0593"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39598"
FT                   /db_xref="GOA:Q1IU52"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU52"
FT                   /protein_id="ABF39598.1"
FT                   /translation="MAVRAEIFEEHERWAPSLVASTVMHVGLTAVIVFTGWANFHHPGE
FT                   NWGGDTSGGGGAMSATLVSAIPLPRPVEETQNVLANDSKGLTQTTPAVKETPPPEAIAI
FT                   PDKQAKTKPQKAPPAPRDVKKPKPVEEAKNNEIPYGEGGPASAMYSNAGTNFAMGTTKG
FT                   GISVGQGGDFGNHYAYYVDAVRRKITENWLRYEIDPHTPPGKRTYITFDINRDGSPSNI
FT                   RVEQSSGIPSLDISATRALQRIDTFGPLPGGYSGNKVSVEFYFER"
FT   gene            complement(722898..723329)
FT                   /locus_tag="Acid345_0594"
FT   CDS_pept        complement(722898..723329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0594"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39599"
FT                   /db_xref="GOA:Q1IU51"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU51"
FT                   /protein_id="ABF39599.1"
FT                   /translation="MAFTNSQGRTQSSLSDINVTPFVDVVLVLLIMFMVTAPVLQSGID
FT                   VAVPKTKTVKEITEERLVISIDKQQRVYFGNEPVNIHDIPQKIREKIRDPRGQAIFLRA
FT                   DESVPFGAFATVMDAVKQSGVSNVSIVTQPLSEKNGSTR"
FT   gene            complement(723330..724037)
FT                   /locus_tag="Acid345_0595"
FT   CDS_pept        complement(723330..724037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0595"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39600"
FT                   /db_xref="GOA:Q1IU50"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU50"
FT                   /protein_id="ABF39600.1"
FT                   /translation="MAIHLLAFAQSGELTSLFSNTGLVARAVLLILMLFSLFSWSIVVA
FT                   KWSLFRRAKVQSGRFVRAFRKAQRMQDVAAVAEQFKPSPLVSVFEGAYEELRRQGPRLN
FT                   VTSIQRSTQIAASEELTRLERRLPWLATTGAVTPFIGLFGTVWGIIDAFHGLGDAGAAT
FT                   LRAVAPGISEALITTAAGLFAAVPAVIFYNMYMNNIREFGARMDDFSLELLNTVERGSN
FT                   APAPQRGVEVVER"
FT   gene            724268..725986
FT                   /locus_tag="Acid345_0596"
FT   CDS_pept        724268..725986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0596"
FT                   /product="DNA replication and repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39601"
FT                   /db_xref="GOA:Q1IU49"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU49"
FT                   /protein_id="ABF39601.1"
FT                   /translation="MLSCARNKGIRVLLELRVENYAVIDNVVVEFAPGLNLLTGETGAG
FT                   KSILIDALTLLLGDKASADVIRHGTDKAVVAAVFEAEPGGIAPVLEENGLDAEGDQIIL
FT                   RREITANGRGRVFINNQPATVSVLKQLAPHLAVIHAQNAAVLGFDPASRLALLDSYAGA
FT                   DLHPTTEAHAKWREITARIADLERDEQDRLRLLDLWKFQREEIDQADLKPGEDEALEAE
FT                   KRVLANSERVFSAAMGAFDHLYEAEGSASEQLKAAAKQLEDLARLDEKFREQAAAVESA
FT                   RITIEDIGVSLRDYAEGIQASPERLAEIEDRLALLDRLKRKYGKALDEVIAYGADLARK
FT                   LNEMENKDEVLRVLKKDLAKAAEAYLDAARTLSRKRYDAAKKLEKMVETEVNDLAMKAR
FT                   FKIEIGGTDEESNWTASGFDQVAYMISANPGEPLGPVEQIASGGELSRVMLALKASVEA
FT                   GKSRSKKDPAHQRTLVFDEIDTGIGGRAAEAVGKKLKALSKTKQVLCITHLPQIASFAD
FT                   HHYLIEKKEASGRTKTTVRPLDLEDRTEEIARMLSGAKLTETSLKHAEQMLKANG"
FT   gene            726181..726801
FT                   /locus_tag="Acid345_0597"
FT   CDS_pept        726181..726801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39602"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU48"
FT                   /protein_id="ABF39602.1"
FT                   /translation="MDWAKFVTEKSREAAVLELDQVAAEVGVDVDVARQGLLRQEQRGL
FT                   VEHLGKGIFLIRTSRDTSGRELINQFRPDAYLSLESVLRESGVSTQSPKYLTCITTGRR
FT                   GEFRSKSFAVVYKHISPKLFWGFHEKRTLYGSYKVANPEKAILDWIYLARQNGQPADTD
FT                   EFEISQIDRGKLLDYSLKYPKPVQQQIKDLLADFAAGRSGSPT"
FT   gene            726933..728762
FT                   /locus_tag="Acid345_0598"
FT   CDS_pept        726933..728762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0598"
FT                   /product="pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39603"
FT                   /db_xref="GOA:Q1IU47"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU47"
FT                   /protein_id="ABF39603.1"
FT                   /translation="MATTEVTAPSLEAQRTPVVNDFSIQVATVNGSGSQSANTVLLRTI
FT                   FQMGVPVSGKNLFPSNIAGLPTWYTIRASKDGFVARKKEIDFVVAMNPETAKEDVLALE
FT                   PGAAVLYDEPLNLKDLRSDVTFYAVAFDKIVAEVCKEAKLRKLVKNMIYVGVMAKLLAL
FT                   DMKEVEKAIRRQFATKVKAADLNWNAAQAGHDYAVQNLPKQDPFKIERMNKTEGQIIID
FT                   GNAAAALGAMFAGVSVVTWYPITPSSSLVENLIEYMKEHRLDADGKATFAIVQAEDELA
FT                   AVGMVLGGGWMGARAMTATAGPGISLMGEFTGLGYYVEVPAVIWDVQRVGPSTGLPTRT
FT                   AQGDIMKVANLSHGDARHPMLFPHSVAECFEFAGAAFDLAETLQTPVFVMSDLDLGMNN
FT                   WMSEPFAYPTQPLKRGKVLSAEQLTQLGGFARYKDVDGDGIPYRTVPGTKHPQAAWFAR
FT                   GSGHNEKSQYTERPDDYVNNMDRLARKFATARKLVPQADIVQDGGKVGIIAYGTSHHAI
FT                   VESLSQLLKEYGVGLDYLRLKGFPFGEEVHDYIARHDRVYVVDQNRDHQMFDLLKLDIK
FT                   PEHVTKLRSVRHYNGLPIDARSVTDAILAQEVK"
FT   gene            728762..729802
FT                   /locus_tag="Acid345_0599"
FT   CDS_pept        728762..729802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0599"
FT                   /product="thiamine pyrophosphate enzyme-like TPP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39604"
FT                   /db_xref="GOA:Q1IU46"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU46"
FT                   /protein_id="ABF39604.1"
FT                   /translation="MATTSAPQPKTNHIGLTVLDYRGGKTTLCAGCGHNAISERIIDAM
FT                   YEMGVQPEEIIKMSGIGCSSKTPAYFMSRSFSFNSVHGRMPAVTTGAVLANQKMMAIGI
FT                   SGDGDTASIGMGQFVHLMRRNIPMIYIIEDNGVYGLTKGQFSATADIGSKLKTGVINDL
FT                   PPIDTCALAIMMGATFVGRSFSGDKKQLHTMLKAAIAHKGTAMLDVISPCVTFNDHEGS
FT                   TKSYKFMKDHEEPLHDLNFVPYFEEINVDYDEGTTTAVQMHDGSKLLLKKLEHDYDPKD
FT                   KINAVHRIMESHKTGEMLTGVFYVNPDAPSFLDLLNMTDTPLAQLPESTLRPSKATLEA
FT                   IMEEYR"
FT   gene            730289..731335
FT                   /locus_tag="Acid345_0600"
FT   CDS_pept        730289..731335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0600"
FT                   /product="sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39605"
FT                   /db_xref="GOA:Q1IU45"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU45"
FT                   /protein_id="ABF39605.1"
FT                   /translation="MNVHISYKGLEKTPDVESTVKLHLKKLERRLQVFRPELVSLHGSV
FT                   LQKSPRAGFVVALNLKLPTTDIAAEQANPNSAVAVKAAFDSLIGQISRHKGALRNEHAW
FT                   PRRQQEHGRNAISEVPFEDTVAAIKPESVTNEDVSSYINANLPRLRRFVQRELRHREQD
FT                   EKIARGSISVDEVIDEAIGNALSEAFERPEKMRLEPWLYRLSTDAIDRLAAGDSGGGNI
FT                   PLDRPDRSRDGEGSDENVLQFHQPDEDLSAMSLTFDKNISTPEDLAAKDEMISLVERTL
FT                   RDAGRNEREAFILFTIEGFTVEEIADITQKPEEEVRKSVHSAREYLKEFLPVRDPLSDR
FT                   LIEHSKTA"
FT   gene            731387..732553
FT                   /locus_tag="Acid345_0601"
FT   CDS_pept        731387..732553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39606"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR041202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU44"
FT                   /protein_id="ABF39606.1"
FT                   /translation="MITRDEIREISEIYSPEGCALTFYYQPALPLDKSHRHEAILVKDL
FT                   VRSALAESEKHGRNDCARQDLERILGMADQFQGNSRQAKAIFACYHRGIWREYDLPPML
FT                   TRTQLVVNSRFHLKPLAPLLEAKPRVLVAAIDRTKARIFELADEKIVEKQDFFTGLPRK
FT                   GKSDGFAGYDGGHAERRELNDAMAHFKTVADFLLAYTQRSGIERVAIGCRDEIWSEIKP
FT                   NLHKYTLDRLVGHFRVDAKVVLPAEVKEKVDYLLAEDDGRKKLDLLREVIGEAGRNGRG
FT                   ALGLRRVLRSLEMGEVQTLLLEDKFAAPGVQCTNCNHIDINMSHSCGVCGNPTIAIEDV
FT                   ADPLLARAMAAGIDLHYLPANGELDRVGRIAALLRFRADQNTSMKLAV"
FT   gene            733007..734215
FT                   /locus_tag="Acid345_0602"
FT   CDS_pept        733007..734215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0602"
FT                   /product="glycosylasparaginase precursor"
FT                   /note="Threonine peptidase; MEROPS family T02"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39607"
FT                   /db_xref="GOA:Q1IU43"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU43"
FT                   /protein_id="ABF39607.1"
FT                   /translation="MKFSRREFIATSAIGSASLALDLNAQSNNAPKAAGPGKNILICSA
FT                   NGHNYLDRGHAVLEKGGDTLDAIMEVVRGPEEDPEDDSVGYGGLPNEEGVVELDSCCMH
FT                   GPTRLAGSVGGVHDIMHVALLAKTVMEHTGHVMLVGEGAKRFAVAHGFPTMNLLTEHSR
FT                   KVWLLWKETNSNQDWWGPGPASPHFKFPTNGTKSEDLKERIREMEKLAEQIGIEPERRM
FT                   AAIHRVLYPPTGTINCSALKANGEMSGATTTSGLAWKIPGRCGDSPIIGAGCYCDQDVG
FT                   SAGATGSGEENIKIAGAHTIVENMRHGMSPKEAGMDALKRIVRNYNGDMARLKYVSMKF
FT                   YILRKDGEHAGVSMWSGTKEAPSKFAIHDGTARFENAAYLYEGEPQEWPPMPELQTSTY
FT                   STL"
FT   sig_peptide     733007..733084
FT                   /locus_tag="Acid345_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.991) with cleavage site probability 0.788 at
FT                   residue 26"
FT   gene            734326..734976
FT                   /locus_tag="Acid345_0603"
FT   CDS_pept        734326..734976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0603"
FT                   /product="multiple antibiotic resistance MarC-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39608"
FT                   /db_xref="GOA:Q1IU42"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU42"
FT                   /protein_id="ABF39608.1"
FT                   /translation="MRGAFEAHIVQFTLVALSSVFFLVDPFAIIPTFLVMTARHDPITR
FT                   RRMAARACWTAFIVLTAFAFAGTAIFKIFGITLPAFEIAGGLILLLIGLDMMQAERPTQ
FT                   EGSPETAEGSVKDDVSITPLGIPMLAGPGAISTVMVLNGTARDWSTTIPVFAAIALTCF
FT                   ASYWILRGAERVSQKMGQTGIRVLMRIMGLLLMAIAIQFMINGLTNLGVIHAD"
FT   gene            735097..737733
FT                   /locus_tag="Acid345_0604"
FT   CDS_pept        735097..737733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0604"
FT                   /product="serine/threonine protein kinase with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39609"
FT                   /db_xref="GOA:Q1IU41"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU41"
FT                   /protein_id="ABF39609.1"
FT                   /translation="MSNSAATLTTGDLVGNYRILGLLGAGGMGVVYRALDVKLERTVAL
FT                   KFLPEHQTTNQDDRKRVLREARTASQLDHPNIGVIHGFEETDDGRVFIVMAYYEGETLA
FT                   RKIAHGPLPVPEAVDIAIQICDGLAAAHASAIVHRDVKPSNVIITPRGVAKIVDFGLAR
FT                   LSTGASTQSISSGGTVGYMSPEQAMGKMVDQHTDVWSLAVTLAEMITGRNPFVRDSAAA
FT                   TVIGIVSDPPQPMDEIPVDLLRIIYRALAKEPELRYQNCGEMLPELKDFRREVEVAVTA
FT                   PPSTRRSTLTAKELRPLLEHASRSSLGNALTVQHRRQRWLVVLAIIAIVIAGLSFVPPV
FT                   REKVTQSFTHSEEHIAVLPFDNIGGDASTDAVAQGLMDSMTNALSNLGTVQKSLWVIPA
FT                   SVVRGQKITDPMMANRELGATLVVKGSIQRKDQTVHLSVNLIDAKNLRQIGSASLEDSS
FT                   GDLAALQNEAVSRLARLMNIKVSADFLKTTGGSVAPAAYESYLKALGLMQRYDKPGNLD
FT                   QAITALKSAVETDPRFALGYAQLGEAFRLKYNLDVNPKWIEQAKTYSQKAVELDDHVPA
FT                   VYVTLGRIHEAAGEHDLAVQEFQRALALDARSANALNGLAHSQESAGHVAEAEATFKKA
FT                   AALRPDYWDVYNEMGLFYDRQSKYKEAIEQLKRAVQLTPDNSQVYSNLAAVYIDSADPK
FT                   LRGDAEQALKKSIDLSPTYFAYANLGSLYFDEKRYAEAASVLEKALQINGDNYLVWIWL
FT                   MNSYDWLGEQDKSAAAADKAFGLLSKEAQAKPRDASAQVILADLSARKKLTDKAMGHLQ
FT                   TALALAPDDPDILADAASAYELMGNRAKALAAAHKALDKGFSLDKLKNDHVLQGLVTDP
FT                   SFQGTAK"
FT   gene            737758..738093
FT                   /locus_tag="Acid345_0605"
FT   CDS_pept        737758..738093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39610"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU40"
FT                   /protein_id="ABF39610.1"
FT                   /translation="MSSPIILTVNWSATSGYSLTPPNPDINNGGTARFTSPNKPATIHF
FT                   TPTNTPFGASKMVPMGGSVDVPVGAAEYQVQYSIAAVQATTGVAATAGTSTVRLGVSSG
FT                   TIKVGSG"
FT   gene            738225..738788
FT                   /locus_tag="Acid345_0606"
FT   CDS_pept        738225..738788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39611"
FT                   /db_xref="GOA:Q1IU39"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU39"
FT                   /protein_id="ABF39611.1"
FT                   /translation="MDSSLAKVAQRASGFSLVLSVLLIVFGVLAIMLPVAMSLGVVIVV
FT                   AWLLIISGVVQGVHSFRCEGIGSKIWRLLVALIYVSMGIYLRVNLHIGLAALTLAMIIF
FT                   CVSQGIFTIGAYLMTRSSGASGWMLFDGFITLILGIMIWRHWPASSFWVLGTFAGINMV
FT                   VSGMSRLGLTLAVRRALKMSAQAA"
FT   sig_peptide     738225..738317
FT                   /locus_tag="Acid345_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.767) with cleavage site probability 0.538 at
FT                   residue 31"
FT   gene            738900..742736
FT                   /locus_tag="Acid345_0607"
FT   CDS_pept        738900..742736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39612"
FT                   /db_xref="GOA:Q1IU38"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU38"
FT                   /protein_id="ABF39612.1"
FT                   /translation="MLEIIALVALVLALLCLAGSSTPYAVFFMSISVACAAWRAYRARE
FT                   AADRAQRELNDLRAEMQRLTTLSERAVRIAAETANQVMARTVSAPPADAVRPAAPPSTP
FT                   QGKPEFVSALDVAAEVPKFVAKPEAEVKAAAPIAPKIVVPPAPVVPPPPSAPPQQVSAP
FT                   PPPAPRVVEPASPAPPQRPAAPPVPSFATVGKPSKAASERMRSALNLEQVLGTNWLNKI
FT                   GVIILVLGIALFGIYELGQLGPLGKVGLSLAVSLALLGGGIYLERKDRYKVLGRTGIGG
FT                   GWALLFFTTYALDHVMAMRVMSSDALDSLLMLVVAGAMVAHTLRYKSQLVTGFAFLLAY
FT                   STVALSHDTVYSLAAGAILATAIVAIVLKMDWFELEVFAILSSYGNHFYWLYRLLGEHG
FT                   AEGHPFPEFMVSASLLVFYWAIFRVSYVVRRVATASEENLSTVAALLNTVLLLAVMKFQ
FT                   SARPELAFYALLILGAMEFTIAQLSITRRRRIAFVVLTMLGTALMIAAVPFKFSGGNVS
FT                   ILWLAGGEVLLFAGIFSSEHLFRRLGMVTGFVVLGQVLIVEFPRMIAVRATSPELALIK
FT                   QGVVLLAGAVVFYGNNALLRMRWPRMFSEYFDDLLLTATSYPGAVTLGLGCWAAFVHDS
FT                   MAVAFAAAMLAVAVIAYWLKSWHVQIQFGALGVVAVARCLTYNAHWDTPHHLPWRIGSL
FT                   IAIAAVFYIAARFTQHNAASDQQLIRGLTAATGTALVGLLFVSEVPAVWQPLAFALFAL
FT                   GLVESARLTGYLPLRWHTHVVAATAVVFAAATRVSTTPLWHSIHTGLWKLIPVVAVFYV
FT                   LGLRAAKIRDSYVEWVGTAYSWAASALAVWLLYEGLNQRYVAAAWIVYACILMVVSRWR
FT                   GWTSPAWQALVIGGFASVQVGVVNLLESTPGVHNTLRLSMCGIVIGGLYLLSQTLRLPD
FT                   QWRKQEFEQLHSWLATGLLATLLWYELPAVSVAVAWALLGLAVYEFGSIRKLAHMRWQG
FT                   YLVLLASFGRIFFANLSAGTPGDWLSTRMVTVLPIAAIYYFVFGREVESEKVRRWNISL
FT                   IFAYLGTAAVMAVFYFQFANEWVVVAWAALVPVLLALALLLKQNVFAQQTVLMSLAVLV
FT                   RGMLHNLFGGSYFSGSDWRGRFGVLGTAVLLLLAALPLAFEYRRRYAVDPALRGLRRAF
FT                   ALAIHRIEQPIFFVAIALLTTMLTLKMDHGMITLAWGVEAVVIFVSALALKERSFRLTG
FT                   LILLLMCVGKIIVIDAWRLAIRDRYLTFIGLGASLILVSFLYSKYSERIRQYL"
FT   sig_peptide     738900..739010
FT                   /locus_tag="Acid345_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.784 at
FT                   residue 37"
FT   gene            742733..743626
FT                   /locus_tag="Acid345_0608"
FT   CDS_pept        742733..743626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0608"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39613"
FT                   /db_xref="GOA:Q1IU37"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU37"
FT                   /protein_id="ABF39613.1"
FT                   /translation="MKRWMGLLLVVAFAAGALVLVHRRRESGEVSPNAMLSMAADAQRD
FT                   VLRAPMQMTRLSDEEETRIGDAMAERYEGSFRSPTDYSAVEREVQKVGGKLAVHAHRRL
FT                   NYRFHLIPDEQLLNAFALPGGHVFIGFGLVRLMNTEDELASVLGHELEHIDHYHCAERV
FT                   QVEAQMRKLQLGVIGELMQLPLSVFEAGYSKDQESEADREGILLAVEAGFSPYGAVSMF
FT                   TKFDELHRAYVIHAGSPPEELSQLAIETLSGYFRSHPLPSERIAQAMQVIAGHHLERQT
FT                   KQTPMLPEIAQQLDRE"
FT   sig_peptide     742733..742786
FT                   /locus_tag="Acid345_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.985) with cleavage site probability 0.564 at
FT                   residue 18"
FT   gene            complement(743673..744689)
FT                   /locus_tag="Acid345_0609"
FT   CDS_pept        complement(743673..744689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0609"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39614"
FT                   /db_xref="GOA:Q1IU36"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU36"
FT                   /protein_id="ABF39614.1"
FT                   /translation="MSTNTTTTTTASRPGIESDLALEFLQVVEEAAIGCAKLMGRGDRT
FT                   QADLVATESMRSTMESVRMKGCIVIGEGERDEAPMLYIGEKVGRQQDTDPEIDIAVDPL
FT                   EGTNLCATGAPGAITVLAASERGGLLHAPDCYMEKIIVGAPASGVVHLDRPVEENLKAI
FT                   AVAMKRDVEDLVIIVLDRPRHEKLIEDIRKAGARIRLISDGDVAAGIAAAVRGTGVHAV
FT                   MGVGGAPEGVITAAAIRCLNGYMEGRLVGYTKEQEARMAGMGITDLKRIYRADELAPGK
FT                   NIIFAATGVTEGPLLKAVRFFGEGVRTSSLVMKLNIGKVRFIDTIHLDRQPNAEIRF"
FT   gene            complement(744790..745968)
FT                   /locus_tag="Acid345_0610"
FT   CDS_pept        complement(744790..745968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0610"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39615"
FT                   /db_xref="GOA:Q1IU35"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU35"
FT                   /protein_id="ABF39615.1"
FT                   /translation="MAIKFKGVDYIELDTLLTDDERLVRDNTRRFIEENLIPIIEQCNR
FT                   DGRFPKELIQPMGELGFFGANLKGYGCAEMGNVEYGLMTQELERGDSGVRSFVSVQSAL
FT                   VMYPIYTFGSDAQKDKWLPAMAKGEKLGCFGLTEPDAGSNPSAMRTRARKEGNDYIISG
FT                   EKMWITSGSIADVAVIWAKVEDEGGRVRGFLVETDRPGFVAKDVHGKWSLRASVTSSLS
FT                   LQDVRIPAENLLPKSDGLKSPLMCLNQARYGIAWGAIGAAMACYDCALQYAQFRKQFHD
FT                   MPIAGHQLVQEKLVWMITEITKAQLLALQVGRLKDQGKAGHQHISMAKRNNVWMALECA
FT                   RMARDILGGNGIADEYPVFRHMMNLESVKTYEGTHDVHTLIIGQHITGIDGF"
FT   gene            746204..746527
FT                   /locus_tag="Acid345_0611"
FT   CDS_pept        746204..746527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39616"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU34"
FT                   /protein_id="ABF39616.1"
FT                   /translation="MPLTRAFKETVMARVKSDRQFRHSLLREGVECLLSGDLDAGKLVL
FT                   RDFIKATVGFSALSKAVKIPEKSLIRMFGPSGNPQAKKLFRVVAFLQRGEGIRFEVKPR
FT                   KAA"
FT   gene            746569..747744
FT                   /locus_tag="Acid345_0612"
FT   CDS_pept        746569..747744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0612"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39617"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU33"
FT                   /protein_id="ABF39617.1"
FT                   /translation="MRTLLVFASLLVSAGLFAAEPIHRLDGGTISPEQIDATVTRLMKA
FT                   AEVPGLGVAVIDDGKVVYLKGYGFRDVEKKLPYTPDTVAYAASFTKSAFAYMVLQLVDE
FT                   RSLDLDRPVYGYLPKPLLEYDDYKDLAGDERWKKITARMLLSHTSGLPNLRRFEDDQKV
FT                   HIHFEPGSRYAYSGEGLKLLQLVIETIAKQPLQQLMEKRVFEPFGMTRTSMVWNAEFED
FT                   NFANGYDENGRNLGPDRRKSAGAAGSMVTTIRDFSRFLQLVMHGDRLSPKMHSEMLKAQ
FT                   VRIHAQHEFPTFENKATHANDAIRLSYGLGWGLYWSPYGEAFFKEGHDDGWRNYTVAFS
FT                   DSGKGMIIMTNSGNGEGIFKELLEAVLKDSFTPIEWEGYTPYQQLPPRQSK"
FT   sig_peptide     746569..746625
FT                   /locus_tag="Acid345_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(747745..747987)
FT                   /locus_tag="Acid345_0613"
FT   CDS_pept        complement(747745..747987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39618"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU32"
FT                   /protein_id="ABF39618.1"
FT                   /translation="MRIRPSAVECGAPSQKTMQEQRLRELEDLLQRAREIKLFRLTEDE
FT                   GNFLRGLHYKSAEELSRDEETRLRALVKLHWRREE"
FT   gene            complement(747991..748464)
FT                   /locus_tag="Acid345_0614"
FT   CDS_pept        complement(747991..748464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39619"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU31"
FT                   /protein_id="ABF39619.1"
FT                   /translation="MPKISAIVHTRNDAPRLGRLLETLRPCDQVLIIDDSTDDSVQKVA
FT                   HEYGAALRKCISGVTPGAYAMDAIHEWILCVLPNESLSEGLEASLFSWKEGEPKREDLF
FT                   AMTIREEKEGQWSELSSEVRLINRRCVNWTGMMPPNLEGAFVLPGHLLRFDHP"
FT   gene            complement(748563..750722)
FT                   /locus_tag="Acid345_0615"
FT   CDS_pept        complement(748563..750722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0615"
FT                   /product="prolyl oligopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="Serine peptidase; MEROPS family S09A"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39620"
FT                   /db_xref="GOA:Q1IU30"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU30"
FT                   /protein_id="ABF39620.1"
FT                   /translation="MHFHERSAKTIAPMKPLLAIVLLAMCLYAADKPAQVKGGNGITLP
FT                   PPPATEIKPVAEMIHGVSITDNYRWLEDAKSPDTRAWIDTQMKYTESYLSQVKIRPEIA
FT                   ERLSKLIKVEEYSTPAERGGKYFFMKRLPEENQSSIYVRDGIHGQDQLLVDANKMSADQ
FT                   NTSVTIDDISQDGSLLVYGDRAGGADEEAVHILDVAKKQDLADSLPSARYFGISLSPDK
FT                   QGIYYSKVNDQGSIVYYHKLGAPSANDELIFGKEFEGEKLGPMDLIGVGITDNQRYLLI
FT                   YNSQGVPAKRVDVYAKDLRQPSSPVKKIIHGIDNRFNPVNIGDDFYVSTDYQAPNYRVI
FT                   KIHFGDTDPKQWKTIVPEGKDVISGISLVGGKLFITSLHDVVTQTRIFALDGKQTGEIK
FT                   YPTLGSASDMSGRENSDHAFYSFQSFISPPTIYHYDVKTGATEVFARPNVPFNADDFEL
FT                   KQVFYTSKDGTKVPMFIASKKGAKRDGKTPALLYAYGGFLVNLTPVWSPRIAWWMEQGG
FT                   IYAQPNLRGGGEYGEKWHQAGMFEHKQNVFDDYFAAAQYLINEKYTDAQHLAARGGSNG
FT                   GLLMGAAMTQHPELFGAISCGYPLLDMIRFQNFLVGKWWTSEYGSSDNAEQFPYLLKYS
FT                   PYHNVKPGMKFPAVMFTTGDSDTRVDPLHARKMAALVQHDNASDRPILMHYQTVSGHSA
FT                   GVSVTQEVSDIADDLAFLWNETSTN"
FT   sig_peptide     complement(750633..750722)
FT                   /locus_tag="Acid345_0615"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.984) with cleavage site probability 0.969 at
FT                   residue 30"
FT   gene            complement(750751..753339)
FT                   /locus_tag="Acid345_0616"
FT   CDS_pept        complement(750751..753339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0616"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39621"
FT                   /db_xref="GOA:Q1IU29"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU29"
FT                   /protein_id="ABF39621.1"
FT                   /translation="MSFFYRHQNEAEFDLELKFHVDERTRELVAQGLSQDEAHRRAMIE
FT                   LGGKEQTAQQLREVHSSALLETIVRNFRSGLRLIRRAPGFSLTVVVTLALAIGANSAVF
FT                   SAINAILLSPLPYPNGDRLMLLQQKMTNMHHPVTFVSPARLEDWNRMNATFEAMTGYYT
FT                   EPGSELSGSLPEKVMRAFVAPRFIQVFGVAPALGRDFTSEEFKYGGPDAVILSDSYWRR
FT                   HFHADPSVIGKRLHIGSTAPTVVGVMPQSFLFPVRDADIFIPSPPDFTYAQSRDATWFT
FT                   VIGRMKPGVAVTQARADLATVQAQLGRQFPNPDATIAVILNPLKEDTVSSARRSLWMIF
FT                   GSVSLLLLIACTNIVALFLARTSDREHEISVRFSLGASRARIVAQLLSETFVLACIGSA
FT                   IGLLLATASARVFHLLAASLPRVDEIALNWRIVGYTFVCAIVVTLLCGTVPALRATRGL
FT                   SAALAASDRRTSVAARQPLQWTLVAVQVALAVTLLFGAGLLLRSFQALTRVDAGFDPSH
FT                   VLTLHISGGYGETVDMKAMARRIDHDLDGIRAVPGVEGAATSSSMPGVPDDHKSDVRIL
FT                   EGPQDPDHPTLATNRFVSDGYFATMRIPVLAGTPCEQGKDTKDVLVNRSFADRYMSGTT
FT                   PMGHHLQFGVNHAIALTGMVRGVVADTRENGLNMDAQPTVYWCIAAPDPDPEFLIRTHS
FT                   DPMALSQTIRRALGNIEPNRAVFDISTLEDHLSDAYSENRLRTILLSLFALTAVSLACV
FT                   GLYGTLSYSVTVRRREIGLRLALGAVRGQITKRYVWQALRVTMIGCTCGLVLAAFAGRI
FT                   LRGMLFGVSALDAVTFAGVIALVLGVAALAAIVPAWRASRTDPMHVLREQ"
FT   gene            complement(753349..753675)
FT                   /locus_tag="Acid345_0617"
FT   CDS_pept        complement(753349..753675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0617"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39622"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR017799"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU28"
FT                   /protein_id="ABF39622.1"
FT                   /translation="MADDLLQGTLDLLVLKVLALGPLHGYGIAQRIRQVSKEVLQVQQG
FT                   SLYPALHRLEKRGWLTASWEESETGRPAKFYKLSAKGRKQLAEEEKTWARMSAAIALIL
FT                   QSAE"
FT   gene            complement(753903..756371)
FT                   /locus_tag="Acid345_0618"
FT   CDS_pept        complement(753903..756371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0618"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39623"
FT                   /db_xref="GOA:Q1IU27"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU27"
FT                   /protein_id="ABF39623.1"
FT                   /translation="MHTLLQDLRFASRQLRKNPGFAITTILTLALGIGAATAIFSLVNA
FT                   VLLRPLPFPEQDKIVWTAMAHTPRNAKTADAALVPGSMSYPDYFDLRKGNKTLQYLSSY
FT                   HDSSFSVTGRGDARHVDGFTVSADFFRTLGVHPERGRDFLADDEKPGVHVAMLGHSLWQ
FT                   STFGSDPDIIGKNITIGGLSYTVAGVMPADFNFPVQNPAAQLWTTLADDALDSTGDHPV
FT                   TVQRGAHFLSMVGRLKPGVSTEQAQADLTVIVKNLAAQYPDTNSHFLGAFVKPQLEQMI
FT                   GDTRGPLRMLFAAVIFVLLIACANVAGLLLARASRRRSEIAVRSALGATRMQIVRQVMV
FT                   ESVFIGICGGIAGLLLSMALLRLLLRFVPSDIPRLDSVGTDYRVFAFAIVISVITGVLF
FT                   GVLPAMRISRLDPSASLRDGTRTSSAGRQQHHLHGALVIAETAIGLVLLVGSGLLIRSF
FT                   VRVMHVDPGFDARHVLLASVDLPDNRYPGDKNVSFFQQLIPRLQALPGVQSVAAGWPLP
FT                   LTGSMMSISFEIEGHPVPKADEPSEIVSIATPGFFKTIGIPVKRGREFLETDTRTSTKV
FT                   IILTESFAKKYFPNEDPIGKHVKPGLGDGYTDSVWREVVGVVGDIKRQGLTVETRPEYY
FT                   LPHTQAIVGPPIFVIRTSGDPTQITNAVRSEVAAMDRNVPVYDVHTYDDLISKNASQPR
FT                   FQSMLLTCFAALALLLSAIGLYAVLSYMVAQRTLEIGVRMALGARRRDVVNLILKHGLG
FT                   LALVGLVLGMGLSLVLTRYLSSMLYTIKPLDPVTLLTVTGILLVVAVVASTAPAWRAAR
FT                   LDPMKTLRDQ"
FT   sig_peptide     complement(756234..756371)
FT                   /locus_tag="Acid345_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.943) with cleavage site probability 0.623 at
FT                   residue 46"
FT   gene            complement(756569..759001)
FT                   /locus_tag="Acid345_0619"
FT   CDS_pept        complement(756569..759001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0619"
FT                   /product="ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39624"
FT                   /db_xref="GOA:Q1IU26"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017800"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU26"
FT                   /protein_id="ABF39624.1"
FT                   /translation="MPDVRFAIRQLLRNKAFAITVVFTLALSIGANTAIFSVVNALLIR
FT                   PLPYPQPERLGTIFGRVSGPGNAEDERSGVDGEKWELLRDNVPAVLAAVQSEFAAGANL
FT                   KAGSAVQYVHAGRVSAHYFEVLGTTPRLGRTFTEDEDRDGGPQAAILSDGLWRSAFGAD
FT                   PRVIGTNILLKGEPSTIVGVMPPHFAMPQSADIFTPIRASRHGEGTGTNFTAIVRLRPG
FT                   ATWQQADTQINAAWADRINRFEKHNPGSHVSYYSVPLQQGQSADLRGPVVALMGAVAFI
FT                   LMIACANLAGLMLVRVARRTPEFATRLALGASRWDILRQLWTEGLVLAVAGGGAGVVLA
FT                   FGALRALTTLLPPDLLPVQNIALDGRVLLFTALATIATSVLFGLLPALQTRRLDLRAAI
FT                   AAGSSRSVSAGGHTRVRQALIAGEIALTVVLLAASGLLVRTLVYLETLPSGFDANNVMA
FT                   ARLSLDDARYHDPAKFRDLLSKSLASMRQIPGAESASVGLSLPYERGLNDGIKIADGKE
FT                   AGQQPTATVIYVTPQYFETLRIPVLAGRTFTEADTADSQPVVIVNQSFARRYLNQPDAT
FT                   GRQLGADKPRIVVAVVADVAKAPGFDSDQPLNVEPTVYVPATQVPGVLIAVAHIWFQPS
FT                   WIVRTSGPVTGLTEQMQHALASADPSLPFSGFYRMTDIRAEAVTMQRVEVTLLTTLAAL
FT                   ALLLSAIGIFALVSNLVLQRTREIGIRIALGSTIHQAMLEIGRSGLISAACGLAAGLVL
FT                   SAFALRITKSALYGVRIYDPVTLFGVLGILAIIALGATYLPTLRIARIHPAETLRAE"
FT   sig_peptide     complement(758900..759001)
FT                   /locus_tag="Acid345_0619"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.894) with cleavage site probability 0.722 at
FT                   residue 34"
FT   gene            complement(759281..760333)
FT                   /locus_tag="Acid345_0620"
FT   CDS_pept        complement(759281..760333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0620"
FT                   /product="Fe-S protein, radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39625"
FT                   /db_xref="GOA:Q1IU25"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU25"
FT                   /protein_id="ABF39625.1"
FT                   /translation="MCHMSALPKFDAPPLLAYEPRSAGPISPTLVGIAKLAAEGESIRL
FT                   GHEVEYLTLPARSLLNRCSTPRMPFTWTINPYRGCEFACKYCYARYTHEFMELRDNTEF
FT                   ERKIFVKQQASNLLRRDLRKVKPGEEIAIGTATDPYQPAERRYEVTRGILEEFALHRGF
FT                   HIGVITKSQLILRDLELLRRVAENNHVSVNLTITTLDAKLARILEPRAPRPDLRLNAIK
FT                   LLNEAGIPCGVSCAPVLPGITDSAKDLDALVAAAHAHGARSIFANPLFLKPCSASVFMP
FT                   FLEKEFPHLAENYRKRYGKNAFVPDAYRKRIQQLMSSLKRKHGFAAHRVQFEDRRPIVA
FT                   DEPAQMGLFG"
FT   gene            complement(760565..762742)
FT                   /locus_tag="Acid345_0621"
FT   CDS_pept        complement(760565..762742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0621"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39626"
FT                   /db_xref="GOA:Q1IU24"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU24"
FT                   /protein_id="ABF39626.1"
FT                   /translation="MKKFTLFFLVATLFVCTASFAQRTPKEKGEWERIPTPTLPAFKPA
FT                   EPTRIELSNGMVIFLQEDHELPLIDATMRIRGGSRNEPAAKVGLVDIYGDVWRTGGTKT
FT                   KTGDELDDLLEARAAKIETDGNADSTTIAFSCLKQDLDTVFPIFADILQNPAFRDDKLE
FT                   LAKEEMGSSISRRNDQIGSIAGREAGKLAYGKDNPYARTPEYATVAAVTHEDLVQWHQK
FT                   YVYPNNIIIGMVGDFDAKQMEQKLRAAFESWPKGPDAPAFHADFKTAAPGIYFVEKPDV
FT                   NQSEIRMVSLGIERNNPDYYAVEVMNEVFGGGFSSRLFSNIRTKQGLAYAVYGSIGASF
FT                   DHPGVFRIGMGTKSVTTVEAIQSLNAQIDDLVKTPPSAEELTRAKAAILNSFIFNFDTP
FT                   EKVLREKMAYEFYHYPLDFLEQYRANVEKVTSEDVARVAQKYVHKDQMATLVVGNSSEM
FT                   GAQKLDSLGKVIPIDITIPTPTGEAQGEGAAEAAPAASNPEGKALAAKFVQAIGGKEKV
FT                   AAIKAVEQQSDTVRNTPQGEMTVQTDSIVQYPDRVHLQISTPMGKMVMAATSSSGFMAA
FT                   GGQSGDMPGPAREDALKGLKRDVIAVAQHADDPKYTFAAAGTKKIGDVEANVLKINADG
FT                   ADATWYLDPKSNLPLRSEYSAMAQAGPVSRTADYADWKPVNGVTLYTSRTVTDNGKVTA
FT                   KETVKQWTFNPIIDPAIWQKPAGAAPADEQK"
FT   sig_peptide     complement(762677..762742)
FT                   /locus_tag="Acid345_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(762742..764253)
FT                   /locus_tag="Acid345_0622"
FT   CDS_pept        complement(762742..764253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0622"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39627"
FT                   /db_xref="GOA:Q1IU23"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU23"
FT                   /protein_id="ABF39627.1"
FT                   /translation="MKCPVAKLVFALLLLSSFLAAQDEASFEKRVTVKKLPNGLTIVIC
FT                   ERHEAPVFSFYTVVDAGSSQDPRGRTGLAHMFEHMAFKGTPTIGTTDWPAEKAALAKVE
FT                   TAYTAYIDERDKRVGRDDAKVASLQKAWKDTIADANKYVIPNQFGQIVESAGGEGMNAS
FT                   TSWDSTDYLYSMPVNKFELWAYLESERFLHPVMREFYKERDVVVEERRMRTESSPVGRL
FT                   IEQFTAASFTASPYHRPTVGYYSDLQTFSATDAEKFFHTYYIPSNMVIGLVGDLDPAKV
FT                   MPILEKYFARIPSGPKPIDETSVEPPQNSERIVKLTDASQPYYLEGYHRPDYMNADDAV
FT                   YDVITDLLSDGRTSRLYRSLVRDKKIALAAAGFSGFPGVKYAHLFVFYALPTQGHTTQE
FT                   VADAIHVEINKLKTTDVTDEELQMIKTREKAGLIRRLGSNEGLANELAVYQTRYGDWHE
FT                   LFKSVDRIDKVTKADVRRIANQIFTETNRSIATIQTAAPQKGAQQ"
FT   sig_peptide     complement(764188..764253)
FT                   /locus_tag="Acid345_0622"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.813 at
FT                   residue 22"
FT   gene            complement(764450..766186)
FT                   /locus_tag="Acid345_0623"
FT   CDS_pept        complement(764450..766186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0623"
FT                   /product="Carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acid345_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF39628"
FT                   /db_xref="GOA:Q1IU22"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1IU22"
FT                   /protein_id="ABF39628.1"
FT                   /translation="MVVLGFSGIQNGEYYRQHYGLRFVGHDAAVALVRDGEVLFAAEEE
FT                   RFSRQKHTSSFPIGALNAALQTTGLEIGDIDTVAYPWAITGRKFLHMNLNHVHRVPLFS
FT                   GPQLAIAGMRVIRDLMSPQRIASRFSAELGSALPRCRGVSHHMGHSACAYYTSPFDSAA
FT                   VLTIDGQGEDESGSLGEWNATRYRHIRSIYSPDSIGILYGMITDFLGMRAAWDEYKVMG
FT                   MASYGNPTRFAAQYRSLVELLPRGRYRTDRTAMVFKPGYCETMLCRTFGIAQRKPDEPL
FT                   EQVHFDLAAALQKLTEDVVFHLLAHLRKETSAPDLCLAGGVFQNSVLNGKILRSGLFER
FT                   VHVPPVPGDHGGALGAALFAYHEKNLKRTDLDFSAFTGPAYAEREIQAVLDQANAVRYN
FT                   RPAELANEVAQRLAQGQVLGWFQGRMEYGPRALGHRSILASPLSAEMKDVVNERIKHRE
FT                   RFRPFAGAVPRECVNQYFELDGASPYMQFVVPVKKEAENRIPAVVHFGTCRAQTVDRTD
FT                   DPLFHALLTAFGKLTGHPVLLNTSFNDADEPIVCSPADAVRTFLRTNLDAMALGPFLVE
FT                   RR"
FT   gene            766313..767350
FT                   /locus_tag="Acid345_0624"
FT   CDS_pept        766313..767350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acid345_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes