(data stored in ACNUC7421 zone)

EMBL: CP000361

ID   CP000361; SV 1; circular; genomic DNA; STD; PRO; 2341251 BP.
XX
AC   CP000361;
XX
PR   Project:PRJNA16319;
XX
DT   01-OCT-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Arcobacter butzleri RM4018, complete genome.
XX
KW   .
XX
OS   Arcobacter butzleri RM4018
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Campylobacteraceae; Arcobacter group; Arcobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2341251
RX   PUBMED; 18159241.
RA   Miller W.G., Parker C.T., Rubenfield M., Mendz G.L., Wosten M.M.,
RA   Ussery D.W., Stolz J.F., Binnewies T.T., Hallin P.F., Wang G., Malek J.A.,
RA   Rogosin A., Stanker L.H., Mandrell R.E.;
RT   "The complete genome sequence and analysis of the epsilonproteobacterium
RT   Arcobacter butzleri";
RL   PLoS One 2(12):E1358-E1358(2007).
XX
RN   [2]
RP   1-2341251
RX   DOI; 10.1007/s10482-007-9171-5.
RX   PUBMED; 17588128.
RA   Kaakoush N.O., Sterzenbach T., Miller W.G., Suerbaum S., Mendz G.L.;
RT   "Identification of disulfide reductases in Campylobacterales: a
RT   bioinformatics investigation";
RL   Antonie Van Leeuwenhoek 92(4):429-441(2007).
XX
RN   [3]
RP   1-2341251
RA   Miller W.G., Rubenfield M., Wang G., Rogosin A., Malek J., Parker C.T.,
RA   Stanker L.H., Mandrell R.E.;
RT   ;
RL   Submitted (25-APR-2006) to the INSDC.
RL   Produce Safety and Microbiology, USDA, ARS, WRRC, 800 Buchanan St., Albany,
RL   CA 94710, USA
XX
DR   MD5; e9bc957b05bf8bea00c03cdfb1ba313c.
DR   BioSample; SAMN02604276.
DR   EnsemblGenomes-Gn; Abu_0149.
DR   EnsemblGenomes-Gn; Abu_0169.
DR   EnsemblGenomes-Gn; Abu_0170.
DR   EnsemblGenomes-Gn; Abu_0171.
DR   EnsemblGenomes-Gn; Abu_0172.
DR   EnsemblGenomes-Gn; Abu_0173.
DR   EnsemblGenomes-Gn; Abu_0174.
DR   EnsemblGenomes-Gn; Abu_0175.
DR   EnsemblGenomes-Gn; Abu_0509.
DR   EnsemblGenomes-Gn; Abu_0510.
DR   EnsemblGenomes-Gn; Abu_0511.
DR   EnsemblGenomes-Gn; Abu_0512.
DR   EnsemblGenomes-Gn; Abu_0513.
DR   EnsemblGenomes-Gn; Abu_0514.
DR   EnsemblGenomes-Gn; Abu_0515.
DR   EnsemblGenomes-Gn; Abu_0516.
DR   EnsemblGenomes-Gn; Abu_0841.
DR   EnsemblGenomes-Gn; Abu_0842.
DR   EnsemblGenomes-Gn; Abu_0843.
DR   EnsemblGenomes-Gn; Abu_0844.
DR   EnsemblGenomes-Gn; Abu_0845.
DR   EnsemblGenomes-Gn; Abu_1229.
DR   EnsemblGenomes-Gn; Abu_1230.
DR   EnsemblGenomes-Gn; Abu_1231.
DR   EnsemblGenomes-Gn; Abu_1323.
DR   EnsemblGenomes-Gn; Abu_1370.
DR   EnsemblGenomes-Gn; Abu_1523.
DR   EnsemblGenomes-Gn; Abu_1532.
DR   EnsemblGenomes-Gn; Abu_1533.
DR   EnsemblGenomes-Gn; Abu_1534.
DR   EnsemblGenomes-Gn; Abu_1535.
DR   EnsemblGenomes-Gn; Abu_1750.
DR   EnsemblGenomes-Gn; Abu_1779.
DR   EnsemblGenomes-Gn; Abu_1780.
DR   EnsemblGenomes-Gn; Abu_1781.
DR   EnsemblGenomes-Gn; Abu_1782.
DR   EnsemblGenomes-Gn; Abu_1783.
DR   EnsemblGenomes-Gn; Abu_1784.
DR   EnsemblGenomes-Gn; Abu_1849.
DR   EnsemblGenomes-Gn; Abu_1850.
DR   EnsemblGenomes-Gn; Abu_1870.
DR   EnsemblGenomes-Gn; Abu_1871.
DR   EnsemblGenomes-Gn; Abu_1876.
DR   EnsemblGenomes-Gn; Abu_1877.
DR   EnsemblGenomes-Gn; Abu_1878.
DR   EnsemblGenomes-Gn; Abu_1891.
DR   EnsemblGenomes-Gn; Abu_1894.
DR   EnsemblGenomes-Gn; Abu_1895.
DR   EnsemblGenomes-Gn; Abu_1896.
DR   EnsemblGenomes-Gn; Abu_1897.
DR   EnsemblGenomes-Gn; Abu_1913.
DR   EnsemblGenomes-Gn; Abu_1914.
DR   EnsemblGenomes-Gn; Abu_1915.
DR   EnsemblGenomes-Gn; Abu_1916.
DR   EnsemblGenomes-Gn; Abu_1917.
DR   EnsemblGenomes-Gn; Abu_1918.
DR   EnsemblGenomes-Gn; Abu_1997.
DR   EnsemblGenomes-Gn; Abu_1998.
DR   EnsemblGenomes-Gn; Abu_1999.
DR   EnsemblGenomes-Gn; Abu_2000.
DR   EnsemblGenomes-Gn; Abu_2001.
DR   EnsemblGenomes-Gn; Abu_2101.
DR   EnsemblGenomes-Gn; Abu_2102.
DR   EnsemblGenomes-Gn; Abu_2103.
DR   EnsemblGenomes-Gn; Abu_2268.
DR   EnsemblGenomes-Gn; Abu_2269.
DR   EnsemblGenomes-Gn; Abu_2270.
DR   EnsemblGenomes-Gn; Abu_2271.
DR   EnsemblGenomes-Gn; Abu_2272.
DR   EnsemblGenomes-Gn; EBG00001083711.
DR   EnsemblGenomes-Gn; EBG00001083712.
DR   EnsemblGenomes-Gn; EBG00001083713.
DR   EnsemblGenomes-Gn; EBG00001083714.
DR   EnsemblGenomes-Gn; EBG00001083715.
DR   EnsemblGenomes-Gn; EBG00001083716.
DR   EnsemblGenomes-Gn; EBG00001083717.
DR   EnsemblGenomes-Gn; EBG00001083718.
DR   EnsemblGenomes-Gn; EBG00001083719.
DR   EnsemblGenomes-Gn; EBG00001083720.
DR   EnsemblGenomes-Gn; EBG00001083721.
DR   EnsemblGenomes-Gn; EBG00001083722.
DR   EnsemblGenomes-Gn; EBG00001083723.
DR   EnsemblGenomes-Gn; EBG00001083724.
DR   EnsemblGenomes-Gn; EBG00001083725.
DR   EnsemblGenomes-Gn; EBG00001083726.
DR   EnsemblGenomes-Gn; EBG00001083727.
DR   EnsemblGenomes-Gn; EBG00001083728.
DR   EnsemblGenomes-Gn; EBG00001083729.
DR   EnsemblGenomes-Gn; EBG00001083730.
DR   EnsemblGenomes-Gn; EBG00001083731.
DR   EnsemblGenomes-Gn; EBG00001083732.
DR   EnsemblGenomes-Gn; EBG00001083733.
DR   EnsemblGenomes-Gn; EBG00001083734.
DR   EnsemblGenomes-Gn; EBG00001083735.
DR   EnsemblGenomes-Gn; EBG00001083736.
DR   EnsemblGenomes-Gn; EBG00001083737.
DR   EnsemblGenomes-Gn; EBG00001083738.
DR   EnsemblGenomes-Gn; EBG00001083739.
DR   EnsemblGenomes-Gn; EBG00001083740.
DR   EnsemblGenomes-Gn; EBG00001083741.
DR   EnsemblGenomes-Gn; EBG00001083742.
DR   EnsemblGenomes-Gn; EBG00001083743.
DR   EnsemblGenomes-Gn; EBG00001083744.
DR   EnsemblGenomes-Gn; EBG00001083746.
DR   EnsemblGenomes-Gn; EBG00001083747.
DR   EnsemblGenomes-Gn; EBG00001083748.
DR   EnsemblGenomes-Gn; EBG00001083749.
DR   EnsemblGenomes-Gn; EBG00001083750.
DR   EnsemblGenomes-Gn; EBG00001083751.
DR   EnsemblGenomes-Gn; EBG00001083752.
DR   EnsemblGenomes-Gn; EBG00001083753.
DR   EnsemblGenomes-Gn; EBG00001083754.
DR   EnsemblGenomes-Gn; EBG00001083755.
DR   EnsemblGenomes-Gn; EBG00001083756.
DR   EnsemblGenomes-Gn; EBG00001083757.
DR   EnsemblGenomes-Gn; EBG00001083758.
DR   EnsemblGenomes-Gn; EBG00001083759.
DR   EnsemblGenomes-Gn; EBG00001083760.
DR   EnsemblGenomes-Gn; EBG00001083761.
DR   EnsemblGenomes-Gn; EBG00001083762.
DR   EnsemblGenomes-Gn; EBG00001083763.
DR   EnsemblGenomes-Gn; EBG00001083764.
DR   EnsemblGenomes-Gn; EBG00001083765.
DR   EnsemblGenomes-Gn; EBG00001083766.
DR   EnsemblGenomes-Gn; EBG00001083767.
DR   EnsemblGenomes-Gn; EBG00001083768.
DR   EnsemblGenomes-Gn; EBG00001083769.
DR   EnsemblGenomes-Gn; EBG00001083770.
DR   EnsemblGenomes-Gn; EBG00001083771.
DR   EnsemblGenomes-Gn; EBG00001083772.
DR   EnsemblGenomes-Gn; EBG00001083773.
DR   EnsemblGenomes-Gn; EBG00001083774.
DR   EnsemblGenomes-Gn; EBG00001083775.
DR   EnsemblGenomes-Gn; EBG00001083776.
DR   EnsemblGenomes-Gn; EBG00001083777.
DR   EnsemblGenomes-Gn; EBG00001083778.
DR   EnsemblGenomes-Gn; EBG00001083779.
DR   EnsemblGenomes-Gn; EBG00001083780.
DR   EnsemblGenomes-Gn; EBG00001083781.
DR   EnsemblGenomes-Gn; EBG00001083782.
DR   EnsemblGenomes-Gn; EBG00001083783.
DR   EnsemblGenomes-Gn; EBG00001083784.
DR   EnsemblGenomes-Gn; EBG00001083785.
DR   EnsemblGenomes-Gn; EBG00001083786.
DR   EnsemblGenomes-Gn; EBG00001083787.
DR   EnsemblGenomes-Gn; EBG00001083788.
DR   EnsemblGenomes-Tr; Abu_0149-1.
DR   EnsemblGenomes-Tr; Abu_0169-1.
DR   EnsemblGenomes-Tr; Abu_0170-1.
DR   EnsemblGenomes-Tr; Abu_0171-1.
DR   EnsemblGenomes-Tr; Abu_0172-1.
DR   EnsemblGenomes-Tr; Abu_0173-1.
DR   EnsemblGenomes-Tr; Abu_0174-1.
DR   EnsemblGenomes-Tr; Abu_0175-1.
DR   EnsemblGenomes-Tr; Abu_0509-1.
DR   EnsemblGenomes-Tr; Abu_0510-1.
DR   EnsemblGenomes-Tr; Abu_0511-1.
DR   EnsemblGenomes-Tr; Abu_0512-1.
DR   EnsemblGenomes-Tr; Abu_0513-1.
DR   EnsemblGenomes-Tr; Abu_0514-1.
DR   EnsemblGenomes-Tr; Abu_0515-1.
DR   EnsemblGenomes-Tr; Abu_0516-1.
DR   EnsemblGenomes-Tr; Abu_0841-1.
DR   EnsemblGenomes-Tr; Abu_0842-1.
DR   EnsemblGenomes-Tr; Abu_0843-1.
DR   EnsemblGenomes-Tr; Abu_0844-1.
DR   EnsemblGenomes-Tr; Abu_0845-1.
DR   EnsemblGenomes-Tr; Abu_1229-1.
DR   EnsemblGenomes-Tr; Abu_1230-1.
DR   EnsemblGenomes-Tr; Abu_1231-1.
DR   EnsemblGenomes-Tr; Abu_1323-1.
DR   EnsemblGenomes-Tr; Abu_1370-1.
DR   EnsemblGenomes-Tr; Abu_1523-1.
DR   EnsemblGenomes-Tr; Abu_1532-1.
DR   EnsemblGenomes-Tr; Abu_1533-1.
DR   EnsemblGenomes-Tr; Abu_1534-1.
DR   EnsemblGenomes-Tr; Abu_1535-1.
DR   EnsemblGenomes-Tr; Abu_1750-1.
DR   EnsemblGenomes-Tr; Abu_1779-1.
DR   EnsemblGenomes-Tr; Abu_1780-1.
DR   EnsemblGenomes-Tr; Abu_1781-1.
DR   EnsemblGenomes-Tr; Abu_1782-1.
DR   EnsemblGenomes-Tr; Abu_1783-1.
DR   EnsemblGenomes-Tr; Abu_1784-1.
DR   EnsemblGenomes-Tr; Abu_1849-1.
DR   EnsemblGenomes-Tr; Abu_1850-1.
DR   EnsemblGenomes-Tr; Abu_1870-1.
DR   EnsemblGenomes-Tr; Abu_1871-1.
DR   EnsemblGenomes-Tr; Abu_1876-1.
DR   EnsemblGenomes-Tr; Abu_1877-1.
DR   EnsemblGenomes-Tr; Abu_1878-1.
DR   EnsemblGenomes-Tr; Abu_1891-1.
DR   EnsemblGenomes-Tr; Abu_1894-1.
DR   EnsemblGenomes-Tr; Abu_1895-1.
DR   EnsemblGenomes-Tr; Abu_1896-1.
DR   EnsemblGenomes-Tr; Abu_1897-1.
DR   EnsemblGenomes-Tr; Abu_1913-1.
DR   EnsemblGenomes-Tr; Abu_1914-1.
DR   EnsemblGenomes-Tr; Abu_1915-1.
DR   EnsemblGenomes-Tr; Abu_1916-1.
DR   EnsemblGenomes-Tr; Abu_1917-1.
DR   EnsemblGenomes-Tr; Abu_1918-1.
DR   EnsemblGenomes-Tr; Abu_1997-1.
DR   EnsemblGenomes-Tr; Abu_1998-1.
DR   EnsemblGenomes-Tr; Abu_1999-1.
DR   EnsemblGenomes-Tr; Abu_2000-1.
DR   EnsemblGenomes-Tr; Abu_2001-1.
DR   EnsemblGenomes-Tr; Abu_2101-1.
DR   EnsemblGenomes-Tr; Abu_2102-1.
DR   EnsemblGenomes-Tr; Abu_2103-1.
DR   EnsemblGenomes-Tr; Abu_2268-1.
DR   EnsemblGenomes-Tr; Abu_2269-1.
DR   EnsemblGenomes-Tr; Abu_2270-1.
DR   EnsemblGenomes-Tr; Abu_2271-1.
DR   EnsemblGenomes-Tr; Abu_2272-1.
DR   EnsemblGenomes-Tr; EBT00001686264.
DR   EnsemblGenomes-Tr; EBT00001686265.
DR   EnsemblGenomes-Tr; EBT00001686266.
DR   EnsemblGenomes-Tr; EBT00001686267.
DR   EnsemblGenomes-Tr; EBT00001686268.
DR   EnsemblGenomes-Tr; EBT00001686269.
DR   EnsemblGenomes-Tr; EBT00001686270.
DR   EnsemblGenomes-Tr; EBT00001686271.
DR   EnsemblGenomes-Tr; EBT00001686272.
DR   EnsemblGenomes-Tr; EBT00001686273.
DR   EnsemblGenomes-Tr; EBT00001686274.
DR   EnsemblGenomes-Tr; EBT00001686275.
DR   EnsemblGenomes-Tr; EBT00001686276.
DR   EnsemblGenomes-Tr; EBT00001686277.
DR   EnsemblGenomes-Tr; EBT00001686278.
DR   EnsemblGenomes-Tr; EBT00001686279.
DR   EnsemblGenomes-Tr; EBT00001686280.
DR   EnsemblGenomes-Tr; EBT00001686281.
DR   EnsemblGenomes-Tr; EBT00001686282.
DR   EnsemblGenomes-Tr; EBT00001686283.
DR   EnsemblGenomes-Tr; EBT00001686284.
DR   EnsemblGenomes-Tr; EBT00001686285.
DR   EnsemblGenomes-Tr; EBT00001686286.
DR   EnsemblGenomes-Tr; EBT00001686287.
DR   EnsemblGenomes-Tr; EBT00001686288.
DR   EnsemblGenomes-Tr; EBT00001686289.
DR   EnsemblGenomes-Tr; EBT00001686290.
DR   EnsemblGenomes-Tr; EBT00001686291.
DR   EnsemblGenomes-Tr; EBT00001686292.
DR   EnsemblGenomes-Tr; EBT00001686293.
DR   EnsemblGenomes-Tr; EBT00001686294.
DR   EnsemblGenomes-Tr; EBT00001686295.
DR   EnsemblGenomes-Tr; EBT00001686296.
DR   EnsemblGenomes-Tr; EBT00001686297.
DR   EnsemblGenomes-Tr; EBT00001686298.
DR   EnsemblGenomes-Tr; EBT00001686299.
DR   EnsemblGenomes-Tr; EBT00001686300.
DR   EnsemblGenomes-Tr; EBT00001686301.
DR   EnsemblGenomes-Tr; EBT00001686302.
DR   EnsemblGenomes-Tr; EBT00001686303.
DR   EnsemblGenomes-Tr; EBT00001686304.
DR   EnsemblGenomes-Tr; EBT00001686305.
DR   EnsemblGenomes-Tr; EBT00001686306.
DR   EnsemblGenomes-Tr; EBT00001686307.
DR   EnsemblGenomes-Tr; EBT00001686308.
DR   EnsemblGenomes-Tr; EBT00001686309.
DR   EnsemblGenomes-Tr; EBT00001686310.
DR   EnsemblGenomes-Tr; EBT00001686311.
DR   EnsemblGenomes-Tr; EBT00001686312.
DR   EnsemblGenomes-Tr; EBT00001686313.
DR   EnsemblGenomes-Tr; EBT00001686314.
DR   EnsemblGenomes-Tr; EBT00001686315.
DR   EnsemblGenomes-Tr; EBT00001686316.
DR   EnsemblGenomes-Tr; EBT00001686317.
DR   EnsemblGenomes-Tr; EBT00001686318.
DR   EnsemblGenomes-Tr; EBT00001686319.
DR   EnsemblGenomes-Tr; EBT00001686320.
DR   EnsemblGenomes-Tr; EBT00001686321.
DR   EnsemblGenomes-Tr; EBT00001686322.
DR   EnsemblGenomes-Tr; EBT00001686323.
DR   EnsemblGenomes-Tr; EBT00001686324.
DR   EnsemblGenomes-Tr; EBT00001686325.
DR   EnsemblGenomes-Tr; EBT00001686326.
DR   EnsemblGenomes-Tr; EBT00001686327.
DR   EnsemblGenomes-Tr; EBT00001686328.
DR   EnsemblGenomes-Tr; EBT00001686329.
DR   EnsemblGenomes-Tr; EBT00001686330.
DR   EnsemblGenomes-Tr; EBT00001686331.
DR   EnsemblGenomes-Tr; EBT00001686333.
DR   EnsemblGenomes-Tr; EBT00001686334.
DR   EnsemblGenomes-Tr; EBT00001686335.
DR   EnsemblGenomes-Tr; EBT00001686336.
DR   EnsemblGenomes-Tr; EBT00001686337.
DR   EnsemblGenomes-Tr; EBT00001686338.
DR   EnsemblGenomes-Tr; EBT00001686339.
DR   EnsemblGenomes-Tr; EBT00001686340.
DR   EnsemblGenomes-Tr; EBT00001686341.
DR   EuropePMC; PMC2147049; 18159241.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC2786422; 19801475.
DR   EuropePMC; PMC2869123; 20348308.
DR   EuropePMC; PMC2874994; 20508853.
DR   EuropePMC; PMC3938529; 24587027.
DR   EuropePMC; PMC5043019; 27746772.
DR   EuropePMC; PMC5407278; 28462059.
DR   EuropePMC; PMC6167121; 30185726.
DR   EuropePMC; PMC6256585; 30533749.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000361.
DR   SILVA-SSU; CP000361.
XX
CC   Source DNA and bacteria available from William Miller
CC   (bmiller@pw.usda.gov).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2341251
FT                   /organism="Arcobacter butzleri RM4018"
FT                   /strain="RM4018"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:367737"
FT   gene            1..1317
FT                   /gene="dnaA"
FT                   /locus_tag="Abu_0001"
FT   CDS_pept        1..1317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Abu_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Pfam matches to PF00308 Bac_DnaA, score 404.1,
FT                   E-value 1.9E-118, and to PF08299 Bac_DnaA_C, score 60,
FT                   E-value 7.2E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66286"
FT                   /db_xref="GOA:A8EQT0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQT0"
FT                   /protein_id="ABV66286.1"
FT                   /translation="MTTKEFLTIIQKEANQIDYERYLKQLVYKKVSSDNKIAIFEVNNK
FT                   YIASWIKSKFTNLIQHCFEIYDGSKPTIEIKLSNEKKSKKEILKEQTQNESTESTILNP
FT                   SYTFDSFVVGPSNQMAYNASLAVANKPGIQYNPLFIYGGTGLGKTHLLQAVGNHAIEKG
FT                   NTVIYVTIEQFMNDFTFSIKNKNMEHFRNKYRKCDVLLIDDIQFLSGKEQTQEEFFHTF
FT                   NELHNAKKQIVMTSDRLPSQIAGLVDRLKSRFEWGLTADVQIPGLETKIAIIEKKSELN
FT                   GICLSREIINFIATNLDNSIREIEGVLIRINASASLLNQEITLPMVQGLLKEQIKETKE
FT                   NVKLPDIINIVANQLNIKPSDIKSKKRTATVANARRIVIYLVRELTHNSMPDIAKFLGM
FT                   KDHSAISHNIKKANELIEKDENFKLIIENLKNKIINSRE"
FT   gene            1475..2545
FT                   /gene="dnaN"
FT                   /locus_tag="Abu_0002"
FT   CDS_pept        1475..2545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Abu_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Pfam matches to PF00712 DNA_pol3_beta, score 79.7,
FT                   E-value 8.1E-021, and to PF02767 DNA_pol3_beta_2, score
FT                   52.1, E-value 1.9E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66287"
FT                   /db_xref="GOA:A8EQT1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT1"
FT                   /protein_id="ABV66287.1"
FT                   /translation="MKFVITKNILENVIASMQPFLEKKDSSAITSHIYLEINNSNLIIK
FT                   ATDYEIGLESFIDNLTNTVDGKTTVNGSNLLGIIKRLKNEDIILEATNNNLVIKQNKST
FT                   FKLPTYDANEFPVLNKSENLKELSISTINFINSIRKITPAIDNNNPKFELNGALLDIKS
FT                   QKINFVSTDTRRLALSFLENMNNDEAQLIIPKKAIIEIQKLFLDEAKISYDNTNLVISN
FT                   QHTKFFTKLINGKFPDYERIIPSNLKHNFFLPKNVLVESIKLVTSLFSNIKITFSSKSI
FT                   IFESLDEDSEAKTQIDIDLNIPNEFFLAVNAKYLLDFLSMTNNEKVKIGFNESNLPFYL
FT                   EDDKFITIVMPIVLEK"
FT   gene            2567..4888
FT                   /gene="gyrB"
FT                   /locus_tag="Abu_0003"
FT   CDS_pept        2567..4888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Abu_0003"
FT                   /product="DNA gyrase, subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Pfam matches to PF00204 DNA_gyraseB, score 265.9,
FT                   E-value 7.4E-077, and to PF00986 DNA_gyraseB_C, score
FT                   143.3, E-value 6.1E-040, and to PF02518 HATPase_c, score
FT                   99.6, E-value 8.5E-027, and to PF01751 Toprim, score 36.9,
FT                   E-value 6.2E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66288"
FT                   /db_xref="GOA:A8EQT2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT2"
FT                   /protein_id="ABV66288.1"
FT                   /translation="MSQQEYGASNIKVLKGLEAVRKRPGMYIGDTNINGLHHLVYEVVD
FT                   NSIDEAMAGFCRNIKVTLTKDGWARIEDDGRGIPTAIHPTEGISAATVALTVLHAGGKF
FT                   DKDTYKVSGGLHGVGVSVVNALSKHLKMTVYREGKIHYQEFKEGIPQGTLEIIGDSPRK
FT                   TGTTIEFLVDDSIFEVTKYEFNILKKRFKEVAYLNPIISITLEDEAAKLKEVYHFEGGI
FT                   KQFVADMNKETALCEVISFSDRVEGVEVDIAMMYNDTYIEKTLSFVNNIRTIDGGTHEA
FT                   GFKAGLTRSISKYLSENAAAREKDTKITGDDVREGLIAVVSVKVPEPQFEGQTKGKLGS
FT                   SYVRPIAQKLTGDNLDKYFEENPTHAKAIMEKALMAARGREAAKKARELTRKKDAMTVG
FT                   TLPGKLAECQSKDPAIRELYLVEGDSAGGSAKQGRDRVFQAILPLKGKILNVEKSRLDK
FT                   ILKSDEIRNMITALGCGIGEDFDEEKIRYHKIIIMTDADVDGSHIQTLLLTFFFRFLRP
FT                   VIEKGYLYIAQPPLYRYKKGKNEIYLKDNNALSAFLIENGLESFEFEGLGYNDLLDLFK
FT                   IVSKYRAMLEQLGKRYSLLEVLKHLIENSDLVNLEFKDLYENIKDFLDKKGYNILSKTV
FT                   LDDRIQLFVQTNEGLEELIIDEELFASPYFSEATYIYSKLKERDLSVFEGRDLIEILEE
FT                   IETLAKKGAYIQRYKGLGEMNPEQLWETTMIPDNRRLLRVKIEDAEVASDTFTLFMGDE
FT                   VEPRRNYIEEHAKDVEHLDV"
FT   gene            complement(4897..5868)
FT                   /locus_tag="Abu_0004"
FT                   /note="AB0004"
FT   CDS_pept        complement(4897..5868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0004"
FT                   /product="probable thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="Pfam matches to PF00070 Pyr_redox, score 52.8,
FT                   E-value 5.8E-015, and to PF00890 FAD_binding_2, score 16.4,
FT                   E-value 7.4E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66289"
FT                   /db_xref="GOA:A8EQT3"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT3"
FT                   /protein_id="ABV66289.1"
FT                   /translation="MNEKIYDIIVIGAGSAGIACIIEAKLKNIENILLIEKTSNHSETI
FT                   RKFYKDGKRVDKDWKNQVIKLEGNIDFMDGTKESTLEYFEELLNKNEISPVYNTEVEKI
FT                   IKNENTNLFEVHTLNKIYQTKFAIICIGKMGKPNKPDYKIPTNIKKYINFNLDDCTTNE
FT                   KILVIGGGNSAAEYAYFLTNEKNNVTLAYRKPTFTRLNPINEKLLMQYQNDKKLTIKMN
FT                   KEIKELEEAENLKVKVIYTDEEIEIFDRLIYAIGGTTPIDFLKACNVKIDENLNPICDG
FT                   NFESSTKGIYLAGDIASKGEGSISTALNHGYHIIKDISAKNV"
FT   gene            5984..6367
FT                   /gene="queF"
FT                   /locus_tag="Abu_0005"
FT   CDS_pept        5984..6367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="Abu_0005"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.-"
FT                   /note="Pfam match to PF01227 GTP_cyclohydroI, score 154.3,
FT                   E-value 1.6E-043"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66290"
FT                   /db_xref="GOA:A8EQT4"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT4"
FT                   /protein_id="ABV66290.1"
FT                   /translation="MEIKYGEKEILEFDINNEENFWPNENSKNYIIDIELPEFMAKCPR
FT                   SGYPDFATIKIQYTPNKKVIELKALKIYINSFMNRYISHENSANEIFDTLYTKLEPKWL
FT                   KVIADFKPRGNVHTVIEIDSAKL"
FT   gene            6377..6964
FT                   /locus_tag="Abu_0006"
FT                   /note="AB0006"
FT   CDS_pept        6377..6964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66291"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT5"
FT                   /protein_id="ABV66291.1"
FT                   /translation="MERLVTTAQAAEILGLSLQGIHYRIKKNQLKSLKKDGKVYVYVDD
FT                   TQKYNFEEKTENHKQQNNINEIIEVKNEQIELLKKSIKWMKKQYISEIYRLEKNQKRII
FT                   EVFNSEIKLLQSAFNEMKAIYKPKLENKNQTNSSDFLPLKEFFVIMKRANKTDAEIKNI
FT                   IFKAIKNGDKRFIYNKAEKKLLILNEDFSDLI"
FT   gene            7173..7580
FT                   /locus_tag="Abu_0007"
FT                   /note="AB0007"
FT   CDS_pept        7173..7580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0007"
FT                   /product="conserved hypothetical protein, putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66292"
FT                   /db_xref="GOA:A8EQT6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT6"
FT                   /protein_id="ABV66292.1"
FT                   /translation="MVYLTIFFVSFISATLFPLGSEALLIYDIKEGYNIYLLLFFATLG
FT                   NSLGSIVNYYLGLKGEEYLIEKNLIKEKYINICKNYFDKYGFITILFSWLPIIGDPITF
FT                   VAGILKYDFKKFVILVTIAKLSRYIFIAWVI"
FT   gene            complement(7573..8379)
FT                   /locus_tag="Abu_0008"
FT                   /note="AB0008"
FT   CDS_pept        complement(7573..8379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0008"
FT                   /product="conserved hypothetical protein, possible
FT                   methyltransferase"
FT                   /note="Pfam match to PF08241 Methyltransf_11, score 34.3,
FT                   E-value 1.3E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66293"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT7"
FT                   /protein_id="ABV66293.1"
FT                   /translation="MPLVNTNLDKLNFSKLYKKQVKNSTFKSKKSSDWDKKAKQFNENV
FT                   LNSPYIKEFISKVDIKDCQTLLDVGSGPANISLQLASKLEKVYALDYSLEMLNLAKENA
FT                   KNLEINNLITIHKSWYDKWNDLPNADIVIASRSMEVKNIKKALKRLNEKANKKVYITTK
FT                   VGGSFIDNEILNQLKRKINPRPDYIYLINTLHSMGIFAKVDFIKTKNNKLQVKTDEEFI
FT                   QKVSWSLGKLTKKEEIILKEYFNNTYKHKKEADYLTWAFISWEKVI"
FT   gene            complement(8381..9235)
FT                   /gene="modD"
FT                   /locus_tag="Abu_0009"
FT   CDS_pept        complement(8381..9235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modD"
FT                   /locus_tag="Abu_0009"
FT                   /product="molybdenum ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.29"
FT                   /note="Pfam match to PF00005 ABC_tran, score 202.3, E-value
FT                   1.1E-057"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66294"
FT                   /db_xref="GOA:A8EQT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT8"
FT                   /protein_id="ABV66294.1"
FT                   /translation="MIEIKINKPLHGSNGTMNLDIDLNINKGEFVALSGLSGSGKTTLL
FT                   RILAGLENATGTLKIDNEYWLNEKYSKDSQKRDIGFVFQDYALFPNFTVLQNLLYVKKD
FT                   KELAKHLLDMTDMYELKDRYPNSLSGGQKQRVSLCRALMNKPKLLLMDEPLSALDPQMR
FT                   TKLQNEILTLHKEFNTTTIMVSHDPSEMYRLASRVLVLDYGKIVNDGLPKDILLKTKGS
FT                   QKFSFEGELLDIVRVDVIDIAIISIGQQLVEIVLTKEESKTLKIGQKVNVSTKAFTPNI
FT                   QGL"
FT   gene            complement(9222..9929)
FT                   /gene="modB"
FT                   /locus_tag="Abu_0010"
FT   CDS_pept        complement(9222..9929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="Abu_0010"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /note="Pfam match to PF00528 BPD_transp_1, score 69.5,
FT                   E-value 1E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66295"
FT                   /db_xref="GOA:A8EQT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQT9"
FT                   /protein_id="ABV66295.1"
FT                   /translation="MIEILKNIEIDPFLISFKLASITTLILFFVCLPLAWYLSQTKSKM
FT                   KPILESITALPLVVPPTVLGFYLLWSLSYNSPIGQFFQEYFGIKLVFNFYGLVIASCFY
FT                   SLPFMVQPMQSGLESLNKNMLEASYISGKGKIETLFRIALPNIKPSLMTAIIITFAHTV
FT                   GEFGVVLMIGGSIPGETRVASIAIYEFVEVMDYKNAHIYSVIMIIMSFLTLLGVYIFNN
FT                   KQKQSQVNLNDRD"
FT   gene            complement(9922..10323)
FT                   /locus_tag="Abu_0011"
FT                   /note="AB0011"
FT   CDS_pept        complement(9922..10323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66296"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU0"
FT                   /protein_id="ABV66296.1"
FT                   /translation="MSKLVAKVSKINSLDNLNIVEFDFFGKTLKMMSLGLSSDIQIGTK
FT                   VNLCVKPTNVAIAKNLSGEISLSNQLFATIENIENGELLSSILLKIENCYLESIITKDS
FT                   SSKMNLKKNDNVLVLIKASNLSIEEVLND"
FT   gene            complement(10320..11066)
FT                   /gene="modA"
FT                   /locus_tag="Abu_0012"
FT   CDS_pept        complement(10320..11066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="Abu_0012"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="Pfam match to PF01547 SBP_bac_1, score 31.8, E-value
FT                   2.1E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66297"
FT                   /db_xref="GOA:A8EQU1"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU1"
FT                   /protein_id="ABV66297.1"
FT                   /translation="MKKIALGFILLCSSVFAGTINVAVAANVSYAINDLVAEFNKTNPD
FT                   TKVQITLGSSGKFTTQIENGAPFNIFMSADMKFPETLFGKNLAITKPVIYAQGSLAMLS
FT                   SKELDFSKGINLVTDKNIEKIAIANPKTAPYGTAAVEAMKNAKVLEKVENKFVYAESIS
FT                   QAVTYATTAADVGFIAKSSLYDENMSKYKENVNWVSVDPALYTPIDQGIVILANAKDNI
FT                   EAKAFYDFILSEKAKEIFHRFGYLTK"
FT   gene            complement(11076..11858)
FT                   /gene="modE"
FT                   /locus_tag="Abu_0013"
FT   CDS_pept        complement(11076..11858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="Abu_0013"
FT                   /product="molybdenum-binding protein"
FT                   /note="Pfam match to PF03459 TOBE, score 61, E-value
FT                   3.4E-015; N-terminal:molybdenum-pterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66298"
FT                   /db_xref="GOA:A8EQU2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU2"
FT                   /protein_id="ABV66298.1"
FT                   /translation="MAISSNLTLELFDQPFLLEKRIELLMAIKKTGSINKAAKEVPMSY
FT                   KSAWETIEAMNNLSINPIVQKETGGSGGGGTKLTEYGENLLKTYHLLKEEQKKFVENLN
FT                   RIVDINNGTLKTIRRLSMQISARNQITGIVEAIEMGTVNAEVHIKLKSNNILVSIITNT
FT                   AVQNLDLKVGDEVVAIIKSSNVFISTDENLQLSARNKFQGIVDNINKGGINSEIVIDIG
FT                   NGDKIVAIITTSSVNSLNIKEKSKVGAIIKASDVMIGR"
FT   gene            11985..13229
FT                   /locus_tag="Abu_0014"
FT                   /note="AB0014"
FT   CDS_pept        11985..13229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0014"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66299"
FT                   /db_xref="GOA:A8EQU3"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU3"
FT                   /protein_id="ABV66299.1"
FT                   /translation="MDINLLLTYFILTTVFSFLIGLELKAYKMKFHENDSRIFLGTTRT
FT                   YTFIGIIGFVFYKIEPNNFSVYIAGFLAITLLYSMLYYRLLAEKNSIVLYLVAVVVYSF
FT                   GPLTNLFPFWLSSLIFVVTIFLLNAKKRLLNFNLKINIYEIETLGKMILLSAVVLPLLP
FT                   EEKIIPYLGISLYKIWLTVVVISAISYAGYIVQKYLFPSKGIFLTGIIGGIYSSTATTV
FT                   VLSKKAQGLEKNHLITASVIAATLMMYLRLIIISYIFNVEVVKTILIPFLALAFICAII
FT                   TLVYYKKASNGVSNIEVEDSNPLELGTAFIFAFLFIITMLITNFVVDNYGSSGLKFLSI
FT                   IIGFTDIDPFILSLLTGKYSIDSSVIASAIIIAAGSNNILKAVYTIWFGKDKTISSFVW
FT                   LSILGILTILVGFFI"
FT   gene            complement(13399..14226)
FT                   /locus_tag="Abu_0015"
FT                   /note="AB0015"
FT   CDS_pept        complement(13399..14226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0015"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="Pfam matches to PF00126 HTH_1, score 57.1, E-value
FT                   5.4E-014, and to PF03466 LysR_substrate, score 48.7,
FT                   E-value 1.8E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66300"
FT                   /db_xref="GOA:A8EQU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU4"
FT                   /protein_id="ABV66300.1"
FT                   /translation="MDLNLLKVFVSVANNKSISLASNELKCTQSNVTSRVKQLEKILTL
FT                   ELFHRVPKGVILTKSGEKFYPQAIELIHKMENCISSLTNENEINSLKIGSTDCNAVVRI
FT                   SPFLLKLHEDFPQMQLELFTGTTKSVTQLILDYKVDIAFISGEPKNDSLMVLKKYEEEI
FT                   AILEPQGDNTPNVTLTFKEGCIYDEFLKDYYKQKNIYVEKSLSFGSLETILSCIKVGMG
FT                   KSLLPTSIVKKMGYDKDIKITVLPKKEANIPTCLVCRKDYIPKISDYLKEMKL"
FT   gene            14324..15502
FT                   /locus_tag="Abu_0016"
FT                   /note="AB0016"
FT   CDS_pept        14324..15502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0016"
FT                   /product="conserved hypothetical protein, putative MFS
FT                   permease"
FT                   /note="Pfam match to PF07690 MFS_1, score 99.6, E-value
FT                   1.1E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66301"
FT                   /db_xref="GOA:A8EQU5"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU5"
FT                   /protein_id="ABV66301.1"
FT                   /translation="MSRLFDRNDNLAILIAGIFSIIIGIGVARFAFTGLIPPMLEDHLS
FT                   IKFVGILASLNFAGYLTGSILSVFLKDINQKVLFYRMGIVLAIATTFVLGFSTNDTFWM
FT                   ISRVLGGFAGAMALVVGSAIVMTKLKMESKTKAMGIHFSGIGFSILTTDLIARYVLSLG
FT                   YTWQDSWIVLSIFAIVLASYAIYILSFDKEVKQNVVKHKFDFSIFTFFVILLIMAYFTE
FT                   GVGFVVQATFLPDIVNTLPGLEGYGSLTWTLVGLAGIPSCIIWMRLAHNYGSINMIIIA
FT                   LLLQAIGILIPAFTSNIYLNLLSGVLYGGTFIGLVALFMNLGGQLSHGNPVILMGALTT
FT                   SYGVGQVIAPLYSVYLIEKFGNYDYALYLTAFIVLGGILLLFIAKKFEKERI"
FT   gene            15585..24281
FT                   /locus_tag="Abu_0017"
FT                   /note="AB0017"
FT   CDS_pept        15585..24281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0017"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66302"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU6"
FT                   /protein_id="ABV66302.1"
FT                   /translation="MSQVGVVKILEGGVFYAKDSSGNIRELNIGDVILENEVVFGDSSN
FT                   PTSAKVEMELSGNDVIVLNQGQQQLIDSSLNEVTFGNEEVIFTKNDIQNAWNNTTNDVS
FT                   DDMETAAGDPTQQETQAGQEEPTEEGRVAARFSARDGNSTNVVSDLRDASWTEEQTTII
FT                   PDLEDKLIEQPLPIVFTVIDGDNVVWEGNTGTYTVKAVDAAGNPIIVNQDTIVYVRYTN
FT                   IETDDNDTQYTHNTTIEVVIKAGTSQATFTVQTKDDYLADNDERFNLEITGNNSTEFDM
FT                   RTGNQTGGQTNVDTKILDNSNPSNPGGEDGGYGSEDTVYAIIEGTTTVNEGDSAQYIVK
FT                   LVDKDGNPVTVTKDTEVTIKYTNKTTQDGDTQYKDNDTIKITIKAGENSSDKFDVDTID
FT                   DYLADNGEKFNLGITNVDDQGQFEKVNIGDINGDKTNVDTTILDNTTDKPNENSTVESN
FT                   QENVILKIVAVGEDGNPIIKDGKYTFENNVAEGSNAKYMVLAFKPATTEFKTTDVVDTQ
FT                   AGTVTIKTTDDTAKTTGTKDNAELDYVSETSKTVTLGEVFEIKTLDDYLKDDGEKYKVS
FT                   INDKTYEHPASGAIYENVVTNTDPVTTTIKDNTTPNTETNVEDVKIVLVAVSSVTTTIA
FT                   DITNSDGTLKVTNTNETPEGGKLYYIAVAVDKDGKPLATQGGDVTINYGTTSTTSDKDA
FT                   TAGVDYDNTTKVTTKVGVVFEVKTKDDYYAEGDENFTVKITDLKNSPYETPSIDTTKDT
FT                   VTSTIKDNAPTINGTVVSGGEDTDGNTYGAEDTVYAIITGETTVNEGGVVTYTVKLVDK
FT                   DGNTVIPTKETTVTVTYTNIGTTSTDDTNKTNNQEIAVKIDASGKGTFTVETKDDYYAE
FT                   ADENYNVKITNVQNTGEFENVKFDSYPNTIPNNPSNNVTTTIKDNPSKVEQPDTGTGND
FT                   DPINGSYGKEDTVYVKIEGNPTVVEGGKLSHTVTLVDKDGNLVTIPTGESVTVTLTYTI
FT                   KQDGGSSDDYVTKTETITIKGGTSSTTFENITKVDFVTEGKEVYEITISKVEQSGAFEN
FT                   VAIDSTANKVTDTILDGITLTNPENTKVDEDDFYKGSSTTKNNLSSTKSLGFTIPTNYE
FT                   TEVGTFSVNFVNTPTVTVDGNNYALTSNGVAVTYTVNGNTITAKAGNTTVFDIVLSKNG
FT                   TYTYKQYANIDHPKAGNTNTDYENVNTNDNIDLNFKFNITTTPKNGEPTTTSPTQEFKV
FT                   TVNDSTPDAETRTETVNEDGTLTIVLSDESFKDGKIEIDNGKDGYQTVAKNGTVNIYDG
FT                   DEIIGTLTNNANGTLTFKPNADYSKYEADNGYLPNFKYKVSDTDGDYAQGQINIQVKPG
FT                   VDGVTITTNKVETYEDNKNTQEGQNSVSLGLVQPTIKDNTDKNDTAKGDHGERVDYITL
FT                   NFTNGTSVKGAVLEKADGTDIATISSNSQTVKIVIVKADGSVDTDFHHSNITLGQSGVV
FT                   YLTKEEYEGLKIQHAEDNDTDIKINISTKTYEVDDSGKPLSNSQANNQGKTDSATVTVV
FT                   IKPVTDDISLKWNDESAGTISDSGKTYTFNDIKEGNDTIDLKALLTKTSGTELNDGTTG
FT                   NKADLDGSEKRTYTISGIPEGTVVTLGGQTAVANDKGIATIVFSDTNNKNADPDFSMKF
FT                   PTSFSGTVNGKITLSVYDNGVESGQRDTTDYGNGTNGIKTAEVDFKVNVNPVADEATLK
FT                   VGQVVGYEDTARNTNKNIQDKDGTIKHPENGIALDIKVSSTDTDGSETFTVTIKDIPDG
FT                   GAIFVKEPLTGKDILVTYAEDGTPTIKVWNNGVLEDYTGTTITANKGSITIEKFDNENP
FT                   PKFIPPHNEHGDFKLNVDAKTVDTVIIDGQPVTNVQDVATNKDILVVVKDVADSVIGND
FT                   YNVENLSLADGTNKDYNLVTQEDTQIKLDSVFKDSTKLSSYDKESEDLTIILKSLPKGV
FT                   ELEGNVTLINGQYIFKASDISSIKIVTPPNYSGELNFDITYITTEKGEANNPSKTHDSK
FT                   QETDKISIFVKPTIDAQFDSQTTKAEDSEIVDGGNSYYKVDLGISHQNGDNDEILESVT
FT                   IKAPEANSGYKLFIIDGNTKTEITSDYTLKTSELNKVYVEVKENQHGSFDIKGTYTVKD
FT                   SQYVGKDVNYDTKETKDFTHKLTITPVTDTPTIEVETGTQTHINVNAGENTEIKIPVKV
FT                   SSEDTDGSENITKIVISGVPKGVIIDTGSAELDAKITVSEHNGIYTITGHNLNSSNFKD
FT                   IVFKVDGNANFEYRDITITAYTKDAQGSIEEQTSTKITLDKTHNGNGGGTGTGPKLDII
FT                   VDEVKKDFNATEDTEFNFLDVFKVTVADNSNDGRTELNFKIDVGSNATLKGLDAYKNAD
FT                   GSYTIKGNRADIESVLANLKVVPNKDFNSNQDGDGISIKVETNGKESTIKVPVTPVTDS
FT                   LNVEITANDSTTIDENGEFNFDIKLTNNSDKEFTNINDFYVVVNENFEAGESSKGELYL
FT                   GNTKLELLDGKYKLPADYKLGDSLNLTYKSGEDRHGAVEIKVIALNKETGAANELTSTG
FT                   TTTITVKPVASSEIEVKKVQDGIEDKEMASAKLNVVKADPSEKFESVLIKVASGVAVYY
FT                   DNGNALAMNLGDGSWLVPVNSDGTLPQIFFKGNEHFGGEIKFDAIINVKDGNSKSTIEL
FT                   KDSSVYIKEVADGVTIDPTKTGIDAKGFEWTSLNLNANMKDVDGSEKMHFTLEGLDSSA
FT                   QFRIVDKDGNITDLSSQSKFENGKWTINGIEYEDINNIQITHDKSVKDIKVEAWTQDGQ
FT                   DADISNKVEGKFDLNFTQDALKDGTLTLGKEMNIDFSKIESGDIKDVSTIDLGAQGENK
FT                   LLNLTLQDVMDIGKKDGSGNINLTILGDEKDGVSFAKNDGWKKSETTITENNKTFDVYT
FT                   NDGNSTVQVKVEQPISDGITN"
FT   gene            complement(24340..25242)
FT                   /locus_tag="Abu_0018"
FT                   /note="AB0018"
FT   CDS_pept        complement(24340..25242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0018"
FT                   /product="ribosomal large subunit pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="Pfam match to PF00849 PseudoU_synth_2, score 141.6,
FT                   E-value 2E-039"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66303"
FT                   /db_xref="GOA:A8EQU7"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU7"
FT                   /protein_id="ABV66303.1"
FT                   /translation="MAFTLRKYDAIKGKKIQLFLIQNLKFDPKIGQRLTSKGRIFDENM
FT                   NQINAGDEIPTEHIFIAVFEGQTKGLKPLLEFEDFAIFDKPTNLMVHPISKNTSYSLLD
FT                   EIRYHFGENANLIHRIDAETSGLVIVGKNKKSEIELKDMFQEKKYHKSYLAIVQGEIKE
FT                   ELKINKALDREGKAIGVRMKVCTQEEGGKESITIIKPIIYDKEKNLTLVEALPLTGRQH
FT                   QIRVHLHSMGHTILGDPIYGVDDENAENYLNKTLSEEDRFKVTKSYRLWLHANYLEFNY
FT                   KDVTYKIFSKNRDLYKEFF"
FT   gene            25356..26684
FT                   /gene="purB"
FT                   /locus_tag="Abu_0019"
FT   CDS_pept        25356..26684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="Abu_0019"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Pfam match to PF00206 Lyase_1, score 189.2, E-value
FT                   9.4E-054"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66304"
FT                   /db_xref="GOA:A8EQU8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU8"
FT                   /protein_id="ABV66304.1"
FT                   /translation="MVERYARVEMSSKWTQEARYAAWLEVEKAAVKAWNKLGLIPDEDC
FT                   EKIVKNASFSVERIEEIEAITKHDLIAFNTSVSESLGEESRWFHYGMTSSDAVDTGVAL
FT                   QMRDSLKIIIDDVKMLMESIKKRALEHKFTLMVGRSHGIHGEPITFGLTLAVWYDEVAR
FT                   HLKNLEETMDVIAVGQISGAMGNFAHAPLELEEYAMAELGLKPEPCSNQVIHRDRYARL
FT                   ATALALLASSVEKFAVQVRHLQRTEVYEAEEYFAKGQKGSSAMPHKRNPILTENITGLA
FT                   RMIRAYAIPAMENVALWHERDISHSSTERFWLPDAFITTDFMLHRMNSVIANLTVMPEN
FT                   MMKNLNLTGGLVFSQRVLLELPLQGVSREDAYRIVQRNAMKVWEEIQKGKPTTNEKGES
FT                   LYLQYLLGDEELRASLSEEQIRECFNFDYYTKNVDAIFKRVFK"
FT   gene            26695..29079
FT                   /gene="nrdA"
FT                   /locus_tag="Abu_0020"
FT   CDS_pept        26695..29079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="Abu_0020"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="Pfam matches to PF02867 Ribonuc_red_lgC, score 429,
FT                   E-value 6.1E-126, and to PF00317 Ribonuc_red_lgN, score
FT                   115, E-value 2E-031, and to PF03477 ATP-cone, score 38.5,
FT                   E-value 2.1E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66305"
FT                   /db_xref="GOA:A8EQU9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQU9"
FT                   /protein_id="ABV66305.1"
FT                   /translation="MAIMIQKRNGRKELLDITKIQKMSMEATKGLEGVSQSELELDAHI
FT                   KFIDGMHSKDIQDALIKTAVEKIDIDVPNWTFVAARLFLFDLYHRVGIATHGVKGEAYC
FT                   HLKDYIKFGIEAGRLIPSIADGYDLDELNAYIDPSRDLLFNYLGIKTLYDRYLIKNRKA
FT                   EPIELPQQMFMAIAMFLAQNEKDKQSKAKEFYDVVSKFEVMLATPTLSNARTNRHQLSS
FT                   CYIGSSPDNIEGIFDGYKEMALLSKYGGGIGWDWNQIRSLGGVIDDHKSAAGGTVPFLK
FT                   ITNDLAIAVDQLGTRKGAIAVYLEPWHMDIVDFVDLKKNSGEERRRAHDLFPALWISDL
FT                   FMERVMEDSYWTLFDPYEVRDLSETFGDEFKAKYVAYENDETITKDRMKAKDLWKKILT
FT                   SYFEVGSPFLCWKDTANRTNPNSHVGHIRSSNLCTEIFQNTNPNHYKIKLEFEDGTVST
FT                   YEESDLVVVDGGVTKKANKVSALDSVNGKRVFIVEKEKIDGDTAVCNLASINLSKINTK
FT                   EDIERVVPTAIRMLDNVIDLNFYPLRKVKATNLKSRSIGLGVMGEAEMLAQHQLAWGSS
FT                   EHFKKIDQIMEAISYNTIKSSSDLASEKGVYPTFEGSKWSKGIMPHDLAPQAVNALVDK
FT                   DLFDTSYDWDVLREKVKKDGMRNGYLMAIAPTSSISILVGTTQAIEPVYKRKWFEENLS
FT                   GLIPVVVPRLSPETWAYYTPAFEIDQLQVIKAAAIRQKWIDQGQSTNIFMSLDKASGKY
FT                   LHEIYTLAWKLGLKSTYYLRSQSPEAKNDVEDRSMECAGCQ"
FT   gene            29209..30228
FT                   /gene="nrdB"
FT                   /locus_tag="Abu_0021"
FT   CDS_pept        29209..30228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="Abu_0021"
FT                   /product="ribonucleoside-diphosphate reductase, beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="Pfam match to PF00268 Ribonuc_red_sm, score 82.7,
FT                   E-value 1E-021"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66306"
FT                   /db_xref="GOA:A8EQR9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR9"
FT                   /protein_id="ABV66306.1"
FT                   /translation="MERKTNYNPDSKESLNDRRVFGGNSDGMINFTRMKYQWALNLWDT
FT                   MEANTWFPREVQMTGDAKDYKFLTPAEKRMYDLVLSQLIFMDSLQTNNLMDNINPYITA
FT                   PEINACLARQSYEEANHSKSYAVMVESISDNTDLIYDMWKNDAKLREKNTYIAEVYKNL
FT                   SGDIDDRKIVLALFANQILEGLYFYAGFAAIYALGKSGKMLGSSQMIRFIQRDEVTHLL
FT                   LFQNMINSVRKERPDLFTSELEETVRAMFRKAVDLEASWGAYITQGQILGFTDGIIRQY
FT                   IEYLADRRLEAVGYKAEYGVKHPIPWVDGYASFNDQRTNFFEGNVVNYSKGSIDFDDF"
FT   gene            30386..31249
FT                   /locus_tag="Abu_0022"
FT                   /note="AB0022"
FT   CDS_pept        30386..31249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66307"
FT                   /db_xref="GOA:A8EQS0"
FT                   /db_xref="InterPro:IPR031709"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS0"
FT                   /protein_id="ABV66307.1"
FT                   /translation="MKYLLIFFAIFAVVIIVIAISFASGVISVLPKEIGEYGQLGDFFG
FT                   GTLNPIFAFFAFLTLLYTVYLQSETLKVSRKELLATKEELEKSRIAQEEQSESLKLQNQ
FT                   ATKLQMFENTFFKLFEQHNKMLDNCYNSHGIISILNYQSNRINDVGGVLKDANKNELID
FT                   NFRYTNEHNNAVKNYFMVLYQLLKFIDIQCIKNNFDAKFFTNMVRAILDNEILKALAVN
FT                   IVAYKDFTQYKEYVEKYELFEHLYIDDKDVNSNLLFDVLIEYDKKAFGKNEKILDKYNE
FT                   LKESKQ"
FT   gene            31307..31720
FT                   /locus_tag="Abu_0023"
FT                   /note="AB0023"
FT   CDS_pept        31307..31720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF03061 4HBT, score 35, E-value
FT                   4.8E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66308"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS1"
FT                   /protein_id="ABV66308.1"
FT                   /translation="MLTQNIMPRFSETDALGHINNNTYGVWFEAAREPIYKLFLPNLNI
FT                   KKWCLVMAHSSNDFLKEVFWGEEVIVKTAVSKIGNSSFELKHAVYQKGVLCTSSKTVLI
FT                   HYDFDSKIAIKIPDNIKAKLEEHIFTDNWDLKI"
FT   gene            31737..31988
FT                   /locus_tag="Abu_0024"
FT                   /note="AB0024"
FT   CDS_pept        31737..31988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66309"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS2"
FT                   /protein_id="ABV66309.1"
FT                   /translation="MPISRVKDFLENELENLDNFSYKIDNDDNHIYVIFSIILGENSNK
FT                   ELTFKLLNNILYLHSITYGWKPVEKGSANKYFWIEVLK"
FT   gene            32050..33000
FT                   /locus_tag="Abu_0025"
FT                   /note="AB0025"
FT   CDS_pept        32050..33000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0025"
FT                   /product="hypothetical protein, OmpA domain"
FT                   /note="Pfam match to PF00691 OmpA, score 75.9, E-value
FT                   1.2E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66310"
FT                   /db_xref="GOA:A8EQS3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS3"
FT                   /protein_id="ABV66310.1"
FT                   /translation="MSISGKIILLLFIFLLLNFISIFTFNYDEYFKDKSGSNIYFENKS
FT                   SFNLFNKTEYKPSDFTITKIDNSIELSGTFENQKVAQDVIQALGINKEGTLTYQNNVVV
FT                   DKGVLETIFLLIVPFKDFFADNSKISVINNEILLSGELKNKMYKNLIDTIILQKSKNII
FT                   LKTEISIPEDNPINNQQNENSNEEVIKNETLKLPEIQLLINNILKDRKISFERKSSIPT
FT                   EQSQNTIKEIAKILNENPNFKVEVAGHTDSRGEAALNKQISQDRANSVKNILVNSGVNE
FT                   TRIKAIGYGEEFPIAKDDENGLSEINRRVEFIIGE"
FT   gene            33004..33477
FT                   /locus_tag="Abu_0026"
FT                   /note="AB0026"
FT   CDS_pept        33004..33477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66311"
FT                   /db_xref="GOA:A8EQS4"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS4"
FT                   /protein_id="ABV66311.1"
FT                   /translation="MFEIAPFIVTNLVIALVIGIFIGYLIGKKRNEIKTIKTDNEESME
FT                   NKKVRFRINPIFNKTSSLDYKPMVLSSSSKIDNFKKIKGINSQIEKNLYNLGIFHYEQI
FT                   ANWTNKNVEWIEGFLELPFHVRNNQWVEQARILKNGNETTYSKQVENGEIEVD"
FT   gene            complement(33483..34469)
FT                   /locus_tag="Abu_0027"
FT                   /note="AB0027"
FT   CDS_pept        complement(33483..34469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0027"
FT                   /product="zinc-containing alcohol dehydrogenase superfamily
FT                   protein"
FT                   /note="Pfam matches to PF00107 ADH_zinc_N, score 70.2,
FT                   E-value 6E-018, and to PF08240 ADH_N, score 38.1, E-value
FT                   2.9E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66312"
FT                   /db_xref="GOA:A8EQS5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS5"
FT                   /protein_id="ABV66312.1"
FT                   /translation="MKAFVVDKITDDKFICDVRDIAKPKCEKDEIIIKATYSCLNYKDA
FT                   LSSIGHPGVTRNFPHITGVDVAGTVFESNSTIFKVGERVIVTGYDLGMNSDGGHSEYVK
FT                   VKASWVARIPDCISDKDIMIYGTAGLTAALSINELISNDISPESGDILVTGATGGVGSI
FT                   AVSILNKLGYNVVALSGKEEKTNYLKSIGANEVIFRNEFLENIKKPLLKEKYAGVVDTV
FT                   GGDILAQALKQVKYDGVVTCCGLTASYELNTNVYPFILRGVRLIGIDSVECKLSKKQLI
FT                   WEKLASTWKIDNLKEITTEITLNEIKEVCQKLLSGEVTGRYIVKIES"
FT   gene            34511..34918
FT                   /locus_tag="Abu_0028"
FT                   /note="AB0028"
FT   CDS_pept        34511..34918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0028"
FT                   /product="conserved hypothetical protein (DUF24 domain
FT                   protein)"
FT                   /note="Pfam match to PF01638 DUF24, score 164.8, E-value
FT                   4E-052"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66313"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS6"
FT                   /protein_id="ABV66313.1"
FT                   /translation="MFYNSKNYLLRNVLTKKILLERNMTKKINQDNINTEFKCPVETAL
FT                   DVLAGKWKILIIWYLKDEKKRFNELQKLLPKATQKMLIQKLRELENDGIVHREVYPVVP
FT                   PKVEYSLTEYGKSLKPIIKQLYLWGDNHKKR"
FT   gene            complement(34920..35816)
FT                   /gene="gpsA"
FT                   /locus_tag="Abu_0029"
FT   CDS_pept        complement(34920..35816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="Abu_0029"
FT                   /product="glycerol 3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="Pfam matches to PF07479 NAD_Gly3P_dh_C, score 220.4,
FT                   E-value 3.7E-063, and to PF01210 NAD_Gly3P_dh_N, score
FT                   65.9, E-value 1.2E-016"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66314"
FT                   /db_xref="GOA:A8EQS7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS7"
FT                   /protein_id="ABV66314.1"
FT                   /translation="MQNNSIAVIGAGKWGQALHFALSQKQKCYITSRTKRELDNFVDLE
FT                   TAMDCEYLVIAIPAQEIRTWLKENFIFKGQKILVASKGIEASSGEFLNEIYASFVPDEN
FT                   IGFISGPSFAAEVIKGLPCALVINSTSKNLYDLFQPFFPNFIKTYYSKDVIGAEIAGAY
FT                   KNVLAIASGICEGLQLGKNAQASLIARGLVEMQRFGKHFGAKKSSFLGLSGAGDLFLTA
FT                   NSTMSRNFRVGLGLSQNKKLEDILEELGEVAEGVKTADAIDKLSKKYKIYTPIANEVKL
FT                   ILNGKNPKDSLKDLLKN"
FT   gene            complement(35818..37251)
FT                   /gene="gatB"
FT                   /locus_tag="Abu_0030"
FT   CDS_pept        complement(35818..37251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="Abu_0030"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="Pfam matches to PF02934 GatB_N, score 513.3, E-value
FT                   2.4E-151, and to PF02637 GatB_Yqey, score 194.1, E-value
FT                   3E-055, and to PF01162 GatB, score 122.1, E-value 1.4E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66315"
FT                   /db_xref="GOA:A8EQS8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS8"
FT                   /protein_id="ABV66315.1"
FT                   /translation="MSSMFEVIIGLEVHAQLNTKSKLFCSCATSFGEKPNTNVCPTCLG
FT                   LPGALPVLNKEAVHKAIMLGTALKSKINQKSIFNRKNYFYPDLPSGYQISQFEVPVVGL
FT                   GELTIDFPDGRQKTIGVTRAHLENDAGKNIHSGNVSQVDLNRAGTPLLEIVSEPDMRSA
FT                   EEAILYLKKLHSIVRYLGISDANMQEGSFRCDVNVSIRPKGDTNLYTRCEIKNMNSFRF
FT                   IEKAIHYEVNRHIEAWEDGVHSTEIVQETRLFDPNTGETRSMRGKEDAADYRYFPDPDL
FT                   LPLIITNEMINEYSKIPELPDEKKDRFVKEYGIKEYDASVITSSLEMANYFDEMMKEGI
FT                   SAKNAVTWLTVELQGRLKEGVTIEQSSIEAKTLATLVKRIEDNTISGKAAKEVLDYLME
FT                   NSSSVDEAIEKLGLKQVSDDGALLTIIDEILNANQDKVAEYKAGKEKMFAFFVGQTMKA
FT                   SKGTANPNRVNDLLKERLS"
FT   gene            complement(37261..38085)
FT                   /locus_tag="Abu_0031"
FT                   /note="AB0031"
FT   CDS_pept        complement(37261..38085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66316"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQS9"
FT                   /protein_id="ABV66316.1"
FT                   /translation="MHKLLLSLLLGSTLSFASMVNGVAILVNEEPITLYDIERTMVVNK
FT                   IPKNEAVSYLIDKILYDQLVQEYNITADIFEVNDYIEKLANSNGMDIYAFKAIIKQEYP
FT                   DYSVFENEAKNTVIRQKLVQKLVKGQLAIATDEDMQLYYEKNRNKYLTAKTFDVTQYSS
FT                   TSKEALMEVAKNPIIIPSEVQRTSLKLNTEDIQAQLQYLLNGTKVNSFTPIFTANKQYV
FT                   TFFITKKEGTAPLSYESVKARIFNDIMMNREQKYLKDYFEKQKLIADIKVIR"
FT   gene            complement(38162..40999)
FT                   /locus_tag="Abu_0032"
FT                   /note="AB0032"
FT   CDS_pept        complement(38162..40999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0032"
FT                   /product="oxidoreductase, FAD-binding/iron-sulfur
FT                   cluster-binding protein"
FT                   /note="Pfam matches to PF02913 FAD-oxidase_C, score 231.9,
FT                   E-value 1.2E-066, and to PF01565 FAD_binding_4, score 95.2,
FT                   E-value 2.7E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66317"
FT                   /db_xref="GOA:A8EQR2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR2"
FT                   /protein_id="ABV66317.1"
FT                   /translation="MLESRYQKFFDEISLKISKDKIFTDKLHTLAYGTDASFYRLIPKI
FT                   VIKTDNSKEVQDIIELANSMNLSITFRAGGTSLSGQAISDSILVITSRNFSNFKIASDA
FT                   SYISLEPALTGAQANGLLARYSKKIGPDPASINAAMIGGIAANNASGMCCGISQNSYKT
FT                   VKSMKLIFSDGTKLDTADENSKNEFRKTHKEFLENLNKFSRETKSNEELRAKIEKKFKI
FT                   KNTCGYSINALIDFEDEFEILQHLIIGSEGTLAFIEEITYYTVEDLKDKASALIYFKDM
FT                   KEACHAVTKLKLARDSKEIIVDAVELMDRAALRSIENDPVMPEFIKDFDEDVTALLIET
FT                   RALSDEKLNIQIEQIEDLLKEFEVRRKIYFTKDEQEYNLYWKIRKGLFPAVGAVRVTGT
FT                   TVIIEDVAYPIEVLAEATLELQGLFQKYGYSEALIFGHALEGNFHFVFTQDFSDVKEVK
FT                   RYDDLMNEVVNSVAVKYQGSLKAEHGTGRNMAAFIEVEWGKEAYNIMKKIKSLFDPKGL
FT                   LNPGVIINDDKEAHLKNLKTLPATNEIVDKCIECGFCEPTCPSNELTLTPRQRIVINRE
FT                   ISRLETIGNYKEAKEYKELYQYDGIETCATCSLCSTACPVKIDTGSLTKHLRAEQLTSK
FT                   EKSIANFVANNFGITLKGIRFGLHSANFIHRTLGTSNMEAFTKTMRDLSKNKLAKWSVY
FT                   MPKGTNINLNFEQQVKDKKVVYFPSCISRTMGLNDMSKEEKELFEVTIEVLQKAGYQII
FT                   FPQNLSNLCCGMPFSSKGFNDAAHAKSSQLEEALLNASEFGEYPILCDTSPCTKKMMES
FT                   FSHKLSIYEPIEFALEFLTKDLEFTPIDEPITIHTTCSSRKMGLEDKFKKLANLCSTNV
FT                   IVPADVKCCGFAGDRGFNFPELNDSALRYLKEQTNGAKMAFSTSKTCEIGLSEKSGLDY
FT                   NSIFYLINRVTKERS"
FT   gene            complement(41118..42758)
FT                   /gene="lctP"
FT                   /locus_tag="Abu_0033"
FT   CDS_pept        complement(41118..42758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="Abu_0033"
FT                   /product="L-lactate permease"
FT                   /note="Pfam match to PF02652 Lactate_perm, score 950.5,
FT                   E-value 6.1E-283"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66318"
FT                   /db_xref="GOA:A8EQR3"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR3"
FT                   /protein_id="ABV66318.1"
FT                   /translation="MQTWQQVYAPIGGSLGLSALVALIPIVFFFLALAVFRMKGHYAAI
FT                   ITLALSMIVAVFGFEMPVNMVFASAEYGFLFGLWPIAWIIVASVFLYKLTVKSGQFEII
FT                   RNSIISITEDQRIQVILIGFSFGAFLEGAAGFGAPVAITAAILVGLGFKPLYAAGLCLI
FT                   ANTAPVAFGALGVPIIVAGQVTSIDAFTIGAMAGRQLPLLSLIIPLWLVAIMDGWKGIK
FT                   EVWPAALVAGASFAISQYLTSNFIGPELPDVTSAIVSIVATTVFLKYWKPKNVMKTVEL
FT                   DEVVSSSHTSAQVFKAWSPFIILSVMVTIWTTGWFKAFFAKGQVLASTIFKFEFSAIHN
FT                   MIFKMPPITSAPKSFDVVYTFNPISATGTAIFLTAIITLFIFRLNISTATKTMGETLFE
FT                   LKWAIVSIGMVLGFAFVMNYSGMSSTMALVLANTGFLFPFFSPFLGWLGVFLTGSDTSS
FT                   NALFCGLQQQTAQQLGLNETLMVAANTTGGVCGKMISPQSISIACASTGIVGKESDLFR
FT                   FTVKHSLILVVIMGLITMTQAYVLTWMIP"
FT   gene            complement(42849..43493)
FT                   /locus_tag="Abu_0034"
FT                   /note="AB0034"
FT   CDS_pept        complement(42849..43493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0034"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 81.2,
FT                   E-value 2E-024, and to PF00486 Trans_reg_C, score 56.1,
FT                   E-value 1.1E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66319"
FT                   /db_xref="GOA:A8EQR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR4"
FT                   /protein_id="ABV66319.1"
FT                   /translation="MKILLLEDNQKLNETITKRLKMKNYTVISFTDGAEAYEKITEGFS
FT                   CFILDINVPNVDGINILKKIREFYEIVPVIIISASVELDIIKQSYDFGCNDYLKKPFFI
FT                   DELEIKIEKLCQIKNDKIYFDENSYFDFISATITINDEEIRLTKKEKLLMNLFLSKKNQ
FT                   VITYETIENYVWEGNFVTLESIRSLIRRLRKILDKEFIQTVIDTGYIFKNI"
FT   gene            complement(43495..45687)
FT                   /locus_tag="Abu_0035"
FT                   /note="AB0035"
FT   CDS_pept        complement(43495..45687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0035"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 74.1,
FT                   E-value 3.9E-019, and to PF08448 PAS_4, score 54.9, E-value
FT                   1.4E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66320"
FT                   /db_xref="GOA:A8EQR5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR5"
FT                   /protein_id="ABV66320.1"
FT                   /translation="MKYFLLFSILFFNILYASQNKEVLLIHSYHKGYAWTDDISKAIDK
FT                   NFSEHKDIELTTVYMDTKRIDDSSYLEDLSKLYKQQFSNRKFDLVILSDNNAFDFVSKY
FT                   YDYLFKDAPVLFCGINNYNKTILDKLPLKEVSGVAEEVDIEKNFELISKLHPNLKNLLI
FT                   INDKSITGLAVKKDLNPIIEKYSKKFNIEYTDNLEISDLKDKVSELEKGDSAILFVLLF
FT                   KDTTGKYFTYKQSFEEVRKVSQVPIYGLWDFYLNSGMVGGLLTSAIAQGDTVSKMALDV
FT                   LNGKDIKDIPVVEKSPNLYIFNYDELKRFNLNVSKYIDNPIIINEPSSIYKEHKNFFII
FT                   TILTISLLTIIVVVLKANIQRREKLERELSNRIEFDKVLLDTIPNAIYYKNVDGHFLGC
FT                   NTAFASLVSSTKEEIIGKTAFDFFPTEIATKNTQIDKEVLKTFTTISFEFTFYTLSNEM
FT                   KHIILNKAAYKNIDGTIGGIVCIMDDMTERTQQRQFLIQQSKLAEMGDMIAAIAHQWNE
FT                   PLVELSALVQDIETSYLLNELKDNDVKNFVNDSMIQIKYMSKTLSDFRNFLKPSTKKVL
FT                   FSISKALNEINEIIGKQVFYSNINMNFNYKNKNEELLIYGYENEFKQVLLNIINNAKNK
FT                   IVEKNLPLNKKGEININIQRCENCNMIEIIDDAGAIDEKIINSIFEPYFTTKENGMGLG
FT                   LYMAKIIIEDKMKGTISVRNDKNCVIFTIKLPFKKA"
FT   gene            complement(45712..46299)
FT                   /locus_tag="Abu_0036"
FT                   /note="AB0036"
FT   CDS_pept        complement(45712..46299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0036"
FT                   /product="conserved hypothetical protein (DUF162 domain
FT                   protein)"
FT                   /note="Pfam match to PF02589 DUF162, score 34.4, E-value
FT                   3.2E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66321"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR6"
FT                   /protein_id="ABV66321.1"
FT                   /translation="MTSKEKILNSIRENNIVKDVKLPSYENFGIKFDNKFETFSTMLES
FT                   VGGKALVIEKEDLDKTIKELYPDEKIIASNVDFCSLGNFDSNSQDDAHNLKDIDLAIVK
FT                   GNFAVAENGAIWMKDESNRHRSLYFIAQNIVIVINENEIVNNMHEAYEKLSFEKAGFGV
FT                   FISGPSKTADIEQSLVIGAHGPKSGYVIFIKS"
FT   gene            complement(46292..47671)
FT                   /locus_tag="Abu_0037"
FT                   /note="AB0037"
FT   CDS_pept        complement(46292..47671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0037"
FT                   /product="iron-sulfur cluster binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66322"
FT                   /db_xref="GOA:A8EQR7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR7"
FT                   /protein_id="ABV66322.1"
FT                   /translation="MSTNHNHSDNATKFVANDERMHWHDQALWFVREKRDRASKSIPEW
FT                   ENLREYANQIKTHTMANLDKYLLEFEKNATEKGITVHFACDAKEHNEIVHKILSENNVK
FT                   KLVKSKSMLTEECHLNPYLESRGIEVIDTDLGERIVQLRHEPPSHIVLPAIHLKKSDVS
FT                   DTFHEKLGTEKGNYDPTYLTRAARAALREDFLTADAGLTGVNFAIAQTGGVVVCTNEGN
FT                   ADMGASVPKLHIASMGIEKIIPRLEDLSVFTRLLARSATGQPITSYTSHFHGSVEGGKM
FT                   HVIIVDNKRSQFLSSQKNKKALNCIRCGACMNTCPVYRRSGGHSYEYVIPGPIGSILGS
FT                   ARHPEAHNSLPFACTLCGSCTNVCPVKIDLDSQLYSLRQDLGEADLIDSKKKMAMRVTT
FT                   WLMSKPILFDFLGKTARFIVPKLPNFIIYNKANAWGKQRDLPKFPKKSFKEMFKDGDLD
FT                   D"
FT   gene            complement(47668..48417)
FT                   /locus_tag="Abu_0038"
FT                   /note="AB0038"
FT   CDS_pept        complement(47668..48417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0038"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="Pfam match to PF02754 CCG, score 55.2, E-value
FT                   2E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66323"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQR8"
FT                   /protein_id="ABV66323.1"
FT                   /translation="MKIGLFIPCFMNELYPDICKATYKLLKNQGLNIDYPLNQTCCGQP
FT                   MANSGCAKDVKVLAINFVNNFKDYDYIVAPSGSCVTMVKEHYAEFFNDDKDYNKVKASI
FT                   YEVCEFLHDIIKIENIKFDHSFPYKVGVHNSCHGHRVLKLATASELNIPYDSKLKNLLN
FT                   KVNNIELVTLKREDECCGFGGTFSVAEEAISVAMGKDRIKDHLDSNAQIITGADMSCLM
FT                   HMDGIINRDKNPIKVMHIVEILAGVRP"
FT   gene            complement(48510..48953)
FT                   /locus_tag="Abu_0039"
FT                   /note="AB0039"
FT   CDS_pept        complement(48510..48953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0039"
FT                   /product="dCMP deaminase, putative"
FT                   /EC_number="3.5.4.12"
FT                   /note="Pfam match to PF00383 dCMP_cyt_deam_1, score 125.7,
FT                   E-value 1.2E-034"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66324"
FT                   /db_xref="GOA:A8EQV0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV0"
FT                   /protein_id="ABV66324.1"
FT                   /translation="MLNDRSFINIAKEIALASKCVSKQVGAVIVKDGRILSTGYNGTPA
FT                   GYINCSEHWKGEYTKDHHEWSKTYEIHAEMNAIIWAARKGISIEGGTIYVTLEPCSECS
FT                   KNLIASGIKRIVYEKAYEHTNSEIISKFLEDNGVKIEQIPAIS"
FT   gene            49110..49583
FT                   /gene="accB"
FT                   /locus_tag="Abu_0040"
FT   CDS_pept        49110..49583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="Abu_0040"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /EC_number="6.4.1.2"
FT                   /note="Pfam match to PF00364 Biotin_lipoyl, score 94.5,
FT                   E-value 2.8E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66325"
FT                   /db_xref="GOA:A8EQV1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV1"
FT                   /protein_id="ABV66325.1"
FT                   /translation="MDFKDIKELIRVFDKSELNKLRIKEADFEISMQRGFEGGVTTVTT
FT                   APAVAVSAPVAQVASSVVAPAAVTSGEGSLLSKGDTINAPMVGTFYSSPSPESPAFVKV
FT                   GDTVRKGQTLCILEAMKIMNEVEAEFDCKILEILVQDSSPVEYDMPIFVVEKI"
FT   gene            49593..50945
FT                   /gene="accC1"
FT                   /locus_tag="Abu_0041"
FT   CDS_pept        49593..50945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC1"
FT                   /locus_tag="Abu_0041"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="Pfam matches to PF02786 CPSase_L_D2, score 355.1,
FT                   E-value 1.1E-103, and to PF02785 Biotin_carb_C, score
FT                   235.7, E-value 9.4E-068, and to PF00289 CPSase_L_chain,
FT                   score 148.9, E-value 1.2E-041"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66326"
FT                   /db_xref="GOA:A8EQV2"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV2"
FT                   /protein_id="ABV66326.1"
FT                   /translation="MAEIKKILIANRGEIVQRAVRTIREMGKKSVAIYSAGDKDASYLK
FT                   HADEAICIGGAKSSESYLNIPAIITAAEITGCDAIFPGYGFLSENQDFVEICKLHNIKF
FT                   IGPSVEVMEKMADKSKAKEEMIKAGVPVVPGSKGSVKTLEEGRTIAREIGYPIMAKAAA
FT                   GGGGRGMRLIKTEEEFDQNFMAAASEALAAFGDGTMYLERFINNPRHIEVQVVGDSHGN
FT                   AIHIGERDCSLQRRHQKVIEESPAILLNDETRAKLHEVAVKATKYLKYEGAGTFEFLAD
FT                   DKQNIYFMEMNTRLQVEHPVSEMVSGIDIIELMIKVAEGEKVPPQESIKFRGHAIECRI
FT                   TAENPNTFLPCPGRITQWMVPGGRNVRVDSHIYTGYVVPPYYDSMIGKLIVWGRDRNKA
FT                   INIMKRALAEFEVEGIKTTIPFHKKMMENKDFISNNYDTKYLENYKGLDDL"
FT   gene            51167..52717
FT                   /locus_tag="Abu_0042"
FT                   /note="AB0043"
FT   CDS_pept        51167..52717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0042"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /note="Pfam matches to PF00270 DEAD, score 233.5, E-value
FT                   4.1E-067, and to PF00271 Helicase_C, score 128, E-value
FT                   1.8E-042"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66327"
FT                   /db_xref="GOA:A8EQV3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV3"
FT                   /protein_id="ABV66327.1"
FT                   /translation="MTFNDFNFKELLQKAIDEAGFKEPSPIQEQAIPYILDGRDIVGQA
FT                   HTGTGKTAAFGLPILNKIKAKSGVEAVVIVPTRELAMQVSDELYRFGKFLGINTATVYG
FT                   GQAYARQIKLIENSSVIVATPGRFLDLLRGDKISIKPKFVILDEADEMLDMGFLDDIKE
FT                   IFTFLPENRQTLLFSATMPTAIKNLAKTILKEPEFVTLTKSDVTNSKITQTFYVVDEKE
FT                   RDDALIRLFDFKNPKKSIIFCRTKKDVDRLSTFLVSQGFMAKALHGDMEQKQREEAIRA
FT                   FKSSKLEILIATDVAARGLDVNDVTHVFNYHLPFDSESYVHRIGRTGRAGKEGMAISIV
FT                   TPHEFRMLQKIEKSIGTKLESKVVPNIGLVKKKKFAELKQQVLEQEIKDYALELVEELK
FT                   EEFDVSTIAFKLASILSSSTYVQGNNHIGKSESDIEKLIEYASKGSDRDGGDRRRNNSR
FT                   GRSRNGGGNSRFRDGDRNRENRDRNRSDRGDRSGDRRRTSSSSKPRSENSSNRARKKD"
FT   gene            52925..54520
FT                   /locus_tag="Abu_0043"
FT                   /note="AB0044"
FT   CDS_pept        52925..54520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0043"
FT                   /product="phosphate permease, putative"
FT                   /note="Pfam match to PF01384 PHO4, score 434.4, E-value
FT                   1.4E-127"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66328"
FT                   /db_xref="GOA:A8EQV4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV4"
FT                   /protein_id="ABV66328.1"
FT                   /translation="MDIKTLNTLDKATQDTMPSFAKFSLSLLFILMVFLWTYTSHGTIP
FT                   DNAFLIVGAVFGAYMAINIGANDVANNVGPAVGARALTLTGAVVVAAIFEAAGAIIAGG
FT                   DVVNTIKSGIIDPTLITDPHVFIWAMTAGLLAGAVWLNFATSIGAPVSTTHAIVGGVMG
FT                   AGIAGVGFSIVNWSSVGSIVASWIISPLFGGIIAAGFLFFIKTKIIFCEDKIAAANKFV
FT                   PILIAVMTWAFSTYLMLKGLRQVVHISFISASILSLIFAVIVYFVLKPIIFAKSLNLKN
FT                   DRTSVNSLFTIPLIFGAALLSFAHGANDVSNAIGPLAAINDAVLTLAEGSFPHASVGVP
FT                   FWIMAVGASGIVIGLILYGPRLIRTVGSEITELDQVRAFSIAMATAITVIVASQLGLPV
FT                   SSTHIAIGGVFGVGFLREIMDSSEKKYIQDAREKFRKHKKKLENMQIELKKFELIKDKS
FT                   KSDYIKIVDLFKKIDEVEAIVEQERKDFKEAKGVKYVKRDAVKKIIAAWVITVPASALL
FT                   AAGIFYMIKGIVIV"
FT   gene            54761..55495
FT                   /locus_tag="Abu_0044"
FT                   /note="AB0045"
FT   CDS_pept        54761..55495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0044"
FT                   /product="conserved hypothetical protein, putative
FT                   permease"
FT                   /note="Pfam match to PF03547 Auxin_eff, score 26.2, E-value
FT                   3.8E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66329"
FT                   /db_xref="GOA:A8EQV5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV5"
FT                   /protein_id="ABV66329.1"
FT                   /translation="MSPLFYIIIVFTTLSFLIFFSKIIFDSRTDESIYLGTALIGNTGN
FT                   LGIPLGIALFGVESVPYTSIINIANVFFMYTISVYFFAREQFSLKQAIISIFKIPAIWF
FT                   ALFAIFLNYYQVPISEHITTALNMGAYTSLTIQLFIFGVYLYNVQVKTIPWKLSLHISF
FT                   AKHILLPVIGILIIVWFTDFNSFVASILIMELMMPLAVNNVNFAVLYNCKPFDVAATIL
FT                   ISSIVFVFLLYFYIEIINYFIK"
FT   gene            55500..57287
FT                   /gene="asnB1"
FT                   /locus_tag="Abu_0045"
FT   CDS_pept        55500..57287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB1"
FT                   /locus_tag="Abu_0045"
FT                   /product="asparagine synthetase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="Pfam matches to PF00733 Asn_synthase, score 243.7,
FT                   E-value 3.6E-070, and to PF00310 GATase_2, score -22.4,
FT                   E-value 2.4E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66330"
FT                   /db_xref="GOA:A8EQV6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV6"
FT                   /protein_id="ABV66330.1"
FT                   /translation="MCGILGTNFLNERFDKSLELLHHRGPDFQNSIKIGNKQFGHTRLA
FT                   IIDLDEEANQPMVFDDILLVFNGEIYNYKELIHVEHLECKTKSDSEVLIRLYQKYGFDF
FT                   LDKLNGMFSFCIYDMKKDLYFCARDRYGKKPFFYYFKDNKFIFSSSVKSILNLLDYKPN
FT                   LNKVALSKYMQYFVSFGEDSFYQDIFKLEASTYLIYEPNKSRELQKKKYYKINTYKAIK
FT                   DEKQALNDIEELLFKSVEYRLNSDVEVASLLSGGIDSSLISALYTKISGNKINTFSIGY
FT                   DEYKNYCELDYAQITAKHINSNHHPVEINQKEYINHFEQTLDMLEEPHGDTAAIPLNIL
FT                   TKQIHKAGIKTVLSGEGSDEIFLGYDNYAKFLKYYDFEKSLSNEQNLFLNDIIGALQNN
FT                   TKESEYLRRIVKKQNLYNSFGEIYTDIQRKRLFKKVPTFKSETAKQDPVDWMSYIDLKI
FT                   WLGESLLSKVDRISMGNSLEVRTPFLDFNLVNYMFSVESHIKVGDTNKYLLKKIASKYI
FT                   PETIINRTKKGFNSPFNEWLNKEYKNKILDVIVEVNNQTNLFNHEYILHIYELSKSNKF
FT                   KQHLYSLFVFSLWYKKEYL"
FT   gene            complement(57411..57848)
FT                   /locus_tag="Abu_0046"
FT                   /note="AB0047"
FT   CDS_pept        complement(57411..57848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66331"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV7"
FT                   /protein_id="ABV66331.1"
FT                   /translation="MSLLQYTSKEMFSSTELVRKSKNIFDKLNRKEIEKAIILRDGKPN
FT                   TILLDFEEYEKIMTDYLKLKGKDVGEIPSIESEKKETVKSDKNISKKENIEDKKISSNT
FT                   KIEDEDFQAALNKIDDLEFFTDSSELKKDKDETLKEFWDKD"
FT   gene            complement(58145..59545)
FT                   /locus_tag="Abu_0047"
FT                   /note="AB0048"
FT   CDS_pept        complement(58145..59545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0047"
FT                   /product="PhoH family protein"
FT                   /note="Pfam match to PF02562 PhoH, score 56.8, E-value
FT                   6.5E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66332"
FT                   /db_xref="GOA:A8EQV8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV8"
FT                   /protein_id="ABV66332.1"
FT                   /translation="MFDKYYVLDTNILLEDATNIYKLSQDGKNLIILAETVLDEIDTKK
FT                   SGFDEINFQAREFARILEDSNIISSTKKDLYKIIRLKINNKDTVIDIISKDEYEINSKN
FT                   VSLNIINDRKILEISTFANTYYKHKVEFISLDIMARTRAISLDIKTNSLLGKDKDIFDL
FT                   DFIKYIDINFEDLEYLDNEEIIKFDKDYKPYNFSYCFKVRHSDQVLLANIQNKKIKLLD
FT                   EVEIRDQVITPLNKEQLFFSDAIINHFYNVLIIEAKAGSGKTLLALSGALKLVRQKFFQ
FT                   KIIYIRNSIESLDKGEDVGYLPGLEEKFKIYNHPLMDSLDYIIRTEHKRKRNKKAPDVV
FT                   FQQLDDSEVTARIEQMISNYGIETMWVGEMRGRTLSNSFIIIDEAQNMSNKTMQMVLSR
FT                   IDSSCKVVVLGSNKQIDNFYVNKYTNALTTLLKSSKNEDNLVNIFAIKLEKVLRGPITE
FT                   WAEQIFSK"
FT   gene            complement(59538..60089)
FT                   /locus_tag="Abu_0048"
FT                   /note="AB0049"
FT   CDS_pept        complement(59538..60089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0048"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="Pfam match to PF03653 UPF0093, score 173.1, E-value
FT                   6.2E-049"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66333"
FT                   /db_xref="GOA:A8EQV9"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQV9"
FT                   /protein_id="ABV66333.1"
FT                   /translation="MDRKNKKQGLKMEYYTWILSLHIIAVLSWMAMLFYLPRLFVYHVE
FT                   NIDKKEFVEVVKIQEYKIYYYIGHPAMLVTIISGISMLAINPSLFQFGWMYAKITAIIL
FT                   LIIYSLSLAKYRKQLADDCCTKDGKFFRMYNEMPTMLAILIVTYVITKSFSIIFTLLII
FT                   LLFAFISYKILKPKVVKSDV"
FT   gene            complement(60059..61243)
FT                   /locus_tag="Abu_0049"
FT                   /note="AB0050"
FT   CDS_pept        complement(60059..61243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0049"
FT                   /product="ATPase, AAA family protein"
FT                   /note="Pfam match to PF00004 AAA, score 57, E-value 5E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66334"
FT                   /db_xref="GOA:A8EQW0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQW0"
FT                   /protein_id="ABV66334.1"
FT                   /translation="MIDLSNKLRPTNLETFVGQSHIISKDKALYKLIKQKDIPHLFFYG
FT                   KPGTGKTTLAKIIAKEIGTDYYYFNATSIKVEDLRKVFDKYKGALIKPLIFIDEVHRLS
FT                   KNQQEVLLPIMENYDAIIIGASTENPFFTLTNAIRSRSFLYEFKPFTKDEMNKILYIAL
FT                   KDIDINISDGAKEYLIISSSGDARAMLTLLNFSYKVSKDINIDLLKELRENVIGDGVSS
FT                   SDTHYDLASAMIKSLRGSNVDGALYYMARLINGGESVDFITRRLVIFASEDIGNANPNA
FT                   LNLAVNTMMACNKIGYPESRIMLSQCAIYLASSPKSNSAYKAINKALEQIKNGKILDIP
FT                   KHLDSQHIGYLYPHDFGGYVEQEYLKEDLNLYQSSNIGFEKTLNDWIEKIKNKD"
FT   gene            complement(61227..62054)
FT                   /gene="rluB"
FT                   /locus_tag="Abu_0050"
FT   CDS_pept        complement(61227..62054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluB"
FT                   /locus_tag="Abu_0050"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="Pfam matches to PF01479 S4, score 54, E-value
FT                   4.5E-013, and to PF00849 PseudoU_synth_2, score 28, E-value
FT                   7.7E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66335"
FT                   /db_xref="GOA:A8EQW1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQW1"
FT                   /protein_id="ABV66335.1"
FT                   /translation="MKKETKKTTTKVEEPKFELIRLNKFLSHNSNYSRREADKLIEEGK
FT                   IRVNNKVVTDLATKVKSTDKVEIGKKLIKEEKNKLYTVIVYNKPKGEIVSKKDPQGRKT
FT                   IYDGLEHKYKHFLSVGRLDYSSEGLLLLSDSVDIVNALMHSDLERVYKIKLNGLITPAV
FT                   EQAMQSGITIEDATSGAYKGTKIKSMSFAPFLAYDIQTNGTKHSKIKVVINEGKNRELR
FT                   RFFAHFNLDVLDLKRLEYGGISLNNLPTGKSRYLTKEEYKNLRIFMNEDDRSI"
FT   gene            complement(62051..63013)
FT                   /locus_tag="Abu_0051"
FT                   /note="AB0052"
FT   CDS_pept        complement(62051..63013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0051"
FT                   /product="carbohydrate isomerase, KpsF/GutQ family"
FT                   /note="Pfam matches to PF01380 SIS, score 115.1, E-value
FT                   1.8E-031, and to PF00571 CBS, score 86.1, E-value 9.7E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66336"
FT                   /db_xref="GOA:A8EQW2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQW2"
FT                   /protein_id="ABV66336.1"
FT                   /translation="MNFKEIVRDVLLTEAKELEKTANKISFDIEKAIDLIVNSKGKLIV
FT                   TGVGKSGLVGAKIAATLASTGTSSFFLHPTEAMHGDLGMIGKDDIVLGISYSGESEELI
FT                   QILPHLKRLNIPLIAMAKSENSTLAKYADVFINIAVDKEACPLDTAPTSSTTLTMAMGD
FT                   ALAVCLMKKRDFKKEDFASFHPGGSLGKKLFVKVDDLLKKDNLPTVSRETKLKDAIIVM
FT                   SEGRLGNVIIIDENRTVFGVLSDGDLRRALMNENFSINCNVEDIATLNPKTLKNKDLLA
FT                   SDALQIIENYKIQLLIVTDENNKLIGLLHIHDLIEAGIK"
FT   gene            complement(63026..64948)
FT                   /locus_tag="Abu_0052"
FT                   /note="AB0053"
FT   CDS_pept        complement(63026..64948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0052"
FT                   /product="conserved hypothetical protein, predicted
FT                   hydrolase of the metallo-beta-lactamase superfamily"
FT                   /note="Pfam matches to PF00753 Lactamase_B, score 93.1,
FT                   E-value 7.8E-025, and to PF07521 RMMBL, score 51.7, E-value
FT                   2.2E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66337"
FT                   /db_xref="GOA:A8EQW3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQW3"
FT                   /protein_id="ABV66337.1"
FT                   /translation="MEEINKEEFTVVIKNENSSNVEEETTKKPPFKKRKPKPKVPRDNS
FT                   TNSNNNQKSGEGWVTDLKKAYLINEKIHKDRLNPHYKLNLNTSAKLKITPLGGLNEIGG
FT                   NMMVVETENEAIIVDVGMSFPDGEMHGVDILIPDFTYIREIKDKIVAVIITHGHEDHIG
FT                   AMPYLFKEMQFPIYGTSLPLEMIGSKFDEHKMREHRGYFRAISKRTPIKIGNDFEVEWM
FT                   HITHSIIDSSAVAIKTEAGTMIHTGDFKIDHTPIDGFPTDLHRLAHYGEEGVLVLTSDS
FT                   TNSHSPGFTRTEKTVGPTFDKIFSSAKGRVVMSTFSSNIHRVAQAIEKALIYGRKICVI
FT                   GRSMEKNLEIAMNLGYIKFPKDQFIEAHEVNKYNDKEVLIVTTGSQGESMSALYRMAIH
FT                   EHRHIKIKPEDQIILSSKAIPGNEASVSEIINHLLKAGAKVAYQDFPDIHVSGHAGQEE
FT                   QKLMLRLIKPKFFLPVHGEYNHALKHGQTGVDCGVLERNVYIMSDGEQIEVTPKYLKKV
FT                   KTVKSGKVYIDNQLNHRISDDVVLDRQTMAKEGIVMIVAQINENDRTLAQKPKVSSFGL
FT                   VSDKQDKYFVKEIEDILGVFLENVKPGILKNNRILEDELRKVVRKHCTRKYKKYPMIVP
FT                   TIFVQ"
FT   gene            complement(64932..65729)
FT                   /gene="ksgA"
FT                   /locus_tag="Abu_0053"
FT   CDS_pept        complement(64932..65729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="Abu_0053"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Pfam match to PF00398 RrnaAD, score 145.7, E-value
FT                   1.2E-040"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66338"
FT                   /db_xref="GOA:A8EQW4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQW4"
FT                   /protein_id="ABV66338.1"
FT                   /translation="MEKVKAKKQYGQNFLKDSTILDKIIQSMPNNNNHIVEIGPGLGDL
FT                   TKNLVKYKDLTAYEVDTDLIGILKSKFAIEIEKGNLKLIHTDVLEAWDKLKNLHDGKYD
FT                   LIANLPYYIATNIILRAFEDELCEHIIVMVQKEVAEKFTAKTNDKEYSSLGIITELISI
FT                   NSKILFDVPAEAFDPPPKVTSSILYIKKDMSKSLDKDFNKFLKACFIQPRKKLSKNLTT
FT                   IFDKNIIFEIYKELNINDNVRPHEVSSSLYSQMYTKVKNGRNK"
FT   gene            65806..66567
FT                   /gene="hisF1"
FT                   /locus_tag="Abu_0054"
FT   CDS_pept        65806..66567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF1"
FT                   /locus_tag="Abu_0054"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="Pfam match to PF00977 His_biosynth, score 461.7,
FT                   E-value 8.7E-136"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66339"
FT                   /db_xref="GOA:A8EQW5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQW5"
FT                   /protein_id="ABV66339.1"
FT                   /translation="MSSFAKRIIPCLDVDNGRVVKGVNFVGLRDAGDPVEVAKRYNSEG
FT                   ADEITFLDITASHENRGTIVDIVKKVAQEVFIPLTVGGGIRKLEDIYSLLNVGCDKVSI
FT                   NSSAVTNPNLINESSKRFGSQCIVVAIDVKRVADGSYHVFVKGGREDTGLDALSWAKEV
FT                   YDRGAGEILLTSMDTDGAKTGFELNITRQVSNLVDIPVIASGGAGSMEHIKEAFENGAS
FT                   AALAASIFHFKEIDIMDLKKYLRANNIPVRI"
FT   gene            66569..67252
FT                   /locus_tag="Abu_0055"
FT                   /note="AB0056"
FT   CDS_pept        66569..67252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66340"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQW6"
FT                   /protein_id="ABV66340.1"
FT                   /translation="MKKLIFNMMLLPILGFSYELDFNKSFSKIVNPDLLSTNITISVEK
FT                   KEENKVNSEIEKFNNFIKDTKSVTIKNGNYTLSPKYEYKDNKTEFKGYVGDLRYTAQSK
FT                   DAKNINKFINDLLALKDQIKSADIKLDISNISWEVSQSLQNKNSDELRLEAINWIEDYS
FT                   NSLSSKLSKRCEVKNINIDDNGSNIVYARSSKMALSSSFEMSDVVPVSSEQNITINPRF
FT                   LLECR"
FT   gene            67249..67785
FT                   /locus_tag="Abu_0056"
FT                   /note="AB0057"
FT   CDS_pept        67249..67785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0056"
FT                   /product="conserved hypothetical protein, possible purine
FT                   nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66341"
FT                   /db_xref="GOA:A8EQW7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQW7"
FT                   /protein_id="ABV66341.1"
FT                   /translation="MIICAGRNETFPFAQTIGVGLIESAINLTRLCLFDKPEYLLFIGS
FT                   AGSYGEHKIFDIIESKRASNIELGFLTGSAYTPLDNVLESENKFARNDTIVNSSNYIST
FT                   NEKLCKEFLDYGVGIENMEFFSVLSVAKEFEIPVAGIFIVTNYTNENAHKDFIKNHKEA
FT                   MEKLTNYLIEKNIIK"
FT   gene            67796..68878
FT                   /locus_tag="Abu_0057"
FT                   /note="AB0058"
FT   CDS_pept        67796..68878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0057"
FT                   /product="conserved hypothetical protein, radical SAM
FT                   enzyme, Cfr family"
FT                   /note="Pfam match to PF04055 Radical_SAM, score 48.6,
FT                   E-value 1.9E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66342"
FT                   /db_xref="GOA:A8EQW8"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQW8"
FT                   /protein_id="ABV66342.1"
FT                   /translation="MAKEALPSIYDYTLDELKEILKPSFRAKQVYNWLYKKYASSYDEM
FT                   KNLPKELVEDLKENYPIDIMQIVKKEQSRDGSIKYLFKLRDNHTVEAVLLLMKDKKIDE
FT                   DGQIVRSEKYTVCISSQVGCKVGCSFCLTAKGGFVRNLTVGEYIAQIVNIKRDNDIAEN
FT                   KALNIVYMGMGEPLDNFDNFTKAVEIFSELDGLAISRRRQTVSTSGIATKIKKLGEKDL
FT                   QIQLAISLHAVDDELRSELIPMNKAYNIASIIQAVKAFPVDTRKKVMFEYLVIKDKNDS
FT                   IEAAKKLVSLLNGIQAKVNLIYFNPYPGTSYQRPQEKDMLKFKDFLNQKGVICTIRESK
FT                   GLDISAACGQLKEKEANGNS"
FT   gene            68967..70376
FT                   /gene="gltX1"
FT                   /locus_tag="Abu_0058"
FT   CDS_pept        68967..70376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX1"
FT                   /locus_tag="Abu_0058"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="Pfam match to PF00749 tRNA-synt_1c, score 460.2,
FT                   E-value 2.3E-135"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66343"
FT                   /db_xref="GOA:A8EQW9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQW9"
FT                   /protein_id="ABV66343.1"
FT                   /translation="MAITRFAPSPTGYLHIGGLRTSLYSYLWARKTGGEFRLRIEDTDL
FT                   ARNSEEAMKAIIDAFDWVGLNYDGEVFYQSKRTDIYKQYIDKLLESGNAYKCYMSKEEL
FT                   DALRAAQEAAKQTPRYDGTWRPEPGKELPPVPAGVEPVIRIKAPTTGTIEFDDGVKGHM
FT                   KFDANQVDDYVIARSNGMPTYNFVVAIDDALMGMTDVIRGDDHLSNTPKQIVVYNALGF
FT                   KVPKFYHVPMINNPEGKKLSKRDGAMDVMDYKRLGYLPEALLNFLVRLGWSNGDQEIFS
FT                   MKEMLELFDPSNINKSASSYNGEKLLWLNSEYIKAVSNERLIEELKFFDLDLSNYPKKN
FT                   EILDLAKQRAQTLVELKKSITDIIDIPTSYEESGVKKFIKEDTKELLEKYLLLLESNKN
FT                   SLDSVEKIEEFTKPFINDNGLKFPQLFQPIRIALTGGTQAPSVYDIIFILGYDEIFKRI
FT                   NEALKRNFQNT"
FT   gene            70400..70696
FT                   /gene="rbpA"
FT                   /locus_tag="Abu_0059"
FT   CDS_pept        70400..70696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbpA"
FT                   /locus_tag="Abu_0059"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /note="Pfam match to PF00076 RRM_1, score 99, E-value
FT                   1.3E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66344"
FT                   /db_xref="GOA:A8EQX0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX0"
FT                   /protein_id="ABV66344.1"
FT                   /translation="MFKLLKRTIEMNIYVGNLSYRMNDKELETVFAKFGEVKSAKVIMD
FT                   KETGRSKGFAFVEMADAKAGKDAIEALNGNDCEGRTLRVNEAKPREERPRRQF"
FT   gene            70806..71465
FT                   /locus_tag="Abu_0060"
FT                   /note="AB0062"
FT   CDS_pept        70806..71465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0060"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 82.1,
FT                   E-value 1.1E-024, and to PF00486 Trans_reg_C, score 69.6,
FT                   E-value 9.2E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66345"
FT                   /db_xref="GOA:A8EQX1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX1"
FT                   /protein_id="ABV66345.1"
FT                   /translation="MKILLLEDDLILNEIIEEYLISQEHEVITAFSGNEAQDYLYSQTF
FT                   DLLILDVNVPFVSGFELLKELRTQNIKTPTIFITSLNMVEDMQKGFDSGCDDYLKKPFE
FT                   LKELDLRINNIKRLFNITPKELINISKDAFLDIQNLLIIKNNQKIHLAKKECEVLQYLI
FT                   NSSKTVSIEELSLNLWAYEDNPNDSTIRTYIKNLRKILGEKKIINIRGVGYRFNKE"
FT   gene            71440..72591
FT                   /locus_tag="Abu_0061"
FT                   /note="AB0063"
FT   CDS_pept        71440..72591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0061"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 84.7,
FT                   E-value 2.6E-022, and to PF00512 HisKA, score 35.1, E-value
FT                   2.2E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66346"
FT                   /db_xref="GOA:A8EQX2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX2"
FT                   /protein_id="ABV66346.1"
FT                   /translation="MVIDLTKSEKITFFRFLFLYLGSSFILMFIAAFFYYQNEKILYID
FT                   LVKSNMQSIVSKASNEVIVSHMMNEKFDKEKYLNSHEYKISFYDKNKSKLFGNLEENID
FT                   LNEKFIFDNESIILVDNSTVGHLGIEYIALKDTSLFDKLERLKISIVIFFLVFYFIISL
FT                   IGIYLAKLFLKPIKDERNKLNNFIKDTTHELNTPISAIMMSSENENLSSKQIERIRYSA
FT                   NRLSEIYKDLTYIFLENIEVKVAEELELSKIIKEQIDSFEPIFSRKKLKIKIELEDTLY
FT                   KMNKDDFIRLFNNLFSNAIKYNKINGDIEVILKDKKLSIKDSGIGIDKNKIKDIFKRYY
FT                   RATNQSGGFGLGLNIVNMICQTYKIKIEVESIENQGTTFIIYF"
FT   gene            72655..73038
FT                   /locus_tag="Abu_0062"
FT                   /note="AB0064"
FT   CDS_pept        72655..73038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66347"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX3"
FT                   /protein_id="ABV66347.1"
FT                   /translation="MKNLFKVFLALFLTVGFLNAQSLNQKNQVDGYDVEITSTRDLSAG
FT                   SNELFANITKDGKAVTTAKVKVKFFMPEMPGMPYMEHEGEGSLAGDKYKMTINFCMNGT
FT                   WQYQLKFKTDDGVIHTVKSSVNF"
FT   gene            73038..74225
FT                   /locus_tag="Abu_0063"
FT                   /note="AB0065"
FT   CDS_pept        73038..74225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0063"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF02321 OEP, score 28.2, E-value
FT                   2.7E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66348"
FT                   /db_xref="GOA:A8EQX4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX4"
FT                   /protein_id="ABV66348.1"
FT                   /translation="MLKILFSSSLVISLLGAVSIDELVNDSFEKNYDIKSLEKSIEIAN
FT                   HQIAIAKNWENPMIAFKTNEIMFDKPLSNQKEYGVELSQAIPIGKKLDIEENIAKNDRN
FT                   IQIYSLEDKKLELESKIYEYSYNILIFEKRYELLNTYQKNLKKLENLNTLLQKYEKATL
FT                   NEVIDSQISSLDLKLEQENLKNSIDNLYLNLEQITYKKVDSITQNLDIKRVDKEKATSN
FT                   LSSHPQVKTLEENSTKYSQMASLEDAKKFSSVTVSLEYMQNKEQDYANVTVAIPLPIYK
FT                   TENVNRIKAKLNANETNDKLDSLLHNLSLETQIYVNNLNQNVRNYEVIQKEIIPLKQKI
FT                   QKNIENYNSFEKSNPQDSIKNLNELITYELKALDEVQKYYENYSKLLYYSNKGIK"
FT   gene            74222..75226
FT                   /gene="czcB"
FT                   /locus_tag="Abu_0064"
FT   CDS_pept        74222..75226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="Abu_0064"
FT                   /product="cation efflux system, membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66349"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX5"
FT                   /protein_id="ABV66349.1"
FT                   /translation="MIKNVLILILLLGSFVNAEILDAKQLFNKKITKVKKEEILLSKSF
FT                   YGITKIDESSTFDIVSRFDGYITNLNANKNYMTIKKGEPLYSIYSSEILSIQNELQISK
FT                   ELNQNIYQSTLLKLDNLDISKESQEKIKSGKLNNNGLVVTSPTNGILLQKNINNKSSVS
FT                   KGITLLQITSLDKIWFIASVYQEDLAFIKKDKQATIYIDGLNTSFNTKVDFIYPIFDDK
FT                   SKTVDVRFILDNKELNLLPSMFGKVDIIDEQKQLLTLPKTAVLKKSDSFYVFKYVSNNE
FT                   FKPVKIEAKRINSNKYEIISGLNENDEVIDNALFLLDSDALTNSLYESDNEDW"
FT   gene            75233..78340
FT                   /gene="czcA"
FT                   /locus_tag="Abu_0065"
FT   CDS_pept        75233..78340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="Abu_0065"
FT                   /product="heavy metal efflux pump"
FT                   /note="Pfam match to PF00873 ACR_tran, score 599.9, E-value
FT                   2.1E-177"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66350"
FT                   /db_xref="GOA:A8EQX6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX6"
FT                   /protein_id="ABV66350.1"
FT                   /translation="MIENIISYSVKNKFIILFVVFILTLSSIWAVKNTSLDALPDLSPA
FT                   QVIIQVEWDGQSPKTIEEQISYPLISNLMSLPNIETVRAMSSFSNAMIYIIFKDGTNLY
FT                   DARSRILEQLSTLQGTFPSGSSVQLGVDATGVGWAYEYALKSKTRSLEELRTLQDYFYK
FT                   FGLLGVDGVSEIATIGGFIKNYEITLNQDKLVQYDLNIEDIKKIIEANNDDKGGRIVLE
FT                   NGYEYIITARGYLKSVVDIENITIQTENNIPLKIKDIATVNITSENRRGMVDLNGEGET
FT                   VGGIVVVRFGENPYKVIKAVKEKLKTLNVPDVEIVEVYDRTSLIDKAIDTLKRTLIEES
FT                   IIVMIVAGLFLFHFRSALIIIITLPITVLISFFLMKLFGIGSNIMSLGGIAIAIGAMVD
FT                   ATIVMVENAHKHLQGKDNLTNEERTSIIIKSAKQVGRPIFFALLLVVVSFLPIFALTGQ
FT                   EGKLFSPLAFTKSFAMMFGAILSITIVPILMIFLIRGKILKEDNNILNRFFINIYSPLL
FT                   HFALRFKYFVIAIFFVTLVLAVTIYQKQKWEFMPMMNEQTFMYMPVTPYGIGIDLAKEL
FT                   AQKTNMVIKSFPEVETSFAKVGRALSATDPAPLSMIETIITFKPENEWREGMTYKKLME
FT                   EMDKKLQVNGLINSWTYPIRGRIDMLMTGIRTPLGIKLYGNDAKILQDISTKIEQKLKK
FT                   YEGTLSVSADKINSGYYLNIKIDDEKISRYGISKNDILETISLGVGGAKISTYLDKLER
FT                   YPISLRFETTQREDLAVLQNLQIKTKLGWKPLNLFATLSYEEAPSVIQSEKALNVAFVY
FT                   ITPKNGFSTKEYKDEANKLLEEIKLPNGYYFEWSGQSEFLELAMNKLVYIIPITFMIIF
FT                   ILIYLALKNITYSLIIFFTLPFAITGGIFYIEYLGFNISIAVIVGFLALLGVAAETSIV
FT                   MLLYLDVAIKEFKEKNEEYSDKNIIETIYKGAVLRLRPKLMTLFTILGGLVPIMYIHGV
FT                   GSEVMQRIAAPMIGGMISSTFLTLFIIPAIFYIVLKRNKEFGLTKH"
FT   gene            78389..78952
FT                   /locus_tag="Abu_0066"
FT                   /note="AB0068"
FT   CDS_pept        78389..78952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0066"
FT                   /product="conserved hypothetical periplasmic protein"
FT                   /note="Pfam match to PF04264 YceI, score 234.1, E-value
FT                   2.7E-067"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66351"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX7"
FT                   /protein_id="ABV66351.1"
FT                   /translation="MSIVSKITSALLLTGSLLMATEYKVDNAHTNVGFTVKHMMITNVN
FT                   GNFKTYDANIDYDEATKTFKKFSATVDTKTVDTGIEKRDDHLRSDDFFASEKFPKMTFE
FT                   MTSYKPDGNDGKMTGNLTIRGVTKTVTLEVEDIASMGNKIGFVLEGKINRTDFGLKWNK
FT                   TIELGGVAVGEEVKIKVDVEAEKK"
FT   gene            complement(78983..80311)
FT                   /locus_tag="Abu_0067"
FT                   /note="AB0070"
FT   CDS_pept        complement(78983..80311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0067"
FT                   /product="fibronectin/fibrinogen-binding protein, putative"
FT                   /note="Pfam match to PF05670 DUF814, score 73.9, E-value
FT                   4.8E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66352"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX8"
FT                   /protein_id="ABV66352.1"
FT                   /translation="MKYFILKEIVNYLSINTQNIKSIRRIDNNLIIIEFNNKNILYVDI
FT                   SKSNSIIFKHNKILSSKKDFNAPFDVILQKRFNNSKIESIELYNDDKIVNIKVSSSSSY
FT                   KKQITILQLEFTGKYTNIIVLDENRVVLEALRHIDEFSSSRIVKVGHKLDEVPKQNFIP
FT                   KIEKIEDIESYLYQVYEQKEKENLENLKKQKISQIDKKAKKLKSTIEDLPKKEDLEKES
FT                   NELYEKANLILSNLHNIKPYQKSLKVYNYQGIEVELDLEAKQSASKYSNDLFKKAKRTK
FT                   QKASNISLEKDNLTQKLEYLLRLISSIKNATSLEECEFLLPKKERNQTKTKKSQTCEIF
FT                   FFEGYKILLGTSQRENIYLLENSKASDFWFHLKDRPSCHVIVQNTKKEIPQSVIIQAAT
FT                   LCAKFSVDFSGTYEVDYTQRRNVKIQSGANVLYNPYTTIVIKF"
FT   gene            80405..80722
FT                   /locus_tag="Abu_0068"
FT                   /note="AB0071"
FT   CDS_pept        80405..80722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66353"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQX9"
FT                   /protein_id="ABV66353.1"
FT                   /translation="MKLLKLLVASSIALGLSTSLMADAAKGQKFYIKLLKEPCGMDGAK
FT                   FAVKHTQDEWKSIAESGKFEQEVIKLCPNVKAGDLKPNAQKEIIDFLIEYASDSGNVPS
FT                   C"
FT   gene            80789..82393
FT                   /locus_tag="Abu_0069"
FT                   /note="AB0072"
FT   CDS_pept        80789..82393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66354"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY0"
FT                   /protein_id="ABV66354.1"
FT                   /translation="MKKNLIAMSVVTALATTSFASDMNKEMYNQIQALKAQIEALEKKV
FT                   AQQEAKDKEAEKAVTNVAPTQQKVAVDEKRIENIEKKLETVSKTATTAKIQSAQDNIKW
FT                   DVDFRTQVDNIQYKHADGSKSKNDALLTNRLWLGAKYKADDNSSFFGKLSYNKAFGDTA
FT                   DHSQSNTNPGYANFDWVTNENATDNSIKVKEAYWLYQNERLFSSDIPWSVSVGRRPSTD
FT                   GLPINIRNDQKPNSPLSHTIDVEFDGFSFKLDTEGVTGFTGSWLKICGGRGLTNATPRF
FT                   DMFKPAYSKDDEKNDDVDMLGLIVVPYDDGQYSVHMQYSHAWNLIGYSADAMGKFNNAY
FT                   GTYTNNPDAQTAYELQMAKPSFEDVGDIDLATVLFKAEGIGDGISETLDNTTAFASFAM
FT                   SKTNPNSKGMLGTTDSQTGYSVWLGVNTACPILPDSARIGFEWNKGSKYWRSMTYGEDT
FT                   YAGSKIAARGQAFEVYRTQKLTEALSFGVSYVYIDYDYTGSNSFFGADGEPIAISDANG
FT                   SAVKEAQDIRAYMRYKF"
FT   gene            complement(82420..82935)
FT                   /locus_tag="Abu_0070"
FT                   /note="AB0073"
FT   CDS_pept        complement(82420..82935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66355"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY1"
FT                   /protein_id="ABV66355.1"
FT                   /translation="MILNISKIKTESLLLFCKDLILSYKDKINLNESELDKDIVEEFNN
FT                   IGNDMLKQILNVTFPQNYYIQNAKHYRIKAVLNGYNFINNEISKNLKENETFNPSMLYF
FT                   SLLALWFKELNKESTSKEYIYFILYPYFQVYDKFLVNMKDPEFKKLNIKMIELAEKVIY
FT                   NFDKYNLR"
FT   gene            83047..84855
FT                   /gene="thrS"
FT                   /locus_tag="Abu_0071"
FT   CDS_pept        83047..84855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="Abu_0071"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="Pfam matches to PF00587 tRNA-synt_2b, score 193.2,
FT                   E-value 1.1E-055, and to PF03129 HGTP_anticodon, score
FT                   109.1, E-value 1.2E-029, and to PF07973 tRNA_SAD, score
FT                   93.6, E-value 5.4E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66356"
FT                   /db_xref="GOA:A8EQY2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY2"
FT                   /protein_id="ABV66356.1"
FT                   /translation="MEPIGILKDGQIYDLQTAEALNIQGDEIKSDDSKESLDILRHSCA
FT                   HLMAQAIKELYPEAKFFVGPVVKEGFYYDFKVNSKISDDELPTIEKKMKEIADRKLPIT
FT                   RHETTKEEFYEKFKNDELKQAVLKNIKDDVLTIYRQGDFEDLCRGPHLPNTRMIRSFKL
FT                   TRVAGAYLGGDEKNEMITRIYGIAFFDKQALFDYTRMLEEAKKRDHRKLGTELELFTFN
FT                   DDVGAGLPMWLPKGARLRSKLEHLLYKAHRIRGYEPVRGPEILKAEMWKISGHYANYKE
FT                   NMYFTTIDDQEYGIKPMNCVGHIQIFKNNLVSYKELPKKLFEYGVVHRHEMSGAMHGLF
FT                   RVREFTQDDSHIFCTQDQIKQVIFEVLEFVDTLLKVFDFKYEIEVSTKPEKAIGDDIFW
FT                   EKTTKGIMDALDENNISYGIDEGGGAFYGPKIDIKILDAIGRKWQCGTVQVDMNLPSRF
FT                   NVEYINEKGEKEQPVMIHRAILGSFERFIGILTEHCAGEFPFIIAPTQVILVPIADSHV
FT                   EYAKELQKALLENDLDSEIYNMNESLNKRIRMAEKQRVPMIVVIGDEEVENKTVALRNR
FT                   RTREQSNMSKNEFISMLNEIKNGSRI"
FT   gene            84852..85379
FT                   /gene="infC"
FT                   /locus_tag="Abu_0072"
FT   CDS_pept        84852..85379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="Abu_0072"
FT                   /product="translation initiation factor IF-3"
FT                   /note="Pfam matches to PF05198 IF3_N, score 153.9, E-value
FT                   3.8E-043, and to PF00707 IF3_C, score 120, E-value
FT                   6.3E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66357"
FT                   /db_xref="GOA:A8EQY3"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY3"
FT                   /protein_id="ABV66357.1"
FT                   /translation="MSKDKRKDDVIMNEMITAKEVRCTSDDGTNHGIIPTAQALALADE
FT                   MGLDLVLIAPDGKPPVAKIMDYGKFRYQQEKKKKEAKKNQKVIVIKEIKLSVKIAENDV
FT                   NYKVKHAREFLEEGNHVRFRVFLKGREMANPQSGIDVLNKIWPMVEDIAVMDKEPKLEG
FT                   RYVNLLVLPKKD"
FT   gene            85518..85715
FT                   /gene="rpmI"
FT                   /locus_tag="Abu_0073"
FT   CDS_pept        85518..85715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="Abu_0073"
FT                   /product="50S ribosomal protein L35"
FT                   /note="Pfam match to PF01632 Ribosomal_L35p, score 42.6,
FT                   E-value 1E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66358"
FT                   /db_xref="GOA:A8EQY4"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQY4"
FT                   /protein_id="ABV66358.1"
FT                   /translation="MPKMKSVKGAVKRFKVKKNGTIKRGSAFRSHILTKMSQKRKRNLR
FT                   GPKTVHSTNVAGILSTLCKA"
FT   gene            85814..86170
FT                   /gene="rplT"
FT                   /locus_tag="Abu_0074"
FT   CDS_pept        85814..86170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="Abu_0074"
FT                   /product="50S ribosomal protein L20"
FT                   /note="Pfam match to PF00453 Ribosomal_L20, score 168.6,
FT                   E-value 1.4E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66359"
FT                   /db_xref="GOA:A8EQY5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQY5"
FT                   /protein_id="ABV66359.1"
FT                   /translation="MPRVKTGVVRRRRHKKVLKAARGFFSGRRKHFRKAKEQLERSLVY
FT                   AFRDRRQKKRDIRKLWIIRINAACRLNDINYSRFMNGLKLSGLELDRKILADMAMNDSA
FT                   AFASLVATAKAALK"
FT   gene            complement(86243..87439)
FT                   /locus_tag="Abu_0075"
FT                   /note="AB0078"
FT   CDS_pept        complement(86243..87439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0075"
FT                   /product="rhodanese-like sulfur transferase"
FT                   /note="Pfam match to PF00581 Rhodanese, score 57.4, E-value
FT                   4.4E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66360"
FT                   /db_xref="GOA:A8EQY6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY6"
FT                   /protein_id="ABV66360.1"
FT                   /translation="MRKVIKNIVLASFLAISGVWAQDELNLKEPTKAVYDLIKKYNLEQ
FT                   VDYEYVKKSIGLGNRSSASSILIDARPTLKYQKGTIPSSYNIPDTNFDEYYKAISDIPK
FT                   DKELIVFCGGYSCEKSPIVAQKLKEKGHKNIKIYSAGEPEWSTKNYLEVDTIVTKAYQE
FT                   NNSALLVDPRPFAKYLQETIIGAISVPDTDFEKLLGRFPINKDEKILIFCSGFNCEKSN
FT                   IVANKLYALGYKNVVVYAGGLPAWKEAGLKTTSFAKASKDENAQTSIKKDEFSKNGLKL
FT                   GKDQGSVDGEWLKALILENKVPEYIQIVNILNEQEFKNGHIKGSINIEAGKLSAKELYE
FT                   KLPKNKTIVFHCTAGSRSLEAWMKLNSNKYDMSEIYYFDANITCKGNNCKIDVNEPLE"
FT   gene            complement(87423..87659)
FT                   /locus_tag="Abu_0076"
FT                   /note="AB0079"
FT   CDS_pept        complement(87423..87659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66361"
FT                   /db_xref="GOA:A8EQY7"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY7"
FT                   /protein_id="ABV66361.1"
FT                   /translation="MKKELIIFIVILIVLTITMHYKEFINYPLTHIKNFPNSSAYGFGI
FT                   FHPLVFASIIYIVLSIPRLVIKLFKRKNHEKSN"
FT   gene            complement(87669..89138)
FT                   /locus_tag="Abu_0077"
FT                   /note="AB0080"
FT   CDS_pept        complement(87669..89138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0077"
FT                   /product="conserved hypothetical protein, putative
FT                   sulfide:quinone reductase"
FT                   /note="Pfam match to PF07992 Pyr_redox_2, score 49.4,
FT                   E-value 1.1E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66362"
FT                   /db_xref="GOA:A8EQY8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY8"
FT                   /protein_id="ABV66362.1"
FT                   /translation="MKKNELDKALEIFDAEIKKTGLSRREAFKVAGLGGAAFLLGGSES
FT                   EAATIAKASEAKAKIVIVGGGLAGISTAARLVNSLAEPDITIIEPNPKSVSYQPATTLL
FT                   ASGVYSSKDELLYDTKDYLPKGVTLIKDKAVDFNPEANKITLESGEVLSYDFLIVAAGI
FT                   VLNYGAIKGLEEVGDAYSVGDASKILKVFGDSGVTSVYNIDSAEQMWVQMQKFIQKAKD
FT                   GQKVKGVFTDPNTAIKCGGAPKKVMYLTNARLNEAKARANAELNFYADSGKLFGVKEYA
FT                   DAIEKQFIARDMKWNFNHNLIAVDINKKIATFDKYWQEKGAFDKDLEEYEMITKHQNID
FT                   VPFDFLHITPPQKAPDEIGNSEIGSSKGWVPVNKETLQHVKYNNIFAIGDIAAVPMGKT
FT                   GGSVRKQYKVLVDNLISVMEGKEPTAKYTGYTVCPLITDIGKVMLAEFDWTAKPTPSFP
FT                   LDPTQERYIWWLLKVYLLKPMTMHGMLSGRA"
FT   gene            complement(89219..89821)
FT                   /gene="mobA"
FT                   /locus_tag="Abu_0078"
FT   CDS_pept        complement(89219..89821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="Abu_0078"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66363"
FT                   /db_xref="GOA:A8EQY9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQY9"
FT                   /protein_id="ABV66363.1"
FT                   /translation="MNIIPFKIPCVILSGGKSSRMGEDKSLLPFGSSNSLIEYQYKRLK
FT                   PYFKNLYISSKIDKFDFLNPSDLILDENQEIYSPILALYSIFKKLPNQNIFIITVDSPF
FT                   VSIDSIKTLIDNSNTSDITIAQTEKTHNLCGVFSSNLIFKIEQMINEDIHKIFYLIRNS
FT                   SSNIITFYDDKEFININKKEEYEESLSFIKKYYDSYN"
FT   gene            complement(89821..91101)
FT                   /gene="leuC"
FT                   /locus_tag="Abu_0079"
FT   CDS_pept        complement(89821..91101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="Abu_0079"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="Pfam match to PF00330 Aconitase, score 276.3,
FT                   E-value 5.6E-080"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66364"
FT                   /db_xref="GOA:A8EQZ0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQZ0"
FT                   /protein_id="ABV66364.1"
FT                   /translation="MGQTITEKIFSEHAGKKVYAGEIVRSPIDMVIGNDITTPISIRAF
FT                   EEGGFEKLANPDGFAIVLDHFIPAKDIASANQAKISRDFALKHNLKNFFDEKDMGIEHA
FT                   LLPEKGLVIPGDVIIGADSHTCTHGALGAFSTGMGSTDISFGMITGGNWFKVPESIKVI
FT                   FKGKPAPFVTGKDLILEIIRILGVDGALYKALEFTGDTIQYLSMDDRFSLCNMAIEAGA
FT                   KNGIVAYDEITKEFLDKVGEANGGLRAEPKIHYSDEDANYCQVIEIDVAKLEPVIAYPY
FT                   LPSNGHSVSQAVSDNIKVDQVFIGSCTNGRLSDFKIAAEILAGQKVARHVRLILTPGTQ
FT                   KILREATKLGYIDTLVDAGAVVSNPTCGACLGGYMGILGDNEVCISTTNRNFVGRMGSR
FT                   SSKIYLANSAVAAASAISGYITDPRSL"
FT   gene            complement(91170..91634)
FT                   /gene="lspA"
FT                   /locus_tag="Abu_0080"
FT   CDS_pept        complement(91170..91634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="Abu_0080"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="Pfam match to PF01252 Peptidase_A8, score 101.6,
FT                   E-value 2.1E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66365"
FT                   /db_xref="GOA:A8EQZ1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQZ1"
FT                   /protein_id="ABV66365.1"
FT                   /translation="MRRELKLATTIFVVVFIIDQIVKFGFANLAWDVDGPYMSLKLAYN
FT                   YGVAFSMFSFLDQNLKYIQLVIVILATLYLLKNRDVFKEYYLPIALLYAGGLSNILDRF
FT                   TYGAVVDYFYWHYGFEFAIFNFADVIIDLAVVIIIYKQLRQSKKDKEIKS"
FT   gene            complement(91631..92965)
FT                   /gene="glmM"
FT                   /locus_tag="Abu_0081"
FT   CDS_pept        complement(91631..92965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="Abu_0081"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="Pfam matches to PF02878 PGM_PMM_I, score 208.3,
FT                   E-value 1.6E-059, and to PF02879 PGM_PMM_II, score 132.6,
FT                   E-value 1E-036, and to PF02880 PGM_PMM_III, score 107,
FT                   E-value 5E-029, and to PF00408 PGM_PMM_IV, score 27.9,
FT                   E-value 2.9E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66366"
FT                   /db_xref="GOA:A8EQZ2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQZ2"
FT                   /protein_id="ABV66366.1"
FT                   /translation="MKLFGTDGVRGKAGDFLDAITVLKLAKAAGIYFRKHSTTNKILVG
FT                   KDTRRSGYMIENALVSGLTAVGYDVIQIGPMPTPAIAYLTESMRCDAGIMISASHNPFE
FT                   DNGIKFFDNHGNKLNTTCEEEIENIFNDMDLMQSEQVTGRDIGSSKRIDDVIGRYIVAI
FT                   KSSFPKNLTLKGLRIILDCANGAAYKVGPTILEELGADVITINNKPNGFNINENCGAMH
FT                   PETVSNLVKEYRADIGLALDGDADRLVVIDEKGEIVDGDNLLGALSVYLKNENLLKGDA
FT                   CVATVMSNKALEDYLQKNKISLFRSNVGDKYVLEVMKEKGINFGGEQSGHIIFSDIAKT
FT                   GDGLASALQVLALIIKSGKKASEILNPFSLYPQILHNMKVTEKIPLEQITGLEEVLKPI
FT                   RQKGLRDLIRYSGTENKIRLLLEGKNKKDVEDAMQTLIAFFKKAL"
FT   gene            93049..93309
FT                   /gene="rpsT"
FT                   /locus_tag="Abu_0082"
FT   CDS_pept        93049..93309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="Abu_0082"
FT                   /product="30S ribosomal protein S20"
FT                   /note="Pfam match to PF01649 Ribosomal_S20p, score 86.8,
FT                   E-value 6E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66367"
FT                   /db_xref="GOA:A8EQZ3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQZ3"
FT                   /protein_id="ABV66367.1"
FT                   /translation="MANHKSCEKRARQTVVKTERNRFYKTRIKNVTKSVLSAVELADKE
FT                   KAVEAMKAANQYFHHCVSKGILKKGTASRKVSRLQLKVNAI"
FT   gene            93313..94380
FT                   /gene="prfA"
FT                   /locus_tag="Abu_0083"
FT   CDS_pept        93313..94380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="Abu_0083"
FT                   /product="peptide chain release factor 1"
FT                   /note="Pfam matches to PF00472 RF-1, score 248.7, E-value
FT                   1.1E-071, and to PF03462 PCRF, score 227.8, E-value
FT                   2.1E-065"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66368"
FT                   /db_xref="GOA:A8EQZ4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EQZ4"
FT                   /protein_id="ABV66368.1"
FT                   /translation="MLKDKLQPFINRFEEINQLLMSSEITSDIKRMTDLSKEQSSIQPI
FT                   VSKAKEYIKVLEDIEENKLMLDDPELGDLAKEELKELETRKPELEEEIKVLMIPKDPND
FT                   DRNIYLELRAGTGGDEAAIFVGDLFRAYLRYAENNGWKVEIMSSSDSESGGYKEIVILV
FT                   KGDHVYSKLKFEGGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEIEINENDLKIDV
FT                   MRASGNGGQSVNTTDSAVRITHIPSGIVVTNQDQKSQHKNKDRALKVLKAKLYEIEMEK
FT                   KMEAEGATRKEQVGTGDRSGRIRTYNYPQNRISDHRINLTLYRLDYIMNDGLFGEVIDP
FT                   LIADHQSKLIEANGL"
FT   gene            94401..94589
FT                   /locus_tag="Abu_0084"
FT                   /note="AB0087"
FT   CDS_pept        94401..94589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66369"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQZ5"
FT                   /protein_id="ABV66369.1"
FT                   /translation="MIELNTTYIHYKNKKTYISLDFCKIQENDVWVKAVIYKPQDNEEL
FT                   FVRTYQEFQEKFIKQTN"
FT   gene            94665..95720
FT                   /gene="pstS"
FT                   /locus_tag="Abu_0085"
FT   CDS_pept        94665..95720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="Abu_0085"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66370"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQZ6"
FT                   /protein_id="ABV66370.1"
FT                   /translation="MTFKKTSMALIASALLTTTLSARDQIKIVGSSTVYPFSSSVAEEF
FT                   GATTKFPTPVVESTGTGGGMKLFCAGVDLNTPDIANASRKMKDKEFETCKENGVTDITE
FT                   ALIGFDGIAIAQSTKVKSFNVTKEQLALAVAEEVPSKDGKTLIKNPYKKWSDIDASLPN
FT                   REIIVYGPPKSSGTRDSFEELVLQHVFEKMAVYTDLFKKDENANKKYKAYSVIRTDGVY
FT                   VESGENDNLIVQKLTKNEAAIGIFGYSFLAENKDKVLGITVDNISPTVETIASGKYPVA
FT                   RSMYFYIKNQHSKDVPALKEYTNLFMSEKMIGDDGILSELGLIPLTSDVRSKARNKVLN
FT                   SEKLTIEELKH"
FT   gene            95790..97520
FT                   /locus_tag="Abu_0086"
FT                   /note="AB0089"
FT   CDS_pept        95790..97520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0086"
FT                   /product="EAL/GGDEF domain protein"
FT                   /note="Pfam matches to PF00563 EAL, score 127.7, E-value
FT                   2.9E-035, and to PF00990 GGDEF, score -12, E-value
FT                   3.7E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66371"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQZ7"
FT                   /protein_id="ABV66371.1"
FT                   /translation="MPNWTEIIEKLDYAFQPIIYSHSGKIYAVEALLRNVNEIPGLMSI
FT                   DDLFDLAFNDDYLYELDLQLREKAISKFGKIKQSNLKLFYNLDNRIIYNKNYSQGNTAK
FT                   ILKKYNLNKDSICFELSEKGTAIEQNALSTMLQRYKESGYKIAIDDFGIGVSGLKLLYF
FT                   SEAHIIKLDRFFITNIDQDSKKKLFCSSIIEMAHIMGMQVIAEGIETAKEFYTCKDIGA
FT                   DFIQGYLVQKPTTNIDKIEKIYKNIYSLISEDKRASQKNFIDEKFIENILPLNVNTSLY
FT                   DLFLHFKENTKSHFVPITDEFGNFLGIIYESDIKKISYSQYGLSLAQNRTFSSTLLKYI
FT                   KPALSVEISWGIDKILEIYNLNSNNSLGIFITSSDKYIGFINLNSLLTLSYKRNIEIAT
FT                   NQNPLTKLPGNNQIEKFIDKSFKKNQKDITHIIYFDFNDFKPFNDIYGFRQGDRAILIF
FT                   SELLQKRYSKDSFIAHIGGDDFFVGLKNKDKEDVFELTSNVQDEFRNSAKNIYSKEDKK
FT                   NGFIISKDRFNEKRRFELLSVSAAIIEINSKSDISNFDNTLNIVKKASKNSKKPIYSIL
FT                   "
FT   gene            97552..98508
FT                   /gene="pstC"
FT                   /locus_tag="Abu_0087"
FT   CDS_pept        97552..98508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="Abu_0087"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="Pfam match to PF00528 BPD_transp_1, score 60.3,
FT                   E-value 5.9E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66372"
FT                   /db_xref="GOA:A8EQZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQZ8"
FT                   /protein_id="ABV66372.1"
FT                   /translation="MKISIKAKGLNSFESRKKQRELNEKLIKIALIFAAAISILTTFGI
FT                   LFSILFEAIEFFKLRSFWYFLTGTVWSPGVVGSQFGALPIFAGTFVITIIALLVAIPIG
FT                   LGSAIYMSEYASPKLRDYLKPLLEVLAGIPTVVYGFFAAVTVAPFVVKVAAIFGLEATF
FT                   NSALASGIVMGIMIIPLVSSLSDDVIKAVPDSQRKAAFGLGMTHGETIKNIVLPSAMPG
FT                   IISASLLALSRALGETMIVVMAAGLRPNLSWNPLEDMTTVTVTIVNSLVGDFEFNSPET
FT                   LSAFALGLMLFIVTLILNMISLSMIRKFKEKYKVNTL"
FT   gene            98505..99689
FT                   /gene="pstA"
FT                   /locus_tag="Abu_0088"
FT   CDS_pept        98505..99689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="Abu_0088"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="Pfam match to PF00528 BPD_transp_1, score 48.7,
FT                   E-value 1.8E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66373"
FT                   /db_xref="GOA:A8EQZ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8EQZ9"
FT                   /protein_id="ABV66373.1"
FT                   /translation="MMKKKKNKQNNPFYDPTLKSRHTSAARFKKFTLTSLIFSIAFLAF
FT                   FLFDMITKGVPAFNVAYVKIDVTFSEKSLEDTRFAVDKKYKDIVSRAWLRDIPTLLKQN
FT                   PDYMNTTQNLWVLADDQVDQYIKNHNNNLKEKEILIVDELYSQGLIEKKFNAIFFKNGD
FT                   SKIPEYAGIFSAVIGSILTLIITMLVAFPIGVMTAIYLEEFAGDNKFTRFIEININNLA
FT                   AIPSILFGLLGLAIFINLFGMPRSSPLVGGLTLALMTLPIIIVSSRAALRAVPDSIRQA
FT                   GYGLGLNKIQVTRDHVLPLAFPGILTGSIIGLAQAMGETAPLIIIGMIAFIPDAPTMVT
FT                   QAATVMPAQLFTWAGMPEGMYIEKTAAGILVLLTILISLNAIAIYLRKKLEVKW"
FT   gene            99705..100475
FT                   /gene="pstB"
FT                   /locus_tag="Abu_0089"
FT   CDS_pept        99705..100475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="Abu_0089"
FT                   /product="phosphate transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="Pfam match to PF00005 ABC_tran, score 187.1, E-value
FT                   3.8E-053"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66374"
FT                   /db_xref="GOA:A8ER00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER00"
FT                   /protein_id="ABV66374.1"
FT                   /translation="MNTDNKIKIDTKNLNLFYGSNQALHDINVSLFENKITALIGPSGC
FT                   GKSTFLRCINRMNDLIPIVKIDGQIIIDNKNIYDKDVDEVSVRKKIGMVFQQPNPFPKS
FT                   IYDNVAYAPLKHGIVKKGKECDELVESSLIKSGLWNEVKDKLTQPGTSLSGGQQQRLCI
FT                   ARTIAVRPEVILMDEPTSALDPISTEKIEALMLDLKQDYTIITVTHNMQQAARVADYTA
FT                   FFHLGKLIEYDITETIFVNPHNKKTEDYITGRFG"
FT   gene            100475..101143
FT                   /locus_tag="Abu_0090"
FT                   /note="AB0093"
FT   CDS_pept        100475..101143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0090"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66375"
FT                   /db_xref="GOA:A8ER01"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER01"
FT                   /protein_id="ABV66375.1"
FT                   /translation="MLKPYETKLQNIKEEIQQIGVSVIEALEICLKALNDRRIEDLSNV
FT                   EISEKKILLKSNEIDNIIVGTLALYSPEAKDLRRLVSFLKITNELVRTGSNAKDFAKMF
FT                   KKSYSQDLDTAIILEYAIPLLKSALLSLQTATSIIDEHDEKQIEEKYHRVVVEESKTDD
FT                   LYLMIEKNILKLITKKLDLSKEYFDILSSLRRLEKIADRAVSIAKLLQFAQVGGDIVQS
FT                   "
FT   gene            101167..101571
FT                   /locus_tag="Abu_0091"
FT                   /note="AB0094"
FT   CDS_pept        101167..101571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66376"
FT                   /db_xref="GOA:A8ER02"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER02"
FT                   /protein_id="ABV66376.1"
FT                   /translation="MKKAINKISNYFSSNFEVLVATIIFLSIIVAGHDFYRAIILMLEF
FT                   IVIMEVVKMISDFIKRETLRLRYVLDIFIIFLIREVIILSANKNRDYVDITFLLFVIFI
FT                   FFIFRILAIKYSPGPKDENEKTNKVIENDE"
FT   gene            101561..102238
FT                   /locus_tag="Abu_0092"
FT                   /note="AB0095"
FT   CDS_pept        101561..102238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0092"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 103.8,
FT                   E-value 2.4E-031, and to PF00486 Trans_reg_C, score 42.4,
FT                   E-value 1.4E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66377"
FT                   /db_xref="GOA:A8ER03"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER03"
FT                   /protein_id="ABV66377.1"
FT                   /translation="MTNNKLILIIEDEEDILELLEYTLQKEGYETIGFLSIDKNVKKVL
FT                   DEEQIDLILMDRNLPNIEGTTFINEIKKEGYVNPVIYLTAKDKDEDILEGFESYADDYI
FT                   TKPFNVKELCARVKAVIKRTSKELDILKVKDIVYNASNKKFYIEDKEIDLTHLEHDLLL
FT                   EFIKNKDILMTREHLLNIVWQDSFDKKEKTVNVAIKRLKAKIDPDGTKNYIHSVRGEGY
FT                   IFC"
FT   gene            102232..103617
FT                   /locus_tag="Abu_0093"
FT                   /note="AB0096"
FT   CDS_pept        102232..103617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0093"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 64.8,
FT                   E-value 2.5E-016, and to PF00512 HisKA, score 59.4, E-value
FT                   1.1E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66378"
FT                   /db_xref="GOA:A8ER04"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031967"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER04"
FT                   /protein_id="ABV66378.1"
FT                   /translation="MLKIHQLFLRTYFTIFVAILVTLTLVTYFWAKNLYINQIEKTLSQ
FT                   NIDTLSIVLKEQNSLSHIKNIVRDLHSELNLRITIIDEQGEVIAESDENLAFIKNHANR
FT                   PEIIQAKNVGFGKDKRNSETVKKELLYIAKKFEIDNAIYFIRMADYTNKIADNFMKLTI
FT                   EIFMYITFFLIIAFLATYFISLKIKKETDTILYFLTQLTNKKSLIPLRSTYTYEFYKIT
FT                   KLLNKVAIKLSKKDKQKSKQNAKLKLANRQKDEIISAISHEFKNPIAIISGYSETILND
FT                   KDMPEAMKSKFLNKIYSNANKMSHIIDKLRLTLKLEEGKQELLLVPCSMKKIVENCVSD
FT                   LKDKYKNREIVIKGEDVSIKVDETLISMAIANLIENSLKYSQKEVVVELSKEYICIIDK
FT                   GIGIEKKELENINQKFYRISNNGWNNSLGLGLFIVQSILNLHSFKLEIESEIDKGSNFY
FT                   IKY"
FT   gene            103693..104112
FT                   /gene="rplM"
FT                   /locus_tag="Abu_0094"
FT   CDS_pept        103693..104112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="Abu_0094"
FT                   /product="50S ribosomal protein L13"
FT                   /note="Pfam match to PF00572 Ribosomal_L13, score 176.4,
FT                   E-value 6.3E-050"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66379"
FT                   /db_xref="GOA:A8ER05"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER05"
FT                   /protein_id="ABV66379.1"
FT                   /translation="MKFTQMAHANEIKRDWIVVDATDKVFGRIITEVATILRGKNKPCF
FT                   TPNVDCGDFVVIINASKAKFSGKKLESKNYFTHSGYFGSTKTHKMSEMFEKNPEKLYKL
FT                   ATRGMLPKTTLGKEMLKKLKVYAGSEHPHTAQIKG"
FT   gene            104118..104507
FT                   /gene="rpsI"
FT                   /locus_tag="Abu_0095"
FT   CDS_pept        104118..104507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="Abu_0095"
FT                   /product="30S ribosomal protein S9"
FT                   /note="Pfam match to PF00380 Ribosomal_S9, score 166,
FT                   E-value 8.9E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66380"
FT                   /db_xref="GOA:A8ER06"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER06"
FT                   /protein_id="ABV66380.1"
FT                   /translation="MAKVYATGRRKTSIAKVWLESGNGQLTINGQTLDAWLGGHESIKK
FT                   RVMQPLNVAKQETSVNIIVKTLGGGYSAQADAARHGISRALVAFDEQFRTILKPYGLLT
FT                   RDSRSVERKKFGKKKARKSSQFSKR"
FT   gene            104560..106110
FT                   /gene="appA"
FT                   /locus_tag="Abu_0096"
FT   CDS_pept        104560..106110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appA"
FT                   /locus_tag="Abu_0096"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="Pfam match to PF00496 SBP_bac_5, score 246.3,
FT                   E-value 5.7E-071"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66381"
FT                   /db_xref="GOA:A8ER07"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER07"
FT                   /protein_id="ABV66381.1"
FT                   /translation="MLLFLYHFYKKTIQYGMKFLTIFTILITFLNASTLTLSMTSSPSR
FT                   LNPILSNDTASTEISDWLFNGLFKYDKEGNIIPDLAKSYSFETPTKLIIKLKENVLWHD
FT                   KVKLSSKDVVFTYEQVINPKVFNSIKSNFQEIKSVKAIDDLTVEVIYKRPYFKAIQVWM
FT                   IGLLPYHILKNEENLMTSSFNKNPIGTGSYKLKEFKVGQDIELIANEDYFEGKPKIDKI
FT                   LYKFLPDSNTAFLYLKEKKLDIGSLDAIQADRQIDDSFKNDYTIIQKPAFSYGYLGFNL
FT                   KNEKFKDKKVRQALSLAINRKELIDILFFGYGRVCNGPFLPGTFAYDENVEEIKQDVQK
FT                   AKELLKEAGYDEKNPFTFEVITSTGNDIRINAAQILQNQLEKVGVNMRIRVMEWQAFLN
FT                   TVVHPRNFESIILGWSMPLTPDAYPLWHSSSDKLGGFNLPGYKNEKVDELIEKGLNTIN
FT                   NDELSKIYKEIFKQISDDLPYLFLYIPDGITAVNKKIKNIEPAFTGITHNQKDWEIKE"
FT   gene            106120..106767
FT                   /locus_tag="Abu_0097"
FT                   /note="AB0100"
FT   CDS_pept        106120..106767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0097"
FT                   /product="conserved hypothetical protein, HAD-superfamily
FT                   hydrolase"
FT                   /EC_number="3.6.1.1"
FT                   /note="Pfam match to PF00702 Hydrolase, score 70.1, E-value
FT                   1.2E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66382"
FT                   /db_xref="GOA:A8ER08"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER08"
FT                   /protein_id="ABV66382.1"
FT                   /translation="MNKIILFDLDGTLIDSTDAIVSTFRFAFKEQGFDFRGSDKNIKDL
FT                   IGYPLDIMFERLGVSKQKVWDYVDSYKNRYRVISVEQTTLLENAFEAVQLASKIARVSV
FT                   VTTKTRMYTIPILDNFNITQYFEIITGRENVENPKPHPEPILKTLAQMNYDKNKDEVYM
FT                   IGDTKLDLICANEAKVNAIGVLCGYSDEEELLKYTNIVKKDALEAIKYISSN"
FT   gene            107081..108052
FT                   /locus_tag="Abu_0098"
FT                   /note="AB0102"
FT   CDS_pept        107081..108052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0098"
FT                   /product="conserved hypothetical protein, putative
FT                   tricarboxylic transport protein TctC"
FT                   /note="Pfam match to PF03401 Bug, score -36.5, E-value
FT                   1.3E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66383"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER09"
FT                   /protein_id="ABV66383.1"
FT                   /translation="MKNKFSKIYKNVALASCLVAGIASSTLASSVEKIHFIIPGGAGGG
FT                   WDGTARGVGEALKKSNLIKEVSYENMSGGGGGTAIAYMIETAARQQNTLMINSTPIVIR
FT                   SLQGVFPQSFRDLSLVAAVVADYQVLVVKKDSKYNSWADIKATFDKNPTALKIGGGSSR
FT                   GSMDHLVAAQIFKASGGNPSDVRYVPYDAGGKALAGLLTGEIEILSTGLGEVIDKHKSG
FT                   ELKIIATTAEETIDGVPSFKEIGVDTYFANWRGFFAAPNLSEEKVNDFAKVFEEMYKTA
FT                   EWEEIRKRYGWSNLYKPTTEFKTFLETQEQGISSLMKEMGFL"
FT   gene            108089..108574
FT                   /locus_tag="Abu_0099"
FT                   /note="AB0103"
FT   CDS_pept        108089..108574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0099"
FT                   /product="conserved hypothetical protein, putative
FT                   tricarboxylic transport protein TctB"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66384"
FT                   /db_xref="GOA:A8ER10"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER10"
FT                   /protein_id="ABV66384.1"
FT                   /translation="MTKNTIGSLFFLAFSAFYFYSVFGIKKMPGAQFEIMTAQTFPFYI
FT                   GIAGITISIVLLIISLIEKEKLVLSLQYIKSLDLKTTFYFIIVMLFYGFIMKPLGFVLA
FT                   TIIFLAVSFLILKERNMKKIFFISVGVSVGFYLLLNNALGVYIDAGDLINSFLGAKS"
FT   gene            108571..110088
FT                   /locus_tag="Abu_0100"
FT                   /note="AB0104"
FT   CDS_pept        108571..110088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0100"
FT                   /product="conserved hypothetical protein, putative
FT                   tricarboxylic transport protein TctA"
FT                   /note="Pfam match to PF01970 DUF112, score 629.2, E-value
FT                   3.2E-186"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66385"
FT                   /db_xref="GOA:A8ER11"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER11"
FT                   /protein_id="ABV66385.1"
FT                   /translation="MMDGIILGAVTAFSLYNILMVTIGCFAGTFIGMLPGLGPISAIAL
FT                   MIPITYGMDPSSGLILIAGVYYGAIFGGSTSSILINAPGVAGTVATSFDGFPMAKNGQA
FT                   GKALAIAAYASFSGGTIAAIFLLFAAPALATVSLSFQSSDYFALMVLGLTAVAAFAGKG
FT                   KFLKAAIMTIFGLMLATVGTDSDSGIARFTFGRMDLIDGISFLLLAMAAFALSEALMNV
FT                   LENHKTTKEEEEALKREIGSLKLTREEVKEIVPTIGRGSVLGFFIGVLPGAGATIASFL
FT                   AYGMERSIASAKDKLKFGKGSLKGLAAPESANNAACSGSFVPLLTLGIPGSGTTAIILG
FT                   ALISYGVQPGPTMYVDSPALFWSVIISMYIGNLVLLFLNLPLIPYIAKILALPKQLLLP
FT                   LIIFFSLVGVYLVTFNVFDIYMMTIFAVVALFLRIIDFPMAPMILGFILGGMMEENLRR
FT                   ALTLSDGSISFLWERPLTLTILIITIILLLMPIISSFFAKMKKEKES"
FT   gene            110116..110796
FT                   /locus_tag="Abu_0101"
FT                   /note="AB0105"
FT   CDS_pept        110116..110796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0101"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 96.8,
FT                   E-value 3.3E-029, and to PF00486 Trans_reg_C, score 46.6,
FT                   E-value 7.5E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66386"
FT                   /db_xref="GOA:A8ER12"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER12"
FT                   /protein_id="ABV66386.1"
FT                   /translation="MEIFKKYTILYIEDDDGVRNINSRFLNRMFNELYEAKDGEEGYAL
FT                   YKKYHPDIILTDIKMPKLDGISLTKKIRQKDKTTKIIISTAFSEKEYLIDAIELNIEKY
FT                   IIKPLTSRNLMPALTKAIEALEKQKDFKIFLAEDFYFDNNTSLFYYKEKVIDFTKKELQ
FT                   FLKLLTLNKDRVVSYEEIEQNIWEDEYMSLNSLRTSIGFIRKKIPFNCIKNISNMGYKL
FT                   NLEK"
FT   gene            110786..112966
FT                   /locus_tag="Abu_0102"
FT                   /note="AB0106"
FT   CDS_pept        110786..112966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0102"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam match to PF02518 HATPase_c, score 51.7, E-value
FT                   2.2E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66387"
FT                   /db_xref="GOA:A8ER13"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER13"
FT                   /protein_id="ABV66387.1"
FT                   /translation="MKNNYNLNQENGIKKITLLSSTIIILFVATITGYNLIKTEYDNFK
FT                   NHINSFKETLIEREKFYIKSSVDNLKNDIDFEELSIINNKKHNIKTQSILAYNLAKSIY
FT                   EKTTKLSKEEQINFIKTAIKQIAQKSNDINYFILDTNGNLILNSDNEIDENRNFYNFQD
FT                   INGKKFVQEMINTDSNKQNFIEYFWYIPNQSLTANKITYSRHLKELDLIIGSGTFLEKQ
FT                   NSELISKLITKIENQNVNNEEFIFIYKINSLNDIKNKSELISKKLIEPKKEDLEAMEKL
FT                   LINTNYKGNDYLFYNNNQQLIYGTYLKEHRYFIAIGVNLVNIYDIVEKERNISLENMYK
FT                   NINRLVIIITVMTIIFFIFSLLFTKRIETIFQEYKENVILNEDKYRMLFNHSNDAFIIS
FT                   ELDSNEYTRITSYNKTASKVTFYDEKELIDKSFFDLFINLDTKKILTEKSFFDTVKLKT
FT                   KYDDIKTIELSIIIYEANKKTIVFASIRDITERTLLKENKEKQEKILIQKSKMASMGEM
FT                   IGNIAHQWRQPLSQLSGLFFDIKSAYDYKELDTKYLQNRVEEANDLLEYMSKTIDDFRN
FT                   FFSPNSQKEEFFINQAVQNALKIAQSTLNFYQIKISVQVDESLKISGYQNEYSQAVMNI
FT                   ISNAKDILIEKNISDPQIKIYLEKNVLCIEDNAGGIDEEIINKIFDPYFTTKYEYGTGI
FT                   GLYMTKMIIEEKMGGSINVKNTRTGAKFFVEV"
FT   gene            113010..113663
FT                   /gene="cynT1"
FT                   /locus_tag="Abu_0103"
FT   CDS_pept        113010..113663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT1"
FT                   /locus_tag="Abu_0103"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="Pfam match to PF00484 Pro_CA, score 123.3, E-value
FT                   6.4E-034"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66388"
FT                   /db_xref="GOA:A8ER14"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER14"
FT                   /protein_id="ABV66388.1"
FT                   /translation="MNPIKNLIRGNKLFRKYQFDEFKDELEELNISGQKPEILFISCCD
FT                   SRITIDFMVGTKPGDLFILRNIGNFVPPFSLNGDFHGTASAIEYAVSILNVSNVIVCGH
FT                   SYCGACQSLYSDIPQNSHYINIRKWLKLGKKAKEMTLKNKHLYKNQEELYKATEKNSII
FT                   CQLKNLLTYPAIKEKIELNEITIHGWYYNLDDGSIQYYDEKDRLFKEISEYLND"
FT   gene            113656..114741
FT                   /locus_tag="Abu_0104"
FT                   /note="AB0108"
FT   CDS_pept        113656..114741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0104"
FT                   /product="conserved hypothetical protein, putative ammonia
FT                   monooxygenase"
FT                   /note="Pfam match to PF05145 AmoA, score 88.1, E-value
FT                   2.4E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66389"
FT                   /db_xref="GOA:A8ER15"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER15"
FT                   /protein_id="ABV66389.1"
FT                   /translation="MIKKIKLNKKMQELPILIKMLLALLIAVSGSILFIFLHFPLPWLL
FT                   GAIFATTIAIRFPTVPISSPKPFSAPARILIGLTIGSAFTPHILQYIPHYIISLLLVIP
FT                   FTLLVIFFGTYYYHKILKYDLKTSYLGSMPGGVIEMVIIGQDLKADTSKITLMQSSRLF
FT                   FVIVSLPFIIQYIFQIDIRGNQILTTPIKDINLFEFSYIYILGIAGAIIAKRLRLAAAY
FT                   LIGPMIVSIILYSTGFVHTHIPDELLKFIQVIFGTIIGFTFKNVSLKTISKTFLATLGH
FT                   FAILIILCAIFIFIIYKSLDFKALDILLAFGPGGQTEINLVAILIGANLPYITLHHIVR
FT                   LFIVMNIAPIIAKRLDRNNSI"
FT   gene            complement(114718..115296)
FT                   /locus_tag="Abu_0105"
FT                   /note="AB0109"
FT   CDS_pept        complement(114718..115296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER16"
FT                   /protein_id="ABV66390.1"
FT                   /translation="MKNSILILTIFLLFTGCTFKQQRIDINHYSIDFKTQKISQNAKLS
FT                   SIFIEEPNVNRSFNLTSIYYNTKPYLFEEYAKNKWINLPSNMIYNQLIDSFIASNIFSN
FT                   VISKDSKIEHKYTLKTDIIKLYHEFKEDKSYAILKIKFDLIEDKKVIKTISFDKNVLCV
FT                   TNDAYGFVKALNKGLEESTNSLLNTIISI"
FT   gene            complement(115293..116201)
FT                   /locus_tag="Abu_0106"
FT                   /note="AB0110"
FT   CDS_pept        complement(115293..116201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0106"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /note="Pfam match to PF02470 MCE, score 70.7, E-value
FT                   4.3E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66391"
FT                   /db_xref="GOA:A8ER17"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER17"
FT                   /protein_id="ABV66391.1"
FT                   /translation="MDTKINFFKIGLFVSSLFTLLVIFIFWLGKYGLEDKKYDDYSIFF
FT                   SESVSGLNIGSSIKFMGFEVGTVKDIKINPYNSEEIQIDIQIQKGTPIKEDNFAILGNL
FT                   GITGLKYIELKGGSNNSKLLGENQYGMKVIKSKTSALTTFVDSTEDITKEITILLGQMK
FT                   KVLNDENISNFSSLLSKSEKSMANIEQFSAYLVKNEKKIDELINSMKNFANTGNSSFAS
FT                   VKTSADSFKELTTKIKEEFDKGTFDLKGMSSESFENLNSLLKNLENNLNLTQDLINNIN
FT                   ESPSDLLLKQKNIKYGPGEKE"
FT   gene            complement(116201..116938)
FT                   /gene="iamA"
FT                   /locus_tag="Abu_0107"
FT   CDS_pept        complement(116201..116938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iamA"
FT                   /locus_tag="Abu_0107"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Pfam match to PF00005 ABC_tran, score 170.2, E-value
FT                   4.8E-048"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66392"
FT                   /db_xref="GOA:A8ER18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER18"
FT                   /protein_id="ABV66392.1"
FT                   /translation="MKIIEVNNLYTAFGENVVHNDISFSVNEGEIFGILGGSGSGKSVL
FT                   VKQIVMLNQIQRGNIKIFDKDISTLSLKQTEDLKLQFSYLFQFGALYSFLNVIENISVM
FT                   LKEYTNLPKDLIEKIAYTNLDIVGLPKNVAKLYPSQLSGGMKKRVALARSLAMQPKILF
FT                   LDEPTSGLDPASTKSVNELLLYLKNSLNITTVIITHDLDTIKTLLDRFIIIKKEKIFDG
FT                   NITEALKSEDEFIKDFLTNKKAT"
FT   gene            complement(116939..118051)
FT                   /gene="iamB"
FT                   /locus_tag="Abu_0108"
FT   CDS_pept        complement(116939..118051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iamB"
FT                   /locus_tag="Abu_0108"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Pfam match to PF02405 DUF140, score 282.3, E-value
FT                   8.5E-082"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66393"
FT                   /db_xref="GOA:A8ER19"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER19"
FT                   /protein_id="ABV66393.1"
FT                   /translation="MENCDYFLLEKNENNYKLTLLNIWNKQTLPNIIKKIELLNFSKNS
FT                   KLNIDFANLKECDSSAIIYLISFLNTFEEKNITILNNKNHEKIFDFYKKHYQTKVLEEE
FT                   KKNLFFEDLGKKSYDIYKESKEFIGFIGKVFYFFIYAIFNPSKIRFKAMLKYIETSAFD
FT                   ALLIVAVTSFLVGVVIAYQGSVQLEKFGANIFIVEMISITIFREIAPLVTAIVIAGRSA
FT                   SSYTAEIGAMKITEEIDAMKTMNFEPTLFLTLPRIFALCISLPLLVFFADIIGVFGGMV
FT                   IASSSLDVTFIEFINRLHNEVPLKHLILGVFKALFFGFAIAIIGCYRGFQVQNNTTSIG
FT                   KFTTMSVVNAIFVVILIDAVFSVIFTQMGI"
FT   gene            complement(118130..119041)
FT                   /locus_tag="Abu_0109"
FT                   /note="AB0113"
FT   CDS_pept        complement(118130..119041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66394"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER20"
FT                   /protein_id="ABV66394.1"
FT                   /translation="MIKINIDETIVNNFYNGVKEYIGKHLFSNAEKDYFTDEKIEEIIK
FT                   CKIDDFQKIIDEIINLKLNPKIIKQSFVGDEENKFGYKKFTTKAKTQYRAYNLSEALNI
FT                   DVCPYCNKNYTYTIVNKTHQYTRPDFDHFLAKEKYPYFAMSFYNLIPSCQVCNRTLKHR
FT                   KEFSFTTHLHPYKDDFNSIKKFTTTKPLLLCNNEKDFEIKFKDIAEDTVLLEKANKNIE
FT                   DFALPLQYNKHKDIVLELKNRYELYNDDSIKNILKDTEVFKKKGEEYIKSLIMCSSTKD
FT                   KDINKRPLSKLIKDISEELDLI"
FT   gene            complement(119034..120617)
FT                   /locus_tag="Abu_0110"
FT                   /note="AB0114"
FT   CDS_pept        complement(119034..120617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66395"
FT                   /db_xref="GOA:A8ER21"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER21"
FT                   /protein_id="ABV66395.1"
FT                   /translation="MELVYLWVKNYKNIVEQGFNFSPRFRCEYDEDTKELKVVDKNETG
FT                   EFYPKNFFGNNINVTAIVGENGSGKSSLLLGITNSKIIIRRDNQFYTNDFTSEIHKFTN
FT                   INREKDYDIIYMDFDLIKINPITDFWDFSQQNIYDKNLYKRIENNFSGNVNFNIIKYKE
FT                   NFYNLIIKYDDSFLSELFFYNPIEIRLSDFIKTIPFQDSQSKYINDKIKSVQSKNYSKI
FT                   KFLTFLYSKIKNNPELSKLKHFDDDISILEKEQDILNYNRFSNQEEIDNIYKLLKVLEN
FT                   KKIHKFSIEDFNKQIYNENQEAFFKLTELGYLEVNLKDKTGREYFDLSQGERKLFAEFL
FT                   MIFDSISKSDKNEIFLVLDEPDLGLHPQWQKNYIQELIKLLSTFPKKRFHIIITSHSPF
FT                   ILSDLPKENIIFLEKGKQVYPFEDGKQTFGANIHTLLSHGFFMKDGLMGEFAKEKINQV
FT                   YNFITQKGTSFIKTKEEAQNIINLIGEPMLKKELQFLYNEKFEIDDIDKQIREYEEAIE
FT                   KLKSKKKKND"
FT   gene            120758..121273
FT                   /gene="luxS"
FT                   /locus_tag="Abu_0111"
FT   CDS_pept        120758..121273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="Abu_0111"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /EC_number="3.13.1.-"
FT                   /note="Pfam match to PF02664 LuxS, score 314.4, E-value
FT                   1.9E-091"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66396"
FT                   /db_xref="GOA:A8ER22"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER22"
FT                   /protein_id="ABV66396.1"
FT                   /translation="MPLLDSFRVDHTIMPAPAVRVAKVMQTPKGDDITVFDLRFCVPNK
FT                   SMMSEKGTHTLEHLFAGFIRNHLNSPTVEIIDVSPMGCRTGFYMSLIGTPSEQEVAVAW
FT                   KKAMEDVLKVENQSDIPELNLYQCGTCAMHSLDEAKDIARDILKSQIGVMSNKELYLSE
FT                   EKLKSLGN"
FT   gene            121275..121715
FT                   /locus_tag="Abu_0112"
FT                   /note="AB0116"
FT   CDS_pept        121275..121715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER23"
FT                   /protein_id="ABV66397.1"
FT                   /translation="MQEKLDLFKGLFSDYTNISILHIDNSLGLVNSTLEEIKEQNKGNI
FT                   KYISFEDESSAKLSSARVYEYIVLSDILSYCQNKEEILKSHYKALENSGNIIILEKISN
FT                   DNRYEILDMLEEIGFQAPNAIELFDEVLIFTAKKMHHWGYGL"
FT   gene            121697..122467
FT                   /locus_tag="Abu_0113"
FT                   /note="AB0117"
FT   CDS_pept        121697..122467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0113"
FT                   /product="conserved hypothetical protein (DUF752 domain
FT                   protein)"
FT                   /note="Pfam match to PF05430 DUF752, score 83.4, E-value
FT                   6.6E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66398"
FT                   /db_xref="GOA:A8ER24"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER24"
FT                   /protein_id="ABV66398.1"
FT                   /translation="MGLWTLILENNQNILVTTLDGSNTLFSTKYNQHFHNTEDGAINEA
FT                   LSKHIIPTFFYHQNKKELNILDICFGIGYNTFSTIYYILKNNLDIKINIFSPELDEDLI
FT                   KSLKDFPFPKEFENIKHIIKAISTSNKYEDEKIKIEVFIGDARAYIKNFEKNFFDIVFQ
FT                   DAFSSDVNKELWTKEYFEDIYKICKEDSILSTYAIATPIRLSLYEAKFYIYETKSTKRK
FT                   ITLATKSLKNSIGKYIDMELKKQRNQDAKALYDK"
FT   gene            122506..123327
FT                   /gene="dacA"
FT                   /locus_tag="Abu_0114"
FT   CDS_pept        122506..123327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="Abu_0114"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="Pfam match to PF00768 Peptidase_S11, score 153.4,
FT                   E-value 5.5E-043"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66399"
FT                   /db_xref="GOA:A8ER25"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER25"
FT                   /protein_id="ABV66399.1"
FT                   /translation="METIMKFLLSALILIFTPIMAFSYTEANVFQKIEKDLDSIIVKDL
FT                   TKKQLIFSKDANQQVSPASLTKIMTAILAIESNKMDSIVTITADMKKVEPTILGFKVGE
FT                   KIYLRDLVNAALIRSANDAANSIAIYLGNGDKQKFVNMMNAKAKKLGMTKTTFQNPCGF
FT                   DAKNHKSTASDLLKLTEYAIKNSTFNAIVRKNSYSFKAINTKRTYTVYTSNKLQPKEKY
FT                   MIGVKTGYTNQAGPCLIARAKEGKKDILLVMLNSHNRWENTKLALDTILNK"
FT   gene            complement(123339..123839)
FT                   /locus_tag="Abu_0115"
FT                   /note="AB0119"
FT   CDS_pept        complement(123339..123839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66400"
FT                   /db_xref="GOA:A8ER26"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER26"
FT                   /protein_id="ABV66400.1"
FT                   /translation="MMFKEKNVQSKVLEYIYTTSKQPILLKDMLVANRQFNNGMQVDPG
FT                   KLGFRLRLSRAYFLYIGIVLVILVPVSLLTHKALAKVDSHISILGAMVITAMIFIGFNF
FT                   FRDKMRDIMTKELIKKSWKLHFPFFSYEEYSIKIDSIFEKAMKEEISKKDLERYILDKL
FT                   TAN"
FT   gene            123957..124397
FT                   /locus_tag="Abu_0116"
FT                   /note="AB0120"
FT   CDS_pept        123957..124397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0116"
FT                   /product="putative membrane protein, DoxX family"
FT                   /note="Pfam match to PF07681 DoxX, score 106.8, E-value
FT                   5.7E-029"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66401"
FT                   /db_xref="GOA:A8ER27"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER27"
FT                   /protein_id="ABV66401.1"
FT                   /translation="MRCCESKLESILNEDIGKLILRVSIAVLMLFHGFAKLQNGIDGIK
FT                   FLVTSAGLPEFFAYGVFLGEVVFPILIILGLFTRISSFFFAFTMVFAVFLAHSADIFTL
FT                   GKTGGPVIELPLIYLLASVSIMFLGAGKYSLDAKCKAKACSI"
FT   gene            complement(124421..127900)
FT                   /gene="metH"
FT                   /locus_tag="Abu_0117"
FT   CDS_pept        complement(124421..127900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="Abu_0117"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /note="Pfam matches to PF02574 S-methyl_trans, score 258,
FT                   E-value 1.8E-074, and to PF02965 Met_synt_B12, score 150,
FT                   E-value 5.9E-042, and to PF00809 Pterin_bind, score 130.4,
FT                   E-value 4.7E-036, and to PF02310 B12-binding, score 91.2,
FT                   E-value 2.9E-024, and to PF02607 B12-binding_2, score 87.1,
FT                   E-value 5E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66402"
FT                   /db_xref="GOA:A8ER28"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER28"
FT                   /protein_id="ABV66402.1"
FT                   /translation="MEELIKNLIDKRVLIIDGAMGTQLQIADIKKEEWFFEDLDLEGCN
FT                   ELLNLTAPHILETIHDNYAKAGADLISTNTFGSMPWVLDEYNIGHMSYELSKLGASLVK
FT                   KSCEKFSTPEKPRFCLASIGPGTKLPSLGHIKYDEMYEGYKIMAKGLVDGGTDIFLLET
FT                   CQDPLQIKAALHALNDVAPNIPIMVSVTIELSGTMLIGTDAMTIAAIMAPFNILSLGFN
FT                   CGTGPVQVHKHVKTLSQVCKFPISVHSNAGLPQNRGGKTYYPMQPEEFTALQKEFLKIN
FT                   GVSFLGGCCGTTPEHIEALAKAVENEIPLKPCGFLKASLASLFNIVPLKQEPAPLLIGE
FT                   RSNATGSKAFRELLKANDYEGTLSVAQQQVRAGAHVIDVSVGFAGRDERFDMDEVVSLY
FT                   SQKIALPLMPDSTQILALEAALKQIGGRCIINSVNLEDGIEKFDAVCSLAKKFGAALVC
FT                   LVIDEIGMAKSKERKLEVAERIFDLCVNRHGFDPADLVFDMLTFTIGSGDDEYRTAGIE
FT                   TLEAIREFEIRHPEVGTTLGLSNISFGLATNARIYLNSIYLDHCVKAGLTSAIVNVKHI
FT                   LPLNKISEEDKKACDNLIFNIWENGADPLFAFIEHFSNVEGQEEQSDEEYQKLEPIEKV
FT                   KKLLLDGDKERLIPLALELRHTISPEIIVNEWLIDGMKVIGELFGSGQMQLPFVLQSAE
FT                   TMKACVDSLNPYLPKQEKASETTLILGTVKGDVHDVGKNLVDIILSNNGFKVVNVGIKA
FT                   DLGQFVEELNKHNAHAIGMSGLLVKSTAVMKENLEELQKLGIKVPVLLGGAALTKNFVD
FT                   EYCRTIYDGPIFYCRDAFDGVVSMQRIEKGDENNTALAADLIERIDTSDRVEKEEIEIP
FT                   SYEEISMPERGKFVFPPIWDRVTKRGEKLNKELIFKWINHRVLFRQRWGYKRGKQTPEA
FT                   FMKYERDVVEPTYEALKAELVDKDIFDPIAIYAYYPCISHDNKLYIFDKKYLFNSLEES
FT                   KNIPPLSEAIKVLEFPRQKRKPFRCIPDFFANDRLDVVAFTLASAGLKITDYERSLYDN
FT                   GEFTKYYQVHGLGVELAEALAEVLHKQIRLDLDIVPNEGHTLNDVQMKQYVGCRYSPGY
FT                   AACPDLAMNRDIFDLLNPEEFGIELSETFQMHPEQTTCAIVVTNPEANYYNV"
FT   gene            128095..129015
FT                   /gene="ilvE"
FT                   /locus_tag="Abu_0118"
FT   CDS_pept        128095..129015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="Abu_0118"
FT                   /product="branched-chain amino-acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="Pfam match to PF01063 Aminotran_4, score 303.2,
FT                   E-value 4.5E-088"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66403"
FT                   /db_xref="GOA:A8ER29"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER29"
FT                   /protein_id="ABV66403.1"
FT                   /translation="MTESKYIWMDGEFVAWHDAKVHVLSHTLHYGNGAIEGTKAYKTVD
FT                   GRCAIFKLNEHTKRLLNSSKMTLMDVPFSLEELNKAQVELLQKNELTNGAYLRPLVYLG
FT                   YGVMGLYHKDAPVKVSLSAWEWGAYLGEEGLKKGVRVKISSFSRTPNTSGMGKAKAVAN
FT                   YLNSQMAKYEAVEAGYDEALLKDDQGYIAEASGACFFIVRDGVLISPPNDNSLESITQA
FT                   TAIELAKDLGIEVVRRRITREEIYIADEAFFTGTAAEITPIREVDARVIGCGSRGPITE
FT                   KIQSAYFDAVTGKNEKYIKYLTYIN"
FT   gene            129060..130133
FT                   /locus_tag="Abu_0119"
FT                   /note="AB0123"
FT   CDS_pept        129060..130133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0119"
FT                   /product="conserved hypothetical protein, Band 7 family
FT                   protein"
FT                   /note="Pfam match to PF01145 Band_7, score 108.4, E-value
FT                   1.8E-029"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66404"
FT                   /db_xref="GOA:A8ER30"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER30"
FT                   /protein_id="ABV66404.1"
FT                   /translation="MPIDNDYFKNRQQNNNGGGNGGNFQPPFETPEFFKNFGKKAGMLY
FT                   AIIIIIGVLFIFKPFVIIESGQVGIKATTGKYDKEPLNPGFHFYIPVIQRVIVVDTKVR
FT                   LLTYMNTQNIGSFDQSIKNNPAINVLDSRGLPISIELTVQYKIIAEGVPETIATWGPSW
FT                   EDKIVNQIVGEVARSVLGGYNAEVLPMKRNDVAESLDRLIKEKVTERSQGAVIVESVQL
FT                   KEIVLPEKIKEQIEKVQIANQEAERVRYEVQRAKQEAEKRAALATGEAEARRIEAQGRA
FT                   DAVTIEAKAQAEANKEIAQSLTQNLLQMQQIEVQGKFNEALRENKDAKIFLTPGGATPN
FT                   IWVDTKDKSRDTIVNQK"
FT   gene            130174..130461
FT                   /locus_tag="Abu_0120"
FT                   /note="AB0124"
FT   CDS_pept        130174..130461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66405"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER31"
FT                   /protein_id="ABV66405.1"
FT                   /translation="MKKRKLFIIINLFFISTIYAQEIESVLRIKPEPKYEDILKYNQNV
FT                   KYEDILEYKEKTEEEKESDYSFGFNLDINRELMTIEGFKIDVGTKFKGIN"
FT   gene            130461..131141
FT                   /gene="hisI"
FT                   /locus_tag="Abu_0121"
FT   CDS_pept        130461..131141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="Abu_0121"
FT                   /product="bifunctional phosphoribosyl-AMP cyclohydrolase/
FT                   phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="Pfam matches to PF01502 PRA-CH, score 173.5, E-value
FT                   4.8E-049, and to PF01503 PRA-PH, score 98.2, E-value
FT                   2.2E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66406"
FT                   /db_xref="GOA:A8ER32"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER32"
FT                   /protein_id="ABV66406.1"
FT                   /translation="MEQLNKIDWEKMNNLIPVITQDAKTNEVLMLAYMNKEALELTIKT
FT                   NYAHYFSRSKQRIWKKGESSNHLQEIVEILVDCDNDTLLLKVNQTGVACHTGRKSCFYT
FT                   NLKTDKIISDVEINTTAAYGVIDTLYHTICERKDEDVSKSYTAKLLKGNQNSMLKKIVE
FT                   EAGEFTFAVKDDNEEEIIYEAADVAYHVLVALASKNINPDRVKQELARRFGISGIEEKN
FT                   SRIK"
FT   gene            131234..131491
FT                   /locus_tag="Abu_0122"
FT                   /note="AB0126"
FT   CDS_pept        131234..131491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66407"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER33"
FT                   /protein_id="ABV66407.1"
FT                   /translation="MTNSCQYCSKKIPISKVFCSAECKESFFQKIAISVPKPFVKKLYF
FT                   FCSEEQKEYEIKTFAQRHNWHEKLVTEKIKELFEEYYQCG"
FT   gene            complement(131527..132708)
FT                   /gene="mrp"
FT                   /locus_tag="Abu_0123"
FT   CDS_pept        complement(131527..132708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="Abu_0123"
FT                   /product="ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66408"
FT                   /db_xref="GOA:A8ER34"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER34"
FT                   /protein_id="ABV66408.1"
FT                   /translation="MATIENIKKELEKVKYPGFTKSIVEFGFVKDIKLDGNSCFIILDI
FT                   TSTAIEVEEQLKKEITDCIEPLGLMLTLYFNKPKEQVQQSNSTSGKNIAPQIKKIVMVS
FT                   SGKGGVGKSTTTVNLAIASAMQGKKVGILDADIYGPNIPRMMGLNGKEVEVVGDKAKPL
FT                   NAYGVDVMSMGMLMQEGQALIWRGAMIMKAIQQLLRDILWEDLDILFIDMPPGTGDAQL
FT                   TLAQSVPVSAGINVTTPQHVALDDSKRSLDMFKKLHIPVAGIIENMSGFICPTCNTESD
FT                   IFGMGTCENLAKEYETQVLGSLPIEPSIRKGGDSGKPIVYFEPESITAKRYMIASDKLI
FT                   SFLNSQDEVSNAEIQPIMPAGVSACSTEGQKIKAQHDEAKKSGGSCGSGCGCH"
FT   gene            complement(132775..134127)
FT                   /gene="thiC"
FT                   /locus_tag="Abu_0124"
FT   CDS_pept        complement(132775..134127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="Abu_0124"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="Pfam match to PF01964 ThiC, score 1015.2, E-value
FT                   2E-302"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66409"
FT                   /db_xref="GOA:A8ER35"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER35"
FT                   /protein_id="ABV66409.1"
FT                   /translation="MRTWLDNHKNDKIRTQMYYAKQGIITPDMEYVAKVEKLDPELVRA
FT                   EIERGRLIIPANVNHKHLVPMSIGIASSCKINANIGSSALASDVSKEIEKVDVCLKYGA
FT                   DTIMDLSTGGDLDMIRRAVIEHSTVPIGTVPIYQILHDVKDKIEDLTIEKMLEVIEKQA
FT                   QQGVSYFTIHAGFLLEFMPHVAKRKMGIVSRGGSLMAAWMMHYHRENPFYEAFDEILDI
FT                   CRKYDVSLSLGDSLRPGCLADASDEAQLRELKVLGELTLRAWEKDVQVMIEGPGHVPLN
FT                   QIERNMKLEKEYCHEAPFYILGPLTTDIAAGYDHISSAIGAAVGGWHGASMLCYVTPKE
FT                   HLGLPNAEDVRNGIIAYKIAAHSADIARGRKGARDIDDEMSDARYAFNWNKQFELCLDP
FT                   DRAKEYHDETLPQDVFKEAEFCSMCGPKFCSYKITQKIVKEHGQEMVNIAG"
FT   gene            134273..135115
FT                   /locus_tag="Abu_0125"
FT                   /note="AB0129"
FT   CDS_pept        134273..135115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66410"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER36"
FT                   /protein_id="ABV66410.1"
FT                   /translation="MKKNLIQEIKTLENLPNSIKEINNFRKNDNSDVSALVKILKKDSL
FT                   IVSNILKISNSNLFGGNYKIETFNKAVELLGVKLILAISIGTIISKTINKNLFAYAVTN
FT                   DDFFYSSALSAIFIDNWLGQINEDLRNELLLPAFLQDIGKFIISQLIQDDRQTEFFLKS
FT                   LVETDDISACELEFTGYTCSRISANIFKHWDFSHNIIFPIAFTQDLENCPKDFLHKAQV
FT                   LNVVKILCDIRNPLSNNNIEKALKKVLEYNFDVEYFLNSLDSIRERIEKNSQHSLSNN"
FT   gene            135154..136278
FT                   /gene="ispDF"
FT                   /locus_tag="Abu_0126"
FT   CDS_pept        135154..136278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispDF"
FT                   /locus_tag="Abu_0126"
FT                   /product="bifunctional 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyl transferase/synthase"
FT                   /EC_number="2.7.7.60"
FT                   /EC_number="4.6.1.12"
FT                   /note="Pfam matches to PF02542 YgbB (IspF), score 259.9,
FT                   E-value 4.8E-075, and to PF01128 IspD, score 20.8, E-value
FT                   8.3E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66411"
FT                   /db_xref="GOA:A8ER37"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER37"
FT                   /protein_id="ABV66411.1"
FT                   /translation="MLDVTLIVLCAGNSTRFEHKTKKQWIRVEDEPLWLNVTKRISSFA
FT                   KFDKIIVTSHQDELNYMKNFSDDFTFVKGGETRQLSILNSLQFVTTKYVMITDVARACV
FT                   PQSVIENLLNEKSSADCIVPILNVTDTVVYENDTIDRSNVKLIQTPQLSSTQVLRDALN
FT                   TPIEFTDESSAIKAIDGKIKYIQGSTFSKKLTLGDELDELPCLKAPSNNFFTGTGFDIH
FT                   AFEEIKDMYLGGVKLPYEYGFKAHSDGDVLIHSVIDALLGACGAGDIGEFFPDTDDKYK
FT                   GIDSKLLLGQIVNFINNVGYEIVNVDLTIIAQKPKINPFKDEIKKSMAKLLRIEKQFVN
FT                   VKATTAEKLGFIGRAEGVAVQSIATLKYYNWKKR"
FT   gene            136263..137165
FT                   /locus_tag="Abu_0127"
FT                   /note="AB0131"
FT   CDS_pept        136263..137165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0127"
FT                   /product="two-component response regulator"
FT                   /note="Pfam match to PF00072 Response_reg, score 27.6,
FT                   E-value 5.3E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66412"
FT                   /db_xref="GOA:A8ER38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER38"
FT                   /protein_id="ABV66412.1"
FT                   /translation="MEKKMNILIIENEIYLAQKVVSRLLDDGHNCDYIESPNIDNLSKD
FT                   YDVILLSTSLPTALCKEITKKYSHKSIILLLVSYVSDETVTNHIKDGARDYIMKPFIMD
FT                   ELIRKIYHYIDTRNVKRELQTLKEYFDFTMSDIDISGILLPPSFPLLIETNSQRYADKL
FT                   VFELSKKVDLPIYFISLVSPTWQKQINSIEEKTIIYLTDYHTLKKNMKDYVVKYIEDKT
FT                   CVISTLECEDSFPYRKIEINSEKELVGITNIMTINDYVKMMVMSYQNKYPDTELSKKLG
FT                   ISRKSLWEKRKKLDIEKKK"
FT   gene            137176..137652
FT                   /gene="pgpA"
FT                   /locus_tag="Abu_0128"
FT   CDS_pept        137176..137652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="Abu_0128"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /note="Pfam match to PF04608 PgpA, score 199.6, E-value
FT                   6.8E-057"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66413"
FT                   /db_xref="GOA:A8ER39"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER39"
FT                   /protein_id="ABV66413.1"
FT                   /translation="MNLRKFFLTVGFSGLSPKAPGTVGSFVSLILGLFLLEFLHSSTLF
FT                   LLSILITVVAIKQIDIYEKEVGLHDSSEIVIDELAGMWIALSICGINGDNILFMAPLAF
FT                   VFFRLFDIWKPSIIGKIDRDVKGGLGVMGDDIIAGIAAGIATAAVYQVIDKFIL"
FT   gene            137669..138382
FT                   /locus_tag="Abu_0129"
FT                   /note="AB0133"
FT   CDS_pept        137669..138382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66414"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER40"
FT                   /protein_id="ABV66414.1"
FT                   /translation="MVDAVNYSYIISRVNQEFDKLPISCVFFDSVDPISSSSMQKINSK
FT                   INKHTIVGILFCQPSIKFVKDEILPSLDYLHHRSGDNINFFCCGYGAYWAPENENVVIT
FT                   IDGVKWSFDNKSFISIIEEFEQSTKWKYSGETELLLLDIIPSTNNKLNIKNAIVCNLEL
FT                   MYQDKAFTSSRAFFENLIRYFTNSENKSLLEYSDLKGISQGLEFLKNSILDNLPFKLKD
FT                   LYNSTKSYAIKDIKK"
FT   gene            complement(138460..139578)
FT                   /gene="carA"
FT                   /locus_tag="Abu_0130"
FT   CDS_pept        complement(138460..139578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="Abu_0130"
FT                   /product="carbamoylphosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="Pfam matches to PF00988 CPSase_sm_chain, score
FT                   234.8, E-value 1.7E-067, and to PF00117 GATase, score
FT                   169.1, E-value 1E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66415"
FT                   /db_xref="GOA:A8ER41"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER41"
FT                   /protein_id="ABV66415.1"
FT                   /translation="MQKVWIYLENGTFLEAKSFGATGTAVGEIVFNTSLTGYQEIISDP
FT                   SYAGQFITFTMPEIGNVGVNDDDMESKICHCKGVLVRNYHNDYSNYRAQNNLDNLLKEH
FT                   GVLGICDIDTRYLTKMLRDEGAMMMIASTEISSKEELAKQLAASPRIEDINYIEIVSTK
FT                   EAYIHKSGSWNHAIKAYDKAVMSDKKVVVIDFGVKRNILNELVQTGLEVEVIPSSFKGE
FT                   DLIARFEAKEIGGVFLSNGPGDPLTLVNEKVEIQKLINANIPIFAICLGHQLLSIAHGY
FT                   DTYKLKFGQHGGNHPVSNNGVVEITAQNHNYNVPDNIVEIADITHINLFDNTIEGVKYK
FT                   NKEIFSVQHHPEASPGPHESKYIFKQFAEIVK"
FT   gene            complement(139578..140129)
FT                   /locus_tag="Abu_0131"
FT                   /note="AB0135"
FT   CDS_pept        complement(139578..140129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0131"
FT                   /product="conserved hypothetical protein (DUF507 domain
FT                   protein)"
FT                   /note="Pfam match to PF04368 DUF507, score 225.9, E-value
FT                   8E-065"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66416"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER42"
FT                   /protein_id="ABV66416.1"
FT                   /translation="MRLKLHHTPYVSRRITRDLINCDFVEIRKEKNSIEAEIEKILDAD
FT                   IEKEFALDEKVQEILESQEEEIEYLNADRRQLFWMTKKRLANDFGVILNNEDRFSDIAH
FT                   KILDYLWEEDFIHYVCSDNQVKNIIFNSLDDFIKGFEKADSEVLTKLRNYKRKLIPGTE
FT                   DYDLVYHRLYEEELIKRGLI"
FT   gene            complement(140134..141384)
FT                   /gene="purA"
FT                   /locus_tag="Abu_0132"
FT   CDS_pept        complement(140134..141384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="Abu_0132"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Pfam match to PF00709 Adenylsucc_synt, score 852.2,
FT                   E-value 2.4E-253"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66417"
FT                   /db_xref="GOA:A8ER43"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER43"
FT                   /protein_id="ABV66417.1"
FT                   /translation="MKADVIVGIQWGDEGKGKIVDMLAQKYDMVCRSQGGHNAGHTIWV
FT                   DGVRYALQLIPSGILNPKAVNVIGNGVVVSPLNIIKEMSQFSSLEGRLFISDKAHLNLP
FT                   FHALIDQAKERLKGDKAIGTTGKGIGPTYAEKVSRTGFRMGELLNPIKLCDDILEYFKQ
FT                   NRSIFDVLDISTPNKDELLAELNEYKEKLSPFITNTTNLVWKAIDENKRILLEGAQGTM
FT                   LDIDHGTYPYVTSSSTVSAGSCTGLGINPKDIGVITGIVKAYCTRVGNGPFPTEDFTEA
FT                   GKTIGEVGKEFGTVTGRKRRCGWFDAVAVRYASRLNGCDQLALMKLDVLDGFSKIKVCV
FT                   AYELDGERIDYMPSDMQNVKPIYEEIDGWDSVVGIQDFDKLPVNAKKYIEKIEEITSVK
FT                   VGIISTSPERADTIIRG"
FT   gene            complement(141386..142231)
FT                   /locus_tag="Abu_0133"
FT                   /note="AB0137"
FT   CDS_pept        complement(141386..142231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0133"
FT                   /product="conserved hypothetical protein, putative tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66418"
FT                   /db_xref="GOA:A8ER44"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER44"
FT                   /protein_id="ABV66418.1"
FT                   /translation="MIFEHEIPKGSRLYFGKLAKAKRVLENQVCDILDKAGFEEILTPN
FT                   FSYSQHQAIANEKKLIKFSDEQNEQVSLRADSTLDVVRIITKRLGRTTKHKKWFYVQPI
FT                   FSYPSTEEYQIGCEWIDHNNIADIMNLTANILNSLKIEPILQISNINIPKLVCSELNLD
FT                   ISLLKNGEMSELFKLNCDWLNKLIKVKDVASLQSVIELVPDSIKKELEKLLSKAKEVKY
FT                   SNIIIAPLYYGSLKYYDDIYYRVIDKNLLLCNGGMYSSNGLSSLGFALYTDNLLKMLEG
FT                   "
FT   gene            complement(142231..143343)
FT                   /locus_tag="Abu_0134"
FT                   /note="AB0138"
FT   CDS_pept        complement(142231..143343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0134"
FT                   /product="putative aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="Pfam match to PF00266 Aminotran_5, score -54,
FT                   E-value 5.4E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66419"
FT                   /db_xref="GOA:A8ER45"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER45"
FT                   /protein_id="ABV66419.1"
FT                   /translation="MLLTPGPTPVPEFARKAMSDITIHHRTPEFEAIFEKTRNLLLELY
FT                   GMPEVLMLASSGTGAMEACITNLTKQKALTINSGKFGERFGKICNAFDIEYTEIKKEWN
FT                   TPVTVEEVVNTIKNDSSIDAIFIQICESAGGLRHPVEEIATEVKKINPNIMIIADGITA
FT                   VGVEKIDVTNLDAVITGSQKAFMLPPGLAIIGLSDKAVEKIEANPKGYYFNLAIELKNQ
FT                   RKNTTAWTAATTLIIGLGAILEKLKADGFDTLYTNTALRAKATREALKAIGFDIYPKSP
FT                   ANAMTTVYTEKSNEIRKILKNKYNVNIAGGQDHLSGKIFRINHMGLVEDFEASWAVNAV
FT                   ELTLDDLGIRTFDGTANKVFAMTMFKGNNK"
FT   gene            143489..144118
FT                   /locus_tag="Abu_0135"
FT                   /note="AB0139"
FT   CDS_pept        143489..144118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0135"
FT                   /product="conserved hypothetical periplasmic protein"
FT                   /note="Pfam match to PF04264 YceI, score 156, E-value
FT                   8.9E-044"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66420"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER46"
FT                   /protein_id="ABV66420.1"
FT                   /translation="MNFLKLTLVSFAVTTTLFAGNYAIDTSLSNANFTVKHLKVTNVTG
FT                   TFNDMSGNFEYEEETNKLKSLKGEIVVSSINTADEKRDEHLKSEDILNVKKFPKIFFKS
FT                   TKIEDNIVYGDLTIRNVTKNIKLELENQAFLDKQVIFSMKGETKRSYFDISWDELLETG
FT                   SIAVSDEIKLTINIKGNLVEEPKPEEKKEDKKKTNKKVTEKKKETK"
FT   gene            144274..144726
FT                   /locus_tag="Abu_0136"
FT                   /note="AB0140"
FT   CDS_pept        144274..144726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0136"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Pfam match to PF01047 MarR, score 57.9, E-value
FT                   5.6E-016"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66421"
FT                   /db_xref="GOA:A8ER47"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER47"
FT                   /protein_id="ABV66421.1"
FT                   /translation="MNNKSLKTYGTRTDKAMKTVVRLEKTSLKITNLTINYLLKHNLTF
FT                   NQFKVLEVLYHLGDLNIGSITKLTMSTPGNITVVVKNLKRDNWITSVKDQNDNRASILS
FT                   ITQKGKEIIEEVFPNHAKNLTKAMEVLNDEELNTLYDLLNKVYKAN"
FT   gene            144782..145333
FT                   /locus_tag="Abu_0137"
FT                   /note="AB0141"
FT   CDS_pept        144782..145333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0137"
FT                   /product="conserved hypothetical periplasmic protein"
FT                   /note="Pfam match to PF04264 YceI, score 219.5, E-value
FT                   6.9E-063"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66422"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER48"
FT                   /protein_id="ABV66422.1"
FT                   /translation="MKKLKLGLLSLAVSTALFAGNYNVDASHSNAGFTVKHMMISNVTG
FT                   KFNDVSGSFEYDEKTNKLKSVSGEIVVDSINTADEKRDGHLKSEDIFAAQKFPKITFKS
FT                   TKVEKDVVYGDLTMKGVTKNIKLQLENGGAVGEKAGFALSGKINRSDFGITWNKVLETG
FT                   GVAVSDEVKLTIDIEGNLAK"
FT   gene            145357..146133
FT                   /locus_tag="Abu_0138"
FT                   /note="AB0142"
FT   CDS_pept        145357..146133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0138"
FT                   /product="conserved hypothetical protein, LigB family
FT                   protein"
FT                   /note="Pfam match to PF02900 LigB, score 166.6, E-value
FT                   5.6E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66423"
FT                   /db_xref="GOA:A8ER49"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER49"
FT                   /protein_id="ABV66423.1"
FT                   /translation="MYPTLFISHGAPNIILSDSKSKRNFEKFALSLELPKYIIIVSAHY
FT                   VTKDLKIISPEANKIMYDFYGFEDELYKVTYEINSDKSLTNNLIEKLKNENINISIDEN
FT                   RKSYDHGVWNVLALFYKKLDIPVLQLSIPYSYSEAELINLGEKLKVFKNDAMIICSGGI
FT                   THNLGDMSFSSIVKPYAKEFNDKIKNVIENGNKEELININSDVNFYKNHPSKEHFLPLY
FT                   IAFGNAIEKRGKSFNSEIQYSNISMESFVFDEKDKL"
FT   gene            146130..146828
FT                   /gene="pirA"
FT                   /locus_tag="Abu_0139"
FT   CDS_pept        146130..146828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pirA"
FT                   /locus_tag="Abu_0139"
FT                   /product="pirin"
FT                   /note="Pfam match to PF02678 Pirin, score 163.7, E-value
FT                   4.3E-046"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66424"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER50"
FT                   /protein_id="ABV66424.1"
FT                   /translation="MIKKLAKENMGKSNLGWLESRFHFSFAEYRNPNNINFGVLRVLND
FT                   DIVHPESGFDTHPHANMEIISYVVNGEITHKDSMGNSEVLRRGEVQYLSAGDGIYHSEH
FT                   NLHKSDDLRLLQIWILPPQAGLPRLYGSFKFKEEQRDNKLLKIVSSLDGDSKIKIYQDI
FT                   NIYVSEFDKKLEYKIEKNRQVYFVQIEGKAEVNGTILENGDAMEIVDEEILNINPLIKS
FT                   HILFIEMQKK"
FT   gene            146885..147913
FT                   /gene="gapB"
FT                   /locus_tag="Abu_0140"
FT   CDS_pept        146885..147913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapB"
FT                   /locus_tag="Abu_0140"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase B"
FT                   /EC_number="1.2.1.12"
FT                   /note="Pfam matches to PF00044 Gp_dh_N, score 85.9, E-value
FT                   1.1E-022, and to PF02800 Gp_dh_C, score 48.9, E-value
FT                   5.9E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66425"
FT                   /db_xref="GOA:A8ER51"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER51"
FT                   /protein_id="ABV66425.1"
FT                   /translation="MSTKILLNGAGRIGKAVLKQLLENKDFEIIVINEINPYIENIVYS
FT                   INYDSTYGKLEDKFKIIEDNYIQNSKSKIKITHFDSLDKIDLKNVDIIIDCSGKKEDAK
FT                   LLEKLPVKAIFLTHPNKNAHINLILGANEEKLDINLHKIISTSSCNATSLLPALKLIDD
FT                   KKEILCGDIVTIHPLLNHQRVLDGNYVGSATRDVDLNFEFGRSSTQNIIPSRTTTIKAC
FT                   SYVLSKFNSELISSNSLRVPTDTVGAINVTLFTKQTSTKDEIISLFKEFEKQQQFPIIL
FT                   NNFEPLVSSDFKKEKYTTIIDHRYLEVKNNMIKLLLWYDNEWGYASKVVEILKYYEEIK
FT                   KG"
FT   gene            complement(147953..148948)
FT                   /gene="purM"
FT                   /locus_tag="Abu_0141"
FT   CDS_pept        complement(147953..148948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="Abu_0141"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /note="Pfam matches to PF00586 AIRS, score 206.2, E-value
FT                   6.8E-059, and to PF02769 AIRS_C, score 126.9, E-value
FT                   5.1E-035"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66426"
FT                   /db_xref="GOA:A8ER52"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER52"
FT                   /protein_id="ABV66426.1"
FT                   /translation="MATVSYKDAGVDIDAGNQFVENIKPYVKSTIIPGVLGGIGSFAGA
FT                   FELPSGYKKPVILSGTDGVGTKLKLAIDAKKFDTVGIDLVAMCSNDLLCNFGEPLFFLD
FT                   YYATAKLDVNEATQVVKGIAEGCIRSECALVGGETAEMPGMYKEGDFDLAGFCVGIAEK
FT                   DELDRISKVKAGDILIALPSSGVHSNGFSLVRKLLLEKLGMSLEDDFQGKKLKDVLLEP
FT                   TRIYVKEFKANKDKINALAHITGGGITENLPRVLPENLTAVVQRSKIRVLPIFEFMSNH
FT                   VELEEMYRTFNMGVGMVLVVNPANVDAILANTDGYVIGELKSGERKVEFI"
FT   gene            149049..149597
FT                   /gene="speE"
FT                   /locus_tag="Abu_0142"
FT   CDS_pept        149049..149597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="Abu_0142"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="Pfam match to PF01564 Spermine_synth, score 19.5,
FT                   E-value 8.3E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66427"
FT                   /db_xref="GOA:A8ER53"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER53"
FT                   /protein_id="ABV66427.1"
FT                   /translation="MKYNNAFNEMMVHIPLCTHKEASKVLIIGTINDNLKIEASKHNKI
FT                   SNIEFGDLAFLKSHNEKNVDVIVLTDVKLDELLLANVDRILKDDGLIAFATKSFSEDEE
FT                   QLFDDLKLVGSKFWIAMPFKFGHNTSIIASKKYHPTADLNLQRADLLDDLQYYSAEIHN
FT                   ASFVFPAREHKALTGIAKR"
FT   gene            149641..150231
FT                   /gene="coaE"
FT                   /locus_tag="Abu_0143"
FT   CDS_pept        149641..150231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="Abu_0143"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="Pfam match to PF01121 CoaE, score 157.3, E-value
FT                   3.7E-044"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66428"
FT                   /db_xref="GOA:A8ER54"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER54"
FT                   /protein_id="ABV66428.1"
FT                   /translation="MSNDLFKNAIALTGGISTGKSTVCNLLKLHGFLTIDADKIAHKLL
FT                   DENSSKIEEMFGKEYVENGKVLRKELGKIIFSNEENKLKLEALLHPLIKEEIIKESKIY
FT                   EEQNKPYFVDIPLFFEKMHYPISKSLVIYTPKELQIQRLMKRDNIDEKEAKLKISNQMD
FT                   IEEKRKLANIVIDNSKDLKHLQNEVERVIGEII"
FT   gene            150228..150968
FT                   /gene="dapF"
FT                   /locus_tag="Abu_0144"
FT   CDS_pept        150228..150968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="Abu_0144"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="Pfam match to PF01678 DAP_epimerase, score 74.9,
FT                   E-value 2.3E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66429"
FT                   /db_xref="GOA:A8ER55"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER55"
FT                   /protein_id="ABV66429.1"
FT                   /translation="MTYTKYSASGNDFIISHSFIEKDYKAEAIKLCNRTEGIGADGFVV
FT                   LVPSSEADFKWLFYNSDGSDASMCGNATRAVTHYAYTNGLINTNQARFLTGAGIIKAVV
FT                   ENDIVETQLTKAKVINEEFSEDGFIWHLVDTGVPHLVTIVDDLNLYNHELCAKMRYKYN
FT                   ANVNFAKIENKTIKVRTYERGVEGETLACGTGMAASFLRANSLKLVNDTTFVYPKSGEE
FT                   LTLSIKDNTIYFKGAVKKVFTVTL"
FT   gene            150993..152162
FT                   /gene="purT"
FT                   /locus_tag="Abu_0145"
FT   CDS_pept        150993..152162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="Abu_0145"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /note="Pfam match to PF02222 ATP-grasp, score 276.1,
FT                   E-value 8.9E-085"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66430"
FT                   /db_xref="GOA:A8ER56"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER56"
FT                   /protein_id="ABV66430.1"
FT                   /translation="MKFTAPLKSDSIKIMLLGSGELGKEVIIEAQRLGIETIAVDSYNN
FT                   APAQLVANKSYTINMKDKNQLLDIIRREKPTYILPEVEAINIQALFDAEKEGFHVIPNA
FT                   DAVNKTMNRKNIREFAAEQLKLPTSKYKFVTTFEALKEAASVIGFPCVIKPVMSSSGHG
FT                   QSVARSEADLEKSWEMAKEARGDASELIVEEFITFDYEITMLTVRNGKDTVFCEPIGHI
FT                   QKDGDYIFSWQPMNMSEIAVKKSQEIAKTITDGLGGRGIFGVELFVKGDDVYFSEVSPR
FT                   PHDTGMVTMITQSASEFALHVRAVLGLPIDFITYGAGASAAYKAGGDSFNPQIDIFDSS
FT                   FTKDSIIRVFGKPQSHVGRRMAVALTFDKDSSDKALQKAKEIIGNFKDF"
FT   gene            152171..152641
FT                   /locus_tag="Abu_0146"
FT                   /note="AB0150"
FT   CDS_pept        152171..152641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0146"
FT                   /product="transcriptional regulator, MarR family"
FT                   /EC_number="2.3.1.-"
FT                   /note="Pfam match to PF00583 Acetyltransf_1, score 55.2,
FT                   E-value 2E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66431"
FT                   /db_xref="GOA:A8ER57"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER57"
FT                   /protein_id="ABV66431.1"
FT                   /translation="MSEDIKIVKFSPKYKEDFKKINLWWIGEYFEVEESDIKVLNEPEK
FT                   YIIDMGGEIFLALYKDEVVGTCALIKSKNENFDFELAKLAVLSKVQGLKLGLLLSQAVI
FT                   NEAKNRGGKTIFLETNSVLTPAVSLYKKLGFEEIPNFKSKYKRVNLVMLKNL"
FT   gene            complement(152643..152951)
FT                   /locus_tag="Abu_0147"
FT                   /note="AB0151"
FT   CDS_pept        complement(152643..152951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0147"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF08238 Sel1, score 44.1, E-value
FT                   4.3E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66432"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER58"
FT                   /protein_id="ABV66432.1"
FT                   /translation="MKKLFLILIILNSIVFGVTFEDGKRALLTNDYEQAFKIFDDLASK
FT                   GDAKAQYGLGFMYETGKAVKMDKKEAIKWYKKSSKQGYKKAQKALDDVCSENPFICR"
FT   gene            complement(153035..154255)
FT                   /locus_tag="Abu_0148"
FT                   /note="AB0152"
FT   CDS_pept        complement(153035..154255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66433"
FT                   /db_xref="InterPro:IPR025330"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER59"
FT                   /protein_id="ABV66433.1"
FT                   /translation="MAFRFRKSIKIIPGVRVNLSSKSASLNVGPRGSSFSIGKQGIYSN
FT                   VSIPEMGISFRKKISNNVREERALKRQRLSEQQTIISVVLSLLDDGNIVYKDENENLLD
FT                   RKIVTKLWQEKSDMLKNWLETEAQKINDMDLITTIHYDMPTPYNEPQLEKLEFDKEKPS
FT                   KPKKNEIKKPSFFKSLFFPSSKQKYQSDLEKAESDFICNTNRFKEELSLWEKDKEEFDK
FT                   VQNELAISFSTLIRTDINTMSEYLEKVLQDLDWARETLVSYDINNSANTVYIDIDLPEI
FT                   ENIPQRTATIAATGKKLNIKNKTEKQLRLEYATHIHAIALRVAAYTFATLPSIDLIIIS
FT                   GYSQRLDKSTANTNDEYLYSIKFNKSDFSKLNFEKIELIDPIKAFDNFENIRNMTSTGI
FT                   FKEIKPF"
FT   gene            complement(154425..154501)
FT                   /locus_tag="Abu_0149"
FT   tRNA            complement(154425..154501)
FT                   /locus_tag="Abu_0149"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: TCG"
FT   gene            complement(154544..155392)
FT                   /gene="ubiA"
FT                   /locus_tag="Abu_0150"
FT   CDS_pept        complement(154544..155392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="Abu_0150"
FT                   /product="4-hydroxybenzoate octaprenyltranferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Pfam match to PF01040 UbiA, score 227.8, E-value
FT                   2.1E-065"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66434"
FT                   /db_xref="GOA:A8ER60"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER60"
FT                   /protein_id="ABV66434.1"
FT                   /translation="MKKLNDFSELVMFQHSIFALPFIFIAMVVAANGWFGFKLLILGVL
FT                   AAVTARNFAMGFNRYMDRDIDALNPRTINRPNVDGRISANAMFIFVVVNALLFILVAYF
FT                   VNDLAFILSLPILIIIGSYSYFKRFSYLAHIILGISLALAPIAGVVAVSENIPLWVIFL
FT                   SIGVMFWVAGFDLLYSLQDIEVDKKLGLHSVPSVFGVEKTMLFSKVFHALTVIFWLLFV
FT                   IYSSSSYFAYLAVIISALMLSYEHYLVNKDFKKIDRAFFTVNGYLGIVFFLLIVLDNIF
FT                   F"
FT   gene            155484..155687
FT                   /locus_tag="Abu_0151"
FT                   /note="AB0154"
FT   CDS_pept        155484..155687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66435"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER61"
FT                   /protein_id="ABV66435.1"
FT                   /translation="MKKIVLFILSLFLILNFSACSSKTQEEIQNTQSNDISKLLKTIIE
FT                   KEKEINELNKKLEICESKKVIK"
FT   gene            155684..156559
FT                   /gene="miaA"
FT                   /locus_tag="Abu_0152"
FT   CDS_pept        155684..156559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="Abu_0152"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="Pfam match to PF01715 IPPT, score 153.1, E-value
FT                   6.8E-043"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66436"
FT                   /db_xref="GOA:A8ER62"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER62"
FT                   /protein_id="ABV66436.1"
FT                   /translation="MKEIAIIGSTASGKTALSLEIASKTNSIILSLDSLCVYKEIDIVS
FT                   AKPTLEERGEILHFGIDEVYPNVEFDVVCFMELYKKAKEYALKNDKNLIIVGGTGFYLK
FT                   ALIDGLSLGIESKIKLDISVSEAYDLLYSLDEMYMKKIEKNDKYRVEKAYAIYKQTGLT
FT                   PTLYFEKNPKIPLAKDLKIFEILWEKEDLKKRVASRTNTMIKSGLIDEIIYLEKKYTRA
FT                   PNCMSSIGIVETFEYLDGKLSKEELEEKISQNTMKLAKRQNTFNKGQFLNKTSNIIDNL
FT                   NSDILKYFSI"
FT   gene            156640..156843
FT                   /gene="rpmE"
FT                   /locus_tag="Abu_0153"
FT   CDS_pept        156640..156843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="Abu_0153"
FT                   /product="50S ribosomal protein L31"
FT                   /note="Pfam match to PF01197 Ribosomal_L31, score 135.8,
FT                   E-value 1.1E-037"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66437"
FT                   /db_xref="GOA:A8ER63"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER63"
FT                   /protein_id="ABV66437.1"
FT                   /translation="MKKDIHPDYKVCTVTCACGNSFETKSNVETLKIDICSSCHPFFTG
FT                   EQKLVDAAGRVEKFKAKYNMAK"
FT   gene            156856..157677
FT                   /locus_tag="Abu_0154"
FT                   /note="AB0157"
FT   CDS_pept        156856..157677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0154"
FT                   /product="conserved hypothetical protein, putative
FT                   methyltransferase"
FT                   /note="Pfam match to PF00590 TP_methylase, score 75,
FT                   E-value 2.1E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66438"
FT                   /db_xref="GOA:A8ER64"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER64"
FT                   /protein_id="ABV66438.1"
FT                   /translation="MLCLVPTPIGNLEDISSRSLKVLEESELIFCEDTRVTKKLLNLLG
FT                   EKYNLDFSNKEYKSFHSHNENQILKTLDKDTFSKNVVYVSDAGMPCVSDPGATLVDFCI
FT                   KNQIPYDVLPGANAILTAYAMSGFIQTTFSFYGFLDHKGASRASKLDEILNDDKLSILY
FT                   ESPHRLLKLLEELNEKEPNRTIFLAKEITKLHQTTYKNSASNLFEEFKNINIKGEWVVV
FT                   IEPKEKVGLNLELNDILPLDLPPKTKAKLIAKMTGQSIKEVYQQFLDKIAE"
FT   gene            157674..158363
FT                   /locus_tag="Abu_0155"
FT                   /note="AB0158"
FT   CDS_pept        157674..158363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0155"
FT                   /product="tRNA methyltransferase, TrmH family"
FT                   /EC_number="2.1.1.-"
FT                   /note="Pfam matches to PF00588 SpoU_methylase, score 161.9,
FT                   E-value 1.5E-045, and to PF08032 SpoU_sub_bind, score 62.1,
FT                   E-value 1.7E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66439"
FT                   /db_xref="GOA:A8ER65"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER65"
FT                   /protein_id="ABV66439.1"
FT                   /translation="MIIYGKQIVLYVLENHPKLVEEVFLSKEIDNKLFSKFLKLGKKIH
FT                   RLDNQKAQALAKGGNHQGFFLKLSQFDYAPIKELKAMNFILVLDGVTDVGNIGAIARTA
FT                   YSLGIDGIIASNIKTINNSGIVRTSAGALLDLPFCIHPRSADLASELIDAGFTLIGATM
FT                   DGVDLKKYGKIEKSDKVALFLGSEGEGISPKVAKKLDLKVSIKMEHEFDSLNVSVAAGI
FT                   LIYNLKR"
FT   gene            158376..159185
FT                   /locus_tag="Abu_0156"
FT                   /note="AB0159"
FT   CDS_pept        158376..159185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66440"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER66"
FT                   /protein_id="ABV66440.1"
FT                   /translation="MIKKLILIIALCVTSNASINDAVQNLLGASDYNTHRNLINHIFKN
FT                   SSSFYKNGQIDYVKITQELSNNNLLKLDLGGTKDIEVSFSFNTNAKKSMKNINDILKAI
FT                   GQQNFITQSEVVIEDQLKWTIRLKTAAAINPLRLSQELQSTNSSIVDIKREGNLKWSYF
FT                   IDSTNSTVYKTEDLINNKSLSLKKPNKPYIIEISNTSAISISSNINNSWYPSIVFYDKD
FT                   FKIIEIVEKDSLHKNLVIDVPNNTRYIKIDDLYSLANLKQGISITKE"
FT   gene            159189..160403
FT                   /gene="aspB1"
FT                   /locus_tag="Abu_0157"
FT   CDS_pept        159189..160403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB1"
FT                   /locus_tag="Abu_0157"
FT                   /product="aspartate aminotransferase, aminotransferase,
FT                   classes I and II"
FT                   /EC_number="2.6.1.-"
FT                   /note="Pfam match to PF00155 Aminotran_1_2, score 176.3,
FT                   E-value 6.9E-050"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66441"
FT                   /db_xref="GOA:A8ER67"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER67"
FT                   /protein_id="ABV66441.1"
FT                   /translation="MFPEIEFERMKRLPNYVFAEVNAIKMEARRAGEDVIDFSMGNPDG
FT                   PAPQHITDKLIEASAKPKNHGYSASAGIFKLRLAISNWYKRKYDVDFLDPNKHVCATMG
FT                   SKEGYVHLVQAIVNVGDVAVVPDPTYPIHSYAFMLNGAAVHKFELAFDDVFKVDEDLFF
FT                   ERLQKTLDESIPKVKFVVVNFPHNPTCATVTPEFYTKLVAMAKRERFYIISDIAYADIT
FT                   FDGYKTPSIFQAEGALDVAVECFTLSKSYNMAGWRVGCIVGNEKLIGALKRIKSWLDYG
FT                   MFTPIQIAATVALDGPQDCVEEHIEKYRKRRDLMLETFADAGWVMNKPNASMFIWAKIP
FT                   EVASHLGSMEFSKQLLTQAQVAVSPGIGFGHYGDQYVRIALIENEKRIRQAAKNIKKYL
FT                   KSLEK"
FT   gene            160528..161790
FT                   /gene="hom"
FT                   /locus_tag="Abu_0158"
FT   CDS_pept        160528..161790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom"
FT                   /locus_tag="Abu_0158"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="Pfam matches to PF00742 Homoserine_dh, score 279.2,
FT                   E-value 7.3E-081, and to PF03447 NAD_binding_3, score 62.7,
FT                   E-value 6.8E-017, and to PF01842 ACT, score 43.8, E-value
FT                   1.5E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66442"
FT                   /db_xref="GOA:A8ER68"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER68"
FT                   /protein_id="ABV66442.1"
FT                   /translation="MLKVGIIGVGTVGTSVANILIDNKNIITARAGKEIVPTIGVVSNL
FT                   GKKRDVSIKLTTNADEILEDDSIDIVVELMGGIDKPYEIVKKALLKGKAVVTANKALLA
FT                   YHRYELQELAGDIPFEFEAAVAGGIPIINALRDGLSANHIKSIQGIMNGTCNYMLTRMI
FT                   NDGVNYDEILKEAQELGYAEADPTFDVGGYDAAHKLLILGSIAYGIDVKPEEILIEGIE
FT                   NITKADIEFAKEFEYSIKLLGIAKKVGNEIELRVHPVLIPEDKMIAKVDGVMNGISVVG
FT                   DKVGETMYYGAGAGGDATASAVVANIIDIARKGKGSPMLGFEKQPGEKITLMPKENIQT
FT                   KYYLRLEVADKSGTLAKVATIFGNNSISIENMMQKPLKDSKANLLLTTHTCVEKDILKA
FT                   IKELENSGVVLTKPNMIRIED"
FT   gene            161886..162662
FT                   /gene="traT"
FT                   /locus_tag="Abu_0159"
FT   CDS_pept        161886..162662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traT"
FT                   /locus_tag="Abu_0159"
FT                   /product="TraT complement resistance protein precursor"
FT                   /note="Pfam match to PF05818 TraT, score 58.2, E-value
FT                   2.4E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66443"
FT                   /db_xref="GOA:A8ER69"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER69"
FT                   /protein_id="ABV66443.1"
FT                   /translation="MHKIKTLGLSIAAATLLFTGCATTELQTNAKMTQSVFINPVKKEL
FT                   RTIFVSTKNTSGQRINLESSIISELMAKGYRVVDDPDMATYVLMMNVLYCDKKQENNVA
FT                   GAALGAGALGAGVSAYNSHGATQPIAVGLGSALVGGLVGKALEDTIYQMQVDIVIREKA
FT                   KGEVYTSSATAQGQASVKDSSKAGFMNSLGGSVNNANASGQLNSNMATGTAQSYSTNYI
FT                   EHKTMLFAEATKMNLTLEEATPILERQISNQIAGLF"
FT   gene            162796..163554
FT                   /gene="cdsA"
FT                   /locus_tag="Abu_0160"
FT   CDS_pept        162796..163554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="Abu_0160"
FT                   /product="CDP-diglyceride synthetase CdsA"
FT                   /EC_number="2.7.7.41"
FT                   /note="Pfam match to PF01148 CTP_transf_1, score 209.9,
FT                   E-value 5.3E-060"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66444"
FT                   /db_xref="GOA:A8ER70"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER70"
FT                   /protein_id="ABV66444.1"
FT                   /translation="MFEMTKDISVRVKTGVVLIIGMLILGYIDSYFLFWLVFGIMLMIS
FT                   VHESKELYKLNSDSIYIYTLLLWIAVYFYPMPIDLIFIVAIGYASQLAYKRTLDKKLFL
FT                   PLLYPTASFIFLMTLYSEYGVKVLLWLFVIVAATDIGAYFVGRSFGKTKFCETSPNKTL
FT                   EGVFGGMAFAIILGTLTSISEVGIIGAIIVSAIVSLSSVFGDLYESYLKREAGVKDSGT
FT                   ILPGHGGVLDRVDGYLFGAITMVVLLRVII"
FT   gene            163551..164618
FT                   /gene="dxr"
FT                   /locus_tag="Abu_0161"
FT   CDS_pept        163551..164618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="Abu_0161"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="Pfam matches to PF02670 DXP_reductoisom, score
FT                   194.9, E-value 1.8E-055, and to PF08436 DXP_redisom_C,
FT                   score 161, E-value 2.8E-045"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66445"
FT                   /db_xref="GOA:A8ER71"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER71"
FT                   /protein_id="ABV66445.1"
FT                   /translation="MILLGSTGSIGVNTLNIARKFNLNVEVLVAGKNIKLLNEQIKEFN
FT                   PKIVVVADKEDIPFVQHKNVSFGEAAILEAIENSSSKTVVNALVGFLGLRPTLKAIECG
FT                   KKIALANKESLVVAGKFIDQTKLSPIDSEHFGLWYLLQNKKIDSMTITASGGSFRDYPL
FT                   DKLQNVSIKEALNHPNWSMGNKITIDSATMTNKMFELIEAAWLFDTRKLDAIIETKSLI
FT                   HAMINFKDGSTTAHIANASMQLPIAYAILGHCDEEILKPVNLIEVGNIEFRRIEENRYP
FT                   IWQLKDEILNNLDLGVVLNAANEVAVSKFLNSKIGFLDISKITMNAINKFHNTNASSIE
FT                   DIFQIDKEVRKYCES"
FT   gene            164608..164901
FT                   /locus_tag="Abu_0162"
FT                   /note="AB0165"
FT   CDS_pept        164608..164901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66446"
FT                   /db_xref="GOA:A8ER72"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER72"
FT                   /protein_id="ABV66446.1"
FT                   /translation="MSLDLLIPFGILLILVIYLIYTRTKFEKDIVTLYEDKFDNWKKNS
FT                   FVNIEKKSHKELVGLIFRKDDKINIELLDENVQYLIRKGKFEIKNIRDEKDE"
FT   gene            164894..165460
FT                   /locus_tag="Abu_0163"
FT                   /note="AB0166"
FT   CDS_pept        164894..165460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0163"
FT                   /product="conserved hypothetical protein (DUF1234 domain
FT                   protein)"
FT                   /note="Pfam match to PF06821 DUF1234, score 33.4, E-value
FT                   1.5E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66447"
FT                   /db_xref="GOA:A8ER73"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER73"
FT                   /protein_id="ABV66447.1"
FT                   /translation="MSKRILILHGLNGSDYPHWQSQLAMDLIKENFIVSFPSFPSRDNP
FT                   KLQEWKDFLKKEIKHFNPDIVVCHSLGNILWFHTCDELDIKLDKLMLVAPVRNEVLEDA
FT                   KTFFPYPIAKDLKANEIIMAASTNDPYLTVEEAIRLQSKLNIGMKIMENAGHINAASGF
FT                   GKLDCALDWIKREDECEINEELKEH"
FT   gene            165463..166464
FT                   /gene="gcp"
FT                   /locus_tag="Abu_0164"
FT   CDS_pept        165463..166464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="Abu_0164"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="Pfam match to PF00814 Peptidase_M22, score 196.1,
FT                   E-value 7.4E-056"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66448"
FT                   /db_xref="GOA:A8ER74"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER74"
FT                   /protein_id="ABV66448.1"
FT                   /translation="MILSIESSCDDSSIAITEIKTNKLIYHKKISQELQHSIYGGVVPE
FT                   LAARLHVEALPKILEECKEYFPLLKAIAVTNAPGLSVTLMEGVTMAKALSISLNLPLIA
FT                   VNHLKGHIYSLFIEKQEVLPITILLVSGGHTQIIEANSLNDMKVVATTIDDSFGESFDK
FT                   VSKMLGLGYPGGPVVQEYSLKGDVNRFDLPIPLSQSPKIEFSYSGLKNAVRLHIEKLEN
FT                   SEEGIREQDKYDICASFQKTAVDHIMQKLKKQFKQKVPKNFAIVGGASANIYLRTQIDE
FT                   LCKKHNMNLYLSELKYCSDNAAMIGRVAVEQYKLKDFISIEEIDIQTRIKEF"
FT   gene            166465..166812
FT                   /locus_tag="Abu_0165"
FT                   /note="AB0168"
FT   CDS_pept        166465..166812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0165"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF01253 SUI1, score 33.1, E-value
FT                   2E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66449"
FT                   /db_xref="GOA:A8ER75"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER75"
FT                   /protein_id="ABV66449.1"
FT                   /translation="MASLADMLSKGLGSKLEGNNHDTIKEDKKNPKKSSSDLIPKNQHQ
FT                   LVFTFEKRNGKPVTLVGRFYIEENEKKEVLKLLKKKLACGGAINNEWLEIQGDFKDKIK
FT                   EILTKENWKFR"
FT   gene            166844..168229
FT                   /locus_tag="Abu_0166"
FT                   /note="AB0169"
FT   CDS_pept        166844..168229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0166"
FT                   /product="conserved hypothetical protein, putative
FT                   carbohydrate kinase"
FT                   /note="Pfam matches to PF01256 Carb_kinase, score 189.8,
FT                   E-value 5.9E-054, and to PF03853 YjeF_N, score 149.5,
FT                   E-value 8.2E-042"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66450"
FT                   /db_xref="GOA:A8ER76"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER76"
FT                   /protein_id="ABV66450.1"
FT                   /translation="MQKIFDEVNSLDKRCYEEFFLNEDILMEHAASSMCSYIEDIFEEN
FT                   KSVLIICGSGNNGADGLALARLLHKKFDVNLYLLSEPKSSMAKLQYKRVKTLNIKEVDE
FT                   VFEADIIVDCLFGTGLNKPLDEKYLNLIDNLNSNSSFKIACDIPSGINNLGQINSSTFQ
FT                   ADVTITMGALKTSLFTDLAKDYVGEIIVSNLGVQREIYEAQTNKFLLDENDIKLPTRNK
FT                   KDSNKGSFGHLNVILGSKKGAGIIASNAAFGFGAGLVSVVCDENVDLPYHIMQTQNISQ
FT                   NCTAIAIGMGLGKYDENKIKEILNKDVPKIIDADLFYDELIFEVLDKEVVLTPHPKEFV
FT                   SLLKLSGIADISVQELQNNRFLYVEKFSKKYPKTVLLLKGANVIIAQNEKLYVNSFGSA
FT                   VLSKGGSGDVLSGLIGSLLAQGYKPLDAAISASLAHTLAAKNYKKNNYSLSPQDLIEEI
FT                   KNL"
FT   gene            168226..168537
FT                   /locus_tag="Abu_0167"
FT                   /note="AB0170"
FT   CDS_pept        168226..168537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0167"
FT                   /product="conserved hypothetical periplasmic protein"
FT                   /note="Pfam match to PF03091 CutA1, score 132.3, E-value
FT                   1E-037"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66451"
FT                   /db_xref="GOA:A8ER77"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER77"
FT                   /protein_id="ABV66451.1"
FT                   /translation="MKTIIIQTTCSSEEEAQNIAKILIEEKFAACIQLSQIKSFYNWDN
FT                   QFCSDKETLLNIKTRKKHFKKIKSKIKELHSYDVPEIIQFDISKSSKKYLKFIKDNTI"
FT   gene            168534..169313
FT                   /gene="thiG"
FT                   /locus_tag="Abu_0168"
FT   CDS_pept        168534..169313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="Abu_0168"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="Pfam match to PF05690 ThiG, score 523.9, E-value
FT                   1.6E-154"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66452"
FT                   /db_xref="GOA:A8ER78"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ER78"
FT                   /protein_id="ABV66452.1"
FT                   /translation="MNDILKIGKYELNSRLIVGSGKYKDFQTTKEATLASGSELITVAI
FT                   RRVNITNPNEENLLDYFKDTNVKFLPNSAGCFTAEEAITTFRLMREATGIDLIKLEVIG
FT                   DAQKTLYPDVIETIKACEILKKDGFTIMAYTSDDPIIAKRLEDAGADAIMPLAAPIGSG
FT                   LGIQNKYNIAFIRDAVKVPVIVDAGIGCASDASIAMELGADAVLANSAIACAQNPIQMA
FT                   EAMKYAVIAGRLGYKAGRIPKKPYATASSPIDGLIQF"
FT   gene            169427..169504
FT                   /locus_tag="Abu_0169"
FT   tRNA            169427..169504
FT                   /locus_tag="Abu_0169"
FT                   /product="tRNA-Pro"
FT                   /note="anticodon: TGG"
FT   gene            169523..169599
FT                   /locus_tag="Abu_0170"
FT   tRNA            169523..169599
FT                   /locus_tag="Abu_0170"
FT                   /product="tRNA-His"
FT                   /note="anticodon: GTG"
FT   gene            169617..169693
FT                   /locus_tag="Abu_0171"
FT   tRNA            169617..169693
FT                   /locus_tag="Abu_0171"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: TCT"
FT   gene            169698..169782
FT                   /locus_tag="Abu_0172"
FT   tRNA            169698..169782
FT                   /locus_tag="Abu_0172"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: TAG"
FT   gene            169790..169866
FT                   /locus_tag="Abu_0173"
FT   tRNA            169790..169866
FT                   /locus_tag="Abu_0173"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: TCC"
FT   gene            169935..170011
FT                   /locus_tag="Abu_0174"
FT   tRNA            169935..170011
FT                   /locus_tag="Abu_0174"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: TCT"
FT   gene            170018..170094
FT                   /locus_tag="Abu_0175"
FT   tRNA            170018..170094
FT                   /locus_tag="Abu_0175"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: TCC"
FT   gene            complement(170234..172066)
FT                   /gene="pycB1"
FT                   /locus_tag="Abu_0176"
FT   CDS_pept        complement(170234..172066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycB1"
FT                   /locus_tag="Abu_0176"
FT                   /product="pyruvate/oxaloacetate carboxyltransferase"
FT                   /EC_number="6.4.1.1"
FT                   /note="Pfam matches to PF00364 Biotin_lipoyl, score 83.9,
FT                   E-value 4.4E-022, and to PF00682 HMGL-like, score -49.1,
FT                   E-value 6.8E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66453"
FT                   /db_xref="GOA:A8ER79"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER79"
FT                   /protein_id="ABV66453.1"
FT                   /translation="MSKKYIDIMDTTFRDGFQSVFGGRVLMNDFFPAVEAAKEAGITHF
FT                   EFGGGARFQSLFFYLQENAFDMMDKFRSIVGPEANLQTLARGINTVMLDTGSRELIDLH
FT                   AKLFAKHGTTTIRNFDALNDVQNLEYSAQCIKNHGLKHEVVVTLMDLPPNCTGAHDVPF
FT                   YEKTLRSILDSGLPFDSVCFKDASGTSSPQKVFDTIKMARNLLGDSTHIRLHTHETAGV
FT                   SIACYLAALEAGADGIDLAASPVSGGTSQPDILTMLHAVKGKNFDLGGLEIDKILKYEE
FT                   TLAHCLKDYFLPPEATQVSPLIPFSPMPGGALTANTQMMRDNGTLDKFPAVIKAMQEVV
FT                   VRGGFGTSVTPVSQFYWQQAYANVMFGPWKQIAPGYGRMVLGYFGKTPVEADPEIIKLA
FT                   SEKLKLEPTKENPLDIADRDEKKKISVWKQRLEIENIPVTEENIFIAAACDEKGIAFLK
FT                   GESPLNVRKKENEINNSNNKTKGDNKMANGNYTVVVDGQRFNVTVAEGIVDNIQVAQPV
FT                   VQQVVQQPVQAQVAQTPAKPVYNGTEVPAAVNGNVWKILVKEGDRVEKDQQIMILEAMK
FT                   MEIDITAPVSGTISKILVEPSSSVDEGQTLAVIA"
FT   gene            complement(172073..172339)
FT                   /locus_tag="Abu_0177"
FT                   /note="AB0173"
FT   CDS_pept        complement(172073..172339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66454"
FT                   /db_xref="GOA:A8ER80"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER80"
FT                   /protein_id="ABV66454.1"
FT                   /translation="MDALVHTLTSFLIVMGIVSTVLLILGFLLKAKGVTFVEFFPKKQE
FT                   NVSQTPNIIYNTITNPVVSNSGIDPRKVAAIMAAIQHHTKLKG"
FT   gene            172487..173362
FT                   /locus_tag="Abu_0178"
FT                   /note="AB0174"
FT   CDS_pept        172487..173362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0178"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Pfam matches to PF06445 AraC_E_bind, score 64.2,
FT                   E-value 3.8E-016, and to PF00165 HTH_AraC, score 40.5,
FT                   E-value 5.2E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66455"
FT                   /db_xref="GOA:A8ER81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER81"
FT                   /protein_id="ABV66455.1"
FT                   /translation="MKKETLQKRTKIANDIMYYIYTHIETNIDIEELSMDLGVSKFHMH
FT                   RIFKEIFGKNIYESIKSIRLQKASNLLLTNKYSTISNIVNLCGYSSQSSFIKIFKERFE
FT                   MSPKEWKNGGYKEYSNKIIQQSQKAMQSKADFKNIVPTIVKMPFIESYYIRNKGYNVNI
FT                   EETWQKLETWVLTNNITSYKRIALFHDNPTITPLDECQYIGCIMVDDMENIKSDRLPKF
FT                   KIAEGVYAKFDLKGKTGDVLPFIQWVYHEWLPKSEYETTTKPSYAIYEKLDFFDEDNEF
FT                   ELSFYVSINF"
FT   gene            173409..174389
FT                   /locus_tag="Abu_0179"
FT                   /note="AB0175"
FT   CDS_pept        173409..174389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0179"
FT                   /product="calcium:sodium antiporter"
FT                   /note="Pfam match to PF01699 Na_Ca_ex, score 167.1, E-value
FT                   4.2E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66456"
FT                   /db_xref="GOA:A8ER82"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER82"
FT                   /protein_id="ABV66456.1"
FT                   /translation="MFLFLGAIVAGFAILVWSADKFVEGAASTAKHLGMPSLLIGILIV
FT                   GFGTSAPEMVVSAIAAMEGNSGLALGNAIGSNIVNIALILGITAIIAPIAVNSKIVKKE
FT                   IPILLIIVLFLGYLLFDNTLTFVEGVVLLVGFFILVGWSIYAAIKGKGDALESEINDEL
FT                   LEHEMSLRAGVIWLIVGLILLIASSRLLVWGAVGVATEFGVSDLIIGLTIVALGTSLPE
FT                   LAASIVAARKGEHDIAIGNVVGSNMFNILAVIGIAVVIAPMNIISFEVLQRDWITMLLL
FT                   TIALLFMAYGFKNKEGEITRLEGFILVVCYVAYNTYLGMTLVGNI"
FT   gene            complement(174410..176431)
FT                   /locus_tag="Abu_0180"
FT                   /note="AB0176"
FT   CDS_pept        complement(174410..176431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0180"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam match to PF00015 MCPsignal, score 164.2,
FT                   E-value 3E-046"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66457"
FT                   /db_xref="GOA:A8ER83"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER83"
FT                   /protein_id="ABV66457.1"
FT                   /translation="MLVKNRLRLLSMLLIAGLIIIGLVAFNSAKTWSDDMQNIGDERIP
FT                   ALLSLSNINAERMAIRAQTLEVLILDRTKSNKERLQEIEKQRVNSWKIIDENWKTFQNI
FT                   PRKTEAGKKAAETLQKAYQDWRDIYGILDSLLYKLIDNESEKNLFQEYETTVNKMIPIS
FT                   NNFGKLMTEQKDRTFNFSLNMISQSADKSKNSVIQISIVFIIVSIIGVIFTILTINIIT
FT                   QSLNKVKNGVLSFFAFLNHETSKPSIIDLNSKDEFGQIASIINENIYKSEANIKKDTEF
FT                   LKDIERFVGELSNGNMLAKIEKDSDTPNLKELKLLLIKLQDYLEHTIARDINILVNILE
FT                   SYKKEDFTARFPNPYAKVAVIINELGDVISNLLKQSLDTGKILENSSNKLLENVNVLNE
FT                   SSNQAAASLEETAAALEEITSTVTSNASSVNQMAQYSQQVSNSAKQGQKLATQTTNAMD
FT                   EINSQVNLINEAISVIDNIAFQTNILSLNAAVEAATAGEAGKGFAVVAQEVRNLASRSA
FT                   EAAKEIKNLVENATSKANEGKNISLEMIQGYDELLKNIENSTQTINEIATASKEQQKGI
FT                   SQINDAINGLDRQTQKNATIASQTKEIALQTDSIAKEIVNDVIKKEFIGKNELTNKTSK
FT                   KENKQIEEPSFIETKKAVMPEKKVLEKKSIQNDEWESF"
FT   gene            176536..179310
FT                   /locus_tag="Abu_0181"
FT                   /note="AB0177"
FT   CDS_pept        176536..179310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0181"
FT                   /product="DNA/RNA helicase (DEAD/DEAH BOX family)"
FT                   /note="Pfam matches to PF04851 ResIII, score 178.2, E-value
FT                   1.9E-050, and to PF00271 Helicase_C, score 46.1, E-value
FT                   5.6E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66458"
FT                   /db_xref="GOA:A8ER84"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER84"
FT                   /protein_id="ABV66458.1"
FT                   /translation="MNNLVTNNQITNFFNNITELLDNCESFYFNVAFINFSGIQLLLDS
FT                   FKKLEEKNIKGKILTSTYLNFTQIKALEKIKKFKNIELKIYDCEVSNIGFHSKSYIFEF
FT                   KDDYKILIGSSNITASAFKSNIEWNVKTITKKDDIFLKDVLNEFGTLWKSSRKVNDEFL
FT                   TSYSNFLNSQNKEFKSFSLNQIKTNFMQEKALEKLENLRNKGENKALIIAATGTGKTYL
FT                   SAFDVKNFKAKTILFLVHRENILVKAKQSFEEILPHINSFGLYTGNKKEQNKNYLFSTI
FT                   QTMSSNFLEFSQNFFDYIIIDEAHHATSPSYKKILDYFKPKFLLGLTATSNRMDGNSIY
FT                   EIFDENIALDIRLNDALEHNLIVPFHYYGISDIQSIDYENVDLIKIDLLAKLLSVNKRV
FT                   DFIIDKMNFYSNSGNKRKVLGFCVSKEHSNFMSEEFNKKGINSITLTSEDSISKREDSI
FT                   KRLENENDSLEVIFTVDIFNEGIDIPSINMVLFLRPTNSPIVFVQQLGRGLRKYQNKEF
FT                   LTVLDFIGNHKKAYLIALALVGNKMIDKESIKLSLQNNFADFKNAFISIDEISKSRILE
FT                   QINKENFNQLKYLKEQYFEVKNILRKIPSLVDFLQFEDVINPLKFVDESKSYIEFLAKV
FT                   EDDKKLKELILDENFIKAIRFIENELPIKRVYEFVILKYLLNNDFCDENIAFKILNKYL
FT                   DRVDKETIIHSFLYLRQDFLDSAQSSRYLKLINYENKIARKTKEFEELLKNENYKKIFE
FT                   DSLNFGIYNYEEEFGLTDFGKPFLKLYSKYNMLNIAKLCNFPKIHSSFRGSGFLKYEND
FT                   FFLFINLEKEKFSKSANYHNAFLSKDVFTYQSKPSHSSDKGDGERLCENKKFGVKLHIF
FT                   VRKYVQVDKKTQDFIYLGIANTLKYWDNKPISLELKLENPLSDKLFEEFTKIV"
FT   gene            179388..181307
FT                   /gene="tkt"
FT                   /locus_tag="Abu_0182"
FT   CDS_pept        179388..181307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="Abu_0182"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="Pfam matches to PF00456 Transketolase_N, score
FT                   491.1, E-value 1E-147, and to PF02779 Transket_pyr, score
FT                   171.1, E-value 2.5E-048, and to PF02780 Transketolase_C,
FT                   score 13.6, E-value 7.1E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66459"
FT                   /db_xref="GOA:A8ER85"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER85"
FT                   /protein_id="ABV66459.1"
FT                   /translation="MSKQLLQKQADTIRFLAADMVQQANSGHPGAPMGLADIATVLSKH
FT                   LNVNPADEKWLNRDRLVFSGGHATGLVYSLLHLWGFNVSINDIKNFRQTHSKTPGHPEY
FT                   GHTHGIEITTGPLGQGIANAVGFAMAGKYAQNLLGSDVINHKVYCLCGDGDLQEGISYE
FT                   ATATAGHLKLDNLVIIYDSNSITIEGDTSISWSENVKKRFQAIDFEVIEIDGHNFDQID
FT                   KALVAAKSSTLPVLIIAKTAIAKGAVTMEGSHHSHGAPLGEDEIAKSKEKAGFNPEEKF
FT                   FVPADVKGAFDKLIVGSTAQNAWMESLSAQTKAKIEELKNPNFDSIVYPTFEPDSSVAT
FT                   RDSNHKILNAIAKAIPGFLGGSADLAPSNKTELKDMGDFPKGRNIHFGIKEHAMAAITN
FT                   AMNLYGLFRVYSATFFVFSDYLKPSARIAALAGIPQHFIWTHDSIGVGEDGPTHQPIEH
FT                   LSQFRALPNFYTFRPADATENIESWKVALKMKAPTAFVCSRQGLRVLKDEKAYGNVSNG
FT                   AYLLKERENANITIMASGSELMLALQTACSLEEDGIFANVVSVPCFDLLMEQSKEYVDR
FT                   IINKNTKVYAVEAARGLEYYKYADVVFGMETFGASGPANDLFEEFGFTKDKLKAKIIAD
FT                   FKNN"
FT   gene            181425..181778
FT                   /gene="lrgA"
FT                   /locus_tag="Abu_0183"
FT   CDS_pept        181425..181778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgA"
FT                   /locus_tag="Abu_0183"
FT                   /product="LrgA family protein"
FT                   /note="Pfam match to PF03788 LrgA, score 63.9, E-value
FT                   4.8E-016"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66460"
FT                   /db_xref="GOA:A8ER86"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER86"
FT                   /protein_id="ABV66460.1"
FT                   /translation="MLKGIIVLLVFQFLGECIAKFFTLLVPGPVIGMVLLLVFLIIKKG
FT                   SFHSLDNAVALHLRYLPLLFIPAAMGIITQIDIITKEFWAIFIALFFGTLIALIFAAKF
FT                   MDFLTSKVNKDEL"
FT   gene            181768..182490
FT                   /gene="lrgB"
FT                   /locus_tag="Abu_0184"
FT   CDS_pept        181768..182490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgB"
FT                   /locus_tag="Abu_0184"
FT                   /product="LrgB-like protein"
FT                   /note="Pfam match to PF04172 LrgB, score 270.7, E-value
FT                   2.6E-078"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66461"
FT                   /db_xref="GOA:A8ER87"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER87"
FT                   /protein_id="ABV66461.1"
FT                   /translation="MNYEALTNYISSTPLTWLIITIAAFKFGIIIYEKFNKHTLLQPII
FT                   IAYVIILFLIIYTNTSFEKYFKSVEIIHFFLGPATVALALPLYKNLKYIKSLFLPIVLT
FT                   LFIAGVFSIVIAVSLLYIFGAHLPTILSMTTKSITAPIAIITSQQIGAIPSLAVGFVLI
FT                   TGIVGALFGTIVFKIFKVKYETSKGFALGLVSHGIGTARAIEISEKAAAFAALAMGLSG
FT                   IFTAIFLPIVITYFKNIF"
FT   gene            182505..182858
FT                   /locus_tag="Abu_0185"
FT                   /note="AB0181"
FT   CDS_pept        182505..182858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66462"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER88"
FT                   /protein_id="ABV66462.1"
FT                   /translation="MKETLFVYGTLMPNCPNAHILENIVGKFLPATVKGKLVDAGWSAS
FT                   MGYPGIRLEDGSDTIHGFLFYSDNLINHWDFLDEFEGEEFIRMPIKAERFDEIEVDTYI
FT                   YTLKDEIIEEELY"
FT   gene            complement(182873..183277)
FT                   /locus_tag="Abu_0186"
FT                   /note="AB0183"
FT   CDS_pept        complement(182873..183277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0186"
FT                   /product="conserved hypothetical protein (DUF350 domain
FT                   protein)"
FT                   /note="Pfam match to PF03994 DUF350, score 31.5, E-value
FT                   2.8E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66463"
FT                   /db_xref="GOA:A8ER89"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER89"
FT                   /protein_id="ABV66463.1"
FT                   /translation="MEIGLFFNFMSFFLTAILLVVSFLYLYSIVTPYDDYKLIFEENNI
FT                   AAALGFGGAIIGVSIPIYSALENSVSYIDFVVWGVIAIIIQLIFASIVTRTKGKYSFSS
FT                   KISQGVISVGILMAFLSICIGLINAGSMSY"
FT   gene            complement(183341..184786)
FT                   /gene="dctA"
FT                   /locus_tag="Abu_0187"
FT   CDS_pept        complement(183341..184786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /locus_tag="Abu_0187"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="Pfam match to PF00375 SDF, score 317, E-value
FT                   3.1E-092"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66464"
FT                   /db_xref="GOA:A8ER90"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER90"
FT                   /protein_id="ABV66464.1"
FT                   /translation="MNNFLFEKLRQKLKQNLKKYSLLLKLRLKKGRTLEQEVDLKKRTL
FT                   MDYTVKSLAFWVIFGIIAGIIVGYVNPALGIEAKPGIDWFIKILKWLVGPIIFLTIISG
FT                   IVGLESLKELGSLGFKAFIYFEIVSTFALAIGVIFGNWFGPGHGMNLDVNHLDEKSVST
FT                   VDKYTHVDPDKVGDIWEILKNAIPTDPITPFLTGQTLQVLVMALVLAILISAFGGKHKP
FT                   KILKPVEVAQNFFFKVLIILMWLSPLASFSAMAFLIGKFGIDSLINMASLLGVMFISVL
FT                   AFIFVILGIIMAFFKVNIFKFMRYIQKEVLIVFATSSSESALAPLMRRLEAAGVKKSVT
FT                   GLVLPTGYSFNLDCTNIYLALCIIFLSQAFNIPLTIEQQLFIILILMVTSKGAVGVTGS
FT                   GFIVLAGTLGAMGGAIPVVTVAVLLGVDKFMSEMRAVGNLCGNAVAAVVVGVWDKKIDM
FT                   EKFQYALNNPDKIESVIGSKTIK"
FT   gene            184871..185509
FT                   /locus_tag="Abu_0188"
FT                   /note="AB0185"
FT   CDS_pept        184871..185509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66465"
FT                   /db_xref="GOA:A8ER91"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER91"
FT                   /protein_id="ABV66465.1"
FT                   /translation="MKIIEDKTYYKMSKLVELSNLNNHTISFYDKKGLLPNTISTSKNM
FT                   KYYPEITITVLNLIKYFKDNLNFSIDYIKELFDYYQINFENRSDLILQSIQMLSNEIKN
FT                   PILKKDLLNKNIDEAIKLDLLEDKEVYFKTEIEVLDTFNELKKYDVSTELISQYVKTSK
FT                   NLALLEKELTNKVLEKNGFLPEVLVLDILNKFKPYVFNRHTILEFKKAK"
FT   gene            185509..185883
FT                   /locus_tag="Abu_0189"
FT                   /note="AB0186"
FT   CDS_pept        185509..185883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66466"
FT                   /db_xref="GOA:A8ER92"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER92"
FT                   /protein_id="ABV66466.1"
FT                   /translation="MRKEKYISAIFAFILWGSWSYFVNIEDENRFISSFFQGIASFIIT
FT                   LFMVRLIIVFSNIFTNSSIYIISILTVLATSSIVFIGHLIINTQNIFYTIAPTVIVAFM
FT                   FSLFIAKKYQKSITEDKNER"
FT   gene            185873..186523
FT                   /locus_tag="Abu_0190"
FT                   /note="AB0187"
FT   CDS_pept        185873..186523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0190"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase-related protein"
FT                   /note="Pfam match to PF01066 CDP-OH_P_transf, score 32.3,
FT                   E-value 1.6E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66467"
FT                   /db_xref="GOA:A8ER93"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER93"
FT                   /protein_id="ABV66467.1"
FT                   /translation="MKDSNRRPLKVRGSVWSQKFASYLSKKDITPNQISIGSIVASFIA
FT                   SIFILFISNDNFFTIWISPILAALFIQMRLLCNLFDGMVALEGGKSTKSGELFNDIPDR
FT                   VSDSLLFIALGYSITNISFGIELGYLAALFAALTAYVRVLGASMQAGSCFKGPMAKQHR
FT                   MAILTIALILTPFELSLFATDYILIITLFVIAIGSFLTIINRTKTIYNTLEGK"
FT   gene            186523..187455
FT                   /locus_tag="Abu_0191"
FT                   /note="AB0188"
FT   CDS_pept        186523..187455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0191"
FT                   /product="CDP-diglyceride synthetase/phosphatidate
FT                   cytidylyltransferase"
FT                   /note="Pfam match to PF01148 CTP_transf_1, score 276.5,
FT                   E-value 4.9E-080"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66468"
FT                   /db_xref="GOA:A8ER94"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER94"
FT                   /protein_id="ABV66468.1"
FT                   /translation="MFDIAQNSLYAMILTIAVLVISTLIYQYKKVKNPNKDFKELGLRI
FT                   KSWWWMIGIVFLALSISLKSALIFFAFLSFLSLKEFLSIVSVRYVDRRAIFWAYLSIPL
FT                   QYYWISIGWYGMFIIFIPVYLFLFIPIRLVLIGETSGFIKSASIIQWATMLTVFSISHI
FT                   AYLMALPVHNSLAGNIGPVLFLLIMTQFNDVSQYVFGKLFGKHKIIPKVSPNKTWEGFL
FT                   GGVFSVTLISGIVAPYLTPLDMSYGFMAGFIISCIGFFGDVVISSVKRDIGIKDTGTFI
FT                   PGHGGILDRIDSLMYTAPVFFHFLYYVSY"
FT   gene            187457..188083
FT                   /locus_tag="Abu_0192"
FT                   /note="AB0189"
FT   CDS_pept        187457..188083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0192"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="Pfam match to PF01553 Acyltransferase, score 65.2,
FT                   E-value 7.2E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66469"
FT                   /db_xref="GOA:A8ER95"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER95"
FT                   /protein_id="ABV66469.1"
FT                   /translation="MKRVVKVLFFAFIVKPIVFVVLGLNIKGREKLPLEGGAVIAPNHN
FT                   SHLDTLVIMSLYPLSKIDKIRPVAAADYFMRNKFVSWISTYCIGIIPLDRTGASSQEEL
FT                   FKEPHEALDNKDILILFPEGSRGKPEQMTRLKKGLFYLLKDKKDIPIIPIAMQGLGNSL
FT                   PKGEALFVPFNCQVVIGESIDIPENSQTLNETLKDFFETNLKQIS"
FT   gene            188095..191577
FT                   /gene="aas"
FT                   /locus_tag="Abu_0193"
FT   CDS_pept        188095..191577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="Abu_0193"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase
FT                   / acyl-acyl carrier protein synthetase"
FT                   /note="Pfam matches to PF00501 AMP-binding, score 238.2,
FT                   E-value 1.6E-068, and to PF01553 Acyltransferase, score
FT                   94.1, E-value 5.5E-026, and to PF07690 MFS_1, score 41,
FT                   E-value 2.5E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66470"
FT                   /db_xref="GOA:A8ER96"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER96"
FT                   /protein_id="ABV66470.1"
FT                   /translation="MKKIDNLLIIKIAFLFVVFCNAVVDVSHKVLLQNIAFKIFDGTTQ
FT                   VIWVSIINVLLIIPFLLLFTFSGYLSDKYNKKDILVYGALSSFLLASLMIAAYISGNFY
FT                   FAMFALFLLAIQSAIYGPAKLGLILDIYGKKNLSRGNAALQAISIIAILFAIGVTSFVF
FT                   EKFYNLNNLQNITSKDELLLAILPLTYYILPVAFLEMVVSFLFLRRVNTNYVKNETISL
FT                   NKQEFFKGRLLINNIKNIYSQNVIFLSVIGLSVFYGVSQGVIAVFPSFAKMYLNIHDVF
FT                   VINGVIAASGIGIAIGSIIYSRVSKFYIEVGTIPFASFGMATMIYISTIVETPFMLTLT
FT                   FLVFGIFGGMFVVPLNSLIQFNAKKKFLGTILAGNNWFQSLFMFLMLCITTIVSFYDLD
FT                   PLNTIYLILSIIVIGTLYTVYKLPQSLLLLFLKAFVGLKYKLEVDGIKNIPSQGGVLLL
FT                   GNHVSWIDWAIILMAVPREVKFVMDKTIYNKWYLTWLLKMFKCIPISNESSKSSMQIIA
FT                   KELDDGNIVVLFPEGAITRNGHLGEFKRGFEKILEFTTNEEIKVIPFYIRGLWESMFSR
FT                   ANKRFKDSNKTNRVTVSFARMMNKNDANAISIKNEVFELSAKSWKEHINHLKPLNEVIF
FT                   DRLKEVSNEIIFADSTNTQLSGYRFLTASILFKNLLKKDLKEQNIALLLPSSVAGAFMN
FT                   YMVLLMGKTAINLNYTSQVEALKSAIIQSQTKSVITSKKFVEKLKLKGFKIDEVLENVN
FT                   VFYMEDLKTKISKKQGIITLICVKLLPSFILKWLFLTKTKKDDTAMILFSSGSEGSPKG
FT                   IELSGDNILGNAQQIANIINVNNKDAILGSLPLFHAFGIVVNTYLPLIEGIKCVAHPDP
FT                   TDGLEIAKLIFKHKVTFMCGTSTFFRLYVRNQKIHPLMFESLRLVIAGAEKLREDVKID
FT                   FKKRFGKDILEGFGTTETSPVATCNLPNVMAPDFTVQIGQKAGTVGMAIPGTTIKIVDP
FT                   MSFEELKPNEEGMIVISGIQVMKGYLGNEEKTKEVLKTIKGKTYYITGDKGKVDEDGFL
FT                   TIIDRYSRFAKLGGEMVSLTSVEDKISKILELKEDSSVDFIATNVEDEKKGEKIVLLIS
FT                   NIDEDFVANLKEKILNNFDNKLMIPSEIKIVKDIPKLGSGKKDFNASKLLAKG"
FT   gene            complement(191582..194113)
FT                   /gene="glnD"
FT                   /locus_tag="Abu_0194"
FT   CDS_pept        complement(191582..194113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="Abu_0194"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="Pfam matches to PF08335 GlnD_UR_UTase, score 52.5,
FT                   E-value 5.3E-013, and to PF01966 HD, score 35.5, E-value
FT                   1.6E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66471"
FT                   /db_xref="GOA:A8ER97"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER97"
FT                   /protein_id="ABV66471.1"
FT                   /translation="MTELNIQIEELISNNATDFQISKVFKTYYKNYLDSIDTTVETTGG
FT                   KDFFIKHTKHTDKFLILLYKYILRKNFGVHQPMSNSIPITLIALGSYGREQLCIYSDID
FT                   IMILYEDIKGYNLKTIIEEFITLTWDCGLKLGSRVDELKNIENVVKEDITIKSAILESR
FT                   IIYGSKTLWVSYENILKKIRKTDQKEFILEKLEEHKQRLLKFPLKMEPNIKDGYGGIRE
FT                   ANMMYWIANILYGLNNVKELAGFQFSEDEYKKYRQALEFIFQVRTALHSIARKKQDQVT
FT                   FDILPDLSAKLGFKNQPRYTKDRLCMSKIISSLHIIHNFTATMIKKFTRVALFEATNIP
FT                   KLKKLRYKKNLYIINNELFCSFSAKPQSLNNFIKELIELPLNVDRFDRSYIYYASKTKL
FT                   PKTQSKELRKSIKLLLTKQKLYPLMKLIYNAGLFQAIIPVTKMLINQPQFDGYHRHPVD
FT                   IHSIKTLKFAQNIEDEHVKSIFNELTNEQKMIVRLVAFFHDVGKGRKEDHHIVGEKLFK
FT                   NMLKSFDFDEELIKVGANLVRYHNMMSYMATNEDIYSEKTILNLMGIVKTKDSLKMLYV
FT                   VTYCDISAVGQNIFNSSTASLLKQLYYQALPAFDNQEFLKESKRRTAKQNAIKNLERYK
FT                   ELPMILQKKIMYISSNQIFLRMKAEDILDIAIKAKDVDSYIYKIINEAQLTIRIIRKQP
FT                   LNLGYLLGKLEFLNIDSMNIYKLYDNKKAFEISFSEKIDPEDIYLIEEIIKDSFDMTKR
FT                   TNLITPIIKKEDIKIDCNHTSYLASMHIVTKDQKGLIAYIAKIFDDFNVEIESAKLYTL
FT                   KGMARDLLLIEKDGNFCSKREEIVNLICSKG"
FT   gene            complement(194110..194862)
FT                   /locus_tag="Abu_0195"
FT                   /note="AB0192"
FT   CDS_pept        complement(194110..194862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF02954 HTH_8, score 22.9, E-value
FT                   1.7E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66472"
FT                   /db_xref="GOA:A8ER98"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER98"
FT                   /protein_id="ABV66472.1"
FT                   /translation="MQEYIALDSISKEILNSAKLLQSVEVNALILGENGVGKKSLAKYI
FT                   LPNSKIYEAKALQKDIIDNILTLQNESIIIDRVNEITNIDIFINWIEKNQIRVIATSQA
FT                   SNLNQKLKDLFIITLEIPPLKNRIEDTKALINKFSQEASSILEMPLVSSSKLITNISNN
FT                   THSLRKSIYFSYLFETIGENEILTFLEKYLSENLSKNSSYKDLLYIFEVPLLKAAIKKY
FT                   KSQVQVAKHLDLNRITLRKKLEVYKELL"
FT   gene            complement(194924..195793)
FT                   /locus_tag="Abu_0196"
FT                   /note="AB0193"
FT   CDS_pept        complement(194924..195793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66473"
FT                   /db_xref="GOA:A8ER99"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A8ER99"
FT                   /protein_id="ABV66473.1"
FT                   /translation="MKEFFETYNQHQEDIEYFLQESLKNIGGLSNHKKNDFKQLYKIFP
FT                   SLELVYIIDKHTKIQTSNNFYRYKIDENAKNKDRSHLISKLHFTDSNMAFSKPYISSAT
FT                   RSTCVTVTIKEENEIFFLDFRIDILLQKLNLIELNKPFHSITKGFYIIAGFSMIVLSIL
FT                   TIFFSLYDFMLYIFSNHDLSLEMIFKPIISLTLSIAIFDLAKTILEQEVFFKSYSKNSR
FT                   VETKILTKFLTTIIIALSIEALIVVFKIAINDYVQMVNAFYLIAGIALILVSLTIFIYF
FT                   SQKKYIQS"
FT   gene            complement(195863..197797)
FT                   /locus_tag="Abu_0197"
FT                   /note="AB0194"
FT   CDS_pept        complement(195863..197797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0197"
FT                   /product="hypothetical protein, ankyrin repeat family"
FT                   /note="Pfam match to PF00023 Ank, score 28.6, E-value
FT                   5.2E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66474"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA0"
FT                   /protein_id="ABV66474.1"
FT                   /translation="MLNILTNKSKFTEQDLVKELIDPTTSSEQLNKIYQNSNIDLNKIY
FT                   HHDEPILHSCCKKDLYESVLWLLEHNINTEIETEQKETAIFYAIYSKDSKMLKTLVDFN
FT                   ANVNHINNKNRTALQESISNSNNKVIRYLLQVTKVLNNKDTNGNNLIFDAITNGNFNLI
FT                   KNIVSLKKIDINEINNQGNCVLHLENVLKNNEIAMFLLESGANPTIVDRNGKSFLSYSV
FT                   LNGIKNMNLIKRASFFGFDLNLKNKDNRNILMEATNHFLNLPKDDKKTVNSQAELIKEL
FT                   VQMNINIQAVDNDNETVFFNITRSEDRDLIHYFLNNGLNINLNKQNNIGLTPLTILVLN
FT                   GIKNSDLIKLYLEKGASLNTKNKFGKTTIEILINIILHQDDKVEIEPEYKLLLVEDAQY
FT                   KDILELFIKNYDVEINELNSEGEPLFFSSLLNFNFSLFKILRTRNTDLNKKDENGNNII
FT                   FRLMDLSSEHKIKNKRTYLNTIKNLINVGVNIDETNQEGSTALQVAIFNNCKDVVKLLL
FT                   ELRASCNLVDEKGRTLIHSCVFQDRTSFIKDIHQSNQEIINIADSFGVRPINYAAFMGK
FT                   KDLVLEMLSMGALINNPHKKSPKILSFLEKYHKNILNLTIGVKDESNKANLNLLAQNMI
FT                   KEFNIKTSV"
FT   gene            197999..198337
FT                   /gene="glnB1"
FT                   /locus_tag="Abu_0198"
FT   CDS_pept        197999..198337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB1"
FT                   /locus_tag="Abu_0198"
FT                   /product="nitrogen regulatory protein PII"
FT                   /note="Pfam match to PF00543 P-II, score 232.3, E-value
FT                   9.7E-076"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66475"
FT                   /db_xref="GOA:A8ERA1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA1"
FT                   /protein_id="ABV66475.1"
FT                   /translation="MKRIEAVIKPFKLEDVKDALQEAGITGMTVSDVKGYGRQQGHSEL
FT                   YRGAEYVVDFLPKIKIELIVADENVDNIISVIIEAARTGKIGDGKIFVSPIEKIVRIRT
FT                   GEEDEEAI"
FT   gene            198338..199363
FT                   /gene="pyrC"
FT                   /locus_tag="Abu_0199"
FT   CDS_pept        198338..199363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="Abu_0199"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="Pfam match to PF01979 Amidohydro_1, score 159.6,
FT                   E-value 7.5E-045"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66476"
FT                   /db_xref="GOA:A8ERA2"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA2"
FT                   /protein_id="ABV66476.1"
FT                   /translation="MSGFKTFEINEPLDMHLHLRDADMLKLVGPLTSKTFSGALVMPNL
FT                   VPPITTKEALLSYKQRIKEACKNDQFEPFVTLFFKNDYSYEFLKDIKDEIIAIKLYPAG
FT                   ITTNSETGVSSMDIEVLRPTLESMSKLEIPLCIHGETNGFVMDREKEFMPIYESIAKAF
FT                   PKLKIIMEHITTKDAIELLDKYDNLFATVTLHHLLITLDDVAGGMLQPHLFCKPIAKTP
FT                   IDRSALLNAALKAHPKLMFGSDSAPHPKHKKECCGCAAGVFTSPIALQVLTQLFEKHNA
FT                   LENLNAFVSLNAQKIYNLKLDKKTIKLVKKDFVVPAIYEYKEERVVPMYAGETLSWSLE
FT                   D"
FT   gene            complement(199381..200487)
FT                   /gene="fliM"
FT                   /locus_tag="Abu_0200"
FT   CDS_pept        complement(199381..200487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="Abu_0200"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="Pfam matches to PF02154 FliM, score 186, E-value
FT                   8.3E-053, and to PF01052 SpoA, score 27.2, E-value
FT                   2.2E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66477"
FT                   /db_xref="GOA:A8ERA3"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA3"
FT                   /protein_id="ABV66477.1"
FT                   /translation="MAEFLSQDEIDALLDIAEQGDDIDGTNPLDKFTAKEKNYSIYDFK
FT                   KPNRVTLDQLKALTTMHDKMLREFINDLSSMLRKIVDIKLTTIEQMTYGEFILSIPQVT
FT                   SLSTLSMKPLDGRIVIECNPTISHKVIADLLGSGAVNTMDNLDRELTEIEIKVLEHFYK
FT                   MFIKILYKTWSDISSLNFRIESSDTNANAIQIVSDHDIVLLVVFEITIDEDSGFLSICY
FT                   PISYIEPLLNKIVDKIFSEGKNKKLSRKEDIKTLISGARMKVEAIMAETELTTAEILNL
FT                   KENDIIVFNKNASSSSATVYINKKEKFSAVSGISNNRKAVQIKANLDREKQETLDTLRE
FT                   MREDREQKAKESAETLKKLLNERTSNYL"
FT   gene            complement(200491..201540)
FT                   /gene="flgI"
FT                   /locus_tag="Abu_0201"
FT   CDS_pept        complement(200491..201540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="Abu_0201"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="Pfam match to PF02119 FlgI, score 265.3, E-value
FT                   1.1E-076"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66478"
FT                   /db_xref="GOA:A8ERA4"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERA4"
FT                   /protein_id="ABV66478.1"
FT                   /translation="MKYFFIIALLLSSLYSQTIKDISNIIGIRENQLIGYGLIVGLAGT
FT                   GDKSKFTMQSLQNLLRNSYIKIPAGSINSKNIAAVMVTADLPPFARQGDKIKVNISTIG
FT                   DAKSVDHGELLITQLKGVDGNVYALAQGTIVANENNKTTGFIYDGATVENEINFDLQSE
FT                   DSIQLSLLKNSAKNADLIETKINDTFGKKLATALDTRTIDVKKPDGMSIVKFISLVQNI
FT                   ELESSFKKKLIIDMNRESILAGGDIVIDPVTIARDTFTIRINKTGLGEVDWNNPTINTG
FT                   VDIGDDVRIADKPVIDINNAMINTKNPPTVADLVRSMKVMKLPMKEIIDTLKMIKDMGA
FT                   IDVDIELRE"
FT   gene            201645..202937
FT                   /locus_tag="Abu_0202"
FT                   /note="AB0199"
FT   CDS_pept        201645..202937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA5"
FT                   /protein_id="ABV66479.1"
FT                   /translation="MNIYIYGNQRFKKEIYKILDSSQIKKIDNNVIIKEISNLNDLKET
FT                   IKAQPKDIYLIDDEKIIKKDSLKSKFFAPKDGVDEQFLVESGVNDLTINSLNEIPEYII
FT                   RKYELEKNLEDIKKENKVELDDELSKLLANETQIEKKAESTPEIKDDEIVSGVNLNELE
FT                   NLIETTEETENIDLHKLDNNDKITNEFEDFNNDFGLNNISFDYDDDNILNDNSLSDEDV
FT                   LSQILNSASIDEDNYEFLGETFEDVNFLEELFPDKAEFLATFEKPEKQVEDDKTEMTDE
FT                   FVEFDDDEEVHLPDEEIQEVADLEEDNFENEKKKVIIEPMDDEENEENEEKNEEDEESE
FT                   NFEDLEGENMNDNEFSELDSLNEKDLMEALNYKADEIVQVPKNEEKTQIISNTNNKETV
FT                   ILNSSNVDEISQLISKLLSNKTLEITIKLKD"
FT   gene            202940..203200
FT                   /gene="fliQ"
FT                   /locus_tag="Abu_0203"
FT   CDS_pept        202940..203200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="Abu_0203"
FT                   /product="flagellar basal body protein FliQ"
FT                   /note="Pfam match to PF01313 Bac_export_3, score 83.3,
FT                   E-value 7E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66480"
FT                   /db_xref="GOA:A8ERA6"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA6"
FT                   /protein_id="ABV66480.1"
FT                   /translation="MDLIGIAENTVKIILILGLPSLIVSMIIGLVISIFSAVTQVNDAS
FT                   LSFVPKMIFVSAFILISLPWVGDHLETFTKDLWDIILTFGH"
FT   gene            203202..203606
FT                   /locus_tag="Abu_0204"
FT                   /note="AB0201"
FT   CDS_pept        203202..203606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66481"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA7"
FT                   /protein_id="ABV66481.1"
FT                   /translation="MIEKLYKLKKNQTDQKLIEKATLEQEVDKIDSEVVFTQHKIDTAT
FT                   VDRFGAISDFLILAMHKDTMRLHIQKLLTRKNSLVSQIANLVNEIVELQKESEQFKYIL
FT                   DEEKKEKFKKILAAEEEAASEYVQSKYIRG"
FT   gene            203615..204106
FT                   /locus_tag="Abu_0205"
FT                   /note="AB0202"
FT   CDS_pept        203615..204106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66482"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA8"
FT                   /protein_id="ABV66482.1"
FT                   /translation="MIYKFLILTIFFVIQINAVETSSSLTRQKMEVLELKNELNNFYNE
FT                   KEKEYQTQKKELENLLAQVEKEKAETKRLHDKNLALLKDIRAEVQSKTVKIYDGMKAKN
FT                   AAEIFDQMINEGKIEDVFDIILRLRESNVTQILKFLTVTNASRLTQKLEKYNLDKDKKD
FT                   "
FT   gene            204108..204635
FT                   /gene="fliL"
FT                   /locus_tag="Abu_0206"
FT   CDS_pept        204108..204635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="Abu_0206"
FT                   /product="flagellar basal body-associated protein"
FT                   /note="Pfam match to PF03748 FliL, score 70, E-value
FT                   6.7E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66483"
FT                   /db_xref="GOA:A8ERA9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERA9"
FT                   /protein_id="ABV66483.1"
FT                   /translation="MAEENGETTKKSSEGKGLLIVLIVLILILIMAVAGGTYFLLDKIS
FT                   STANNGQKTEESAQTATPANTSEATFKADVNDLVLNLTDSRGKEKVMKLSFSIRSNDPL
FT                   IATVIEEYKAEITDVVISQVSSRSSEELLTVGGKNLLKDELIAEINNVINYVTKSNRNV
FT                   VSTILFTTFVIK"
FT   gene            204635..205063
FT                   /locus_tag="Abu_0207"
FT                   /note="AB0204"
FT   CDS_pept        204635..205063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66484"
FT                   /db_xref="GOA:A8ERB0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB0"
FT                   /protein_id="ABV66484.1"
FT                   /translation="MIVAVKRNKSQKILKIIIVVLLVSGGAYYYNDYIETARINAEKQK
FT                   LEEEQKRVLKAKEEEQEKIKQEAQREILAEVEKAVNLIGQEYVRDVKLIKNKVVFVCEP
FT                   DTNIDALVVRYGAMALVKKTFDEIVIVVDIDFILKNKL"
FT   gene            205060..205764
FT                   /gene="flgH"
FT                   /locus_tag="Abu_0208"
FT   CDS_pept        205060..205764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="Abu_0208"
FT                   /product="flagellar basal body L-ring protein FlgH"
FT                   /note="Pfam match to PF02107 FlgH, score 95.6, E-value
FT                   1.3E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66485"
FT                   /db_xref="GOA:A8ERB1"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB1"
FT                   /protein_id="ABV66485.1"
FT                   /translation="MKLVIYISLTSLLFLGCASQEPDIHFEKPEIQIPKKAPEAKKNKG
FT                   SLYSMQGTSLFADKKDLQIGDIIQIIIKEDLTAKSDNKRELTNNRNNNLGGGLFTPMGT
FT                   NTLGGVAESITNESNRSLGVDFGTQSTNSDKGKVKTQFNETFDTTISAIIEETYQNGNY
FT                   YIRGEKEMLIEGQKQKIVISGVIRPYDITSDNSINSSQIANLKLLYNKDGTESDILDTP
FT                   WGLNFMRKIWPF"
FT   gene            205818..207728
FT                   /gene="flgK"
FT                   /locus_tag="Abu_0209"
FT   CDS_pept        205818..207728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="Abu_0209"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="Pfam matches to PF06429 DUF1078, score 45.5, E-value
FT                   1.6E-010, and to PF00460 Flg_bb_rod, score 40.6, E-value
FT                   4.8E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66486"
FT                   /db_xref="GOA:A8ERB2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB2"
FT                   /protein_id="ABV66486.1"
FT                   /translation="MSLFGTFNVAQTGLSASRYGIETVSNNIANKDTDGYKKRVTDLSE
FT                   IGQMGSSITGRGVNVDGVSRVTSQYLYDNYTKEYTKTSYYDKLTNMLGNIEKVFAETDT
FT                   AGLSVDINNYFTAVEQLRSNPNSQIYKSYLQSQGQALVDNLQRLYSSVEQQQSIEKVEL
FT                   KTNVKEVNSILKEIADINGKLENYTNSTNDLLDKRDALELKLSQYVNVDINRDNGYEIK
FT                   IGGVTALSSGTLNRELEISYKDTKQVDKFNYIQSNGTVLDSLKYNEDGTAKAAYDANDV
FT                   IKYTLNNDDNLSVTIQIGEVVNGDWDNDPSTPDTGEAVTMDNLTRALAFKINNDPKLSQ
FT                   YVTAHNGDYNDGYMVYPGDNRGLSTDSDKYLRVESNEAGKANEFTGTISIVRYDATNAV
FT                   QEREALYKNESQSTTAESDVVLKILEQNVNLSSGSIKAQVENLSSSSPNNKIQSYLDNL
FT                   DSLAATFSDIYDQYIQVGKSEYVYGQNAANDYNGTPKGEIVSVGLFSGTSVKTLAFNKN
FT                   AVNDLKQEQIEYLATIQWKTDLSFDGKGQDSTATNTTSLSEFFRNTKVNVSSDTENAKY
FT                   SKEVQANIAQTIGTTYNNIVKVDEDDEMVNLMKLQAAYSANAQMITAVDEMIKVILGLR
FT                   S"
FT   gene            207749..209086
FT                   /gene="fliD"
FT                   /locus_tag="Abu_0210"
FT   CDS_pept        207749..209086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="Abu_0210"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="Pfam matches to PF07195 FliD_C, score 76.5, E-value
FT                   7.8E-020, and to PF02465 FliD_N, score 41.3, E-value
FT                   3.1E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66487"
FT                   /db_xref="GOA:A8ERB3"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB3"
FT                   /protein_id="ABV66487.1"
FT                   /translation="MAGVLGLGSSGSTSLNEALIEKLKEADKASSVTPLEKKLEKFTTE
FT                   KEVVANIQTKVNELLSAVKVFSLNQTTGANAFQQKSANVTGDGVVFDSDDLSALKSGSL
FT                   SVKVEQLAQKDVWQSKQFDGTTTTKSSLVNQGTLNINGTSIDTTNKSYSDLVTEINKIS
FT                   GVQASLVEDSTGKFRLSIKSSETGESNKINFTGSDSTALSHFGFDDTTNNVLKAQDMKM
FT                   KVDGVDYSGSSNTITIDGLKITASKSTGESTINIEDDNSNIKTQMQAFVTAYNTLNTLI
FT                   SGEVYSTDSSLGDKASIRNVMSQLKEQLFGTGSGDKTIFSYGFSFDSSNGNLVLSSTEF
FT                   DNAIKNDKEGLQNLFVGVAEKKGIATTLDELISNSGINKDLIDYESNMLSRETKLTEQK
FT                   DAAQEALDAKYKLMSEQFAAYTTIITQMENSFSGLKMLIQQSTASN"
FT   gene            209158..209514
FT                   /gene="fliS"
FT                   /locus_tag="Abu_0211"
FT   CDS_pept        209158..209514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="Abu_0211"
FT                   /product="flagellar protein FliS"
FT                   /note="Pfam match to PF02561 FliS, score 87.3, E-value
FT                   4.2E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66488"
FT                   /db_xref="GOA:A8ERB4"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB4"
FT                   /protein_id="ABV66488.1"
FT                   /translation="MGIEEYNQQNAISDDPYVLVLKLYEGVIKFLSFAKSAIQEGDIEK
FT                   KFIYINKAIAIFDELRSVLDFDGGDVAYYLDGLYLYQIETLFSAGIDDNINSINQVMKV
FT                   TQGLIEAWKDETGL"
FT   gene            209490..209759
FT                   /locus_tag="Abu_0212"
FT                   /note="AB0209"
FT   CDS_pept        209490..209759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66489"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB5"
FT                   /protein_id="ABV66489.1"
FT                   /translation="MERRNRSLKALNELIYIDSLDSFEKGDALVNWYNDYLSENSIEEF
FT                   DLELKDLKTLEELFFRNINFLKEIKEQARQELIRIRKVKSFLKN"
FT   gene            complement(209748..210728)
FT                   /gene="tilS"
FT                   /locus_tag="Abu_0213"
FT   CDS_pept        complement(209748..210728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="Abu_0213"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /note="Pfam match to PF01171 ATP_bind_3, score 223, E-value
FT                   6.1E-064"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66490"
FT                   /db_xref="GOA:A8ERB6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB6"
FT                   /protein_id="ABV66490.1"
FT                   /translation="MNLNFSAIKESKNLLAFSAGVDSSALFFLLLKQNIPFDIAIVNYN
FT                   VRVQSKDEVNYAKELASKYNKQIYIKDIKLESTSNFEKMARDIRYKFFEEIIDENSYEV
FT                   LITAHQLNDKLEWFLMQFTKGAGLVELIGFNEFEQKENYKVYKPLLEITKKELENFLKQ
FT                   ENIKYFIDNSNFDEKYKRNYFRHNFSDKLLSEYTNGIKKSFKYLQDDINSLNIEITPIK
FT                   NFNELEIYQNQNDNNLNIRIIDNSLKKRGFLLSSAQRDEIIKQKEITISHKINISIKED
FT                   FIWICPNVSSVMDKKFKEICRINKIPKNVRNYIYYKKIDIKELIF"
FT   gene            complement(210731..212071)
FT                   /gene="yliG"
FT                   /locus_tag="Abu_0214"
FT   CDS_pept        complement(210731..212071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yliG"
FT                   /locus_tag="Abu_0214"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="Pfam matches to PF00919 UPF0004, score 144.6,
FT                   E-value 2.4E-040, and to PF04055 Radical_SAM, score 76,
FT                   E-value 1.1E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66491"
FT                   /db_xref="GOA:A8ERB7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERB7"
FT                   /protein_id="ABV66491.1"
FT                   /translation="MKFSTQKPKKTLHMVSLGCTKNLVDSEVMLGRLSDYQLTDDAQNA
FT                   DVIIVNTCGFIDSAKQESINTILSLHEDRKNESVLVMAGCLSERYKEELQKELPEIDVF
FT                   TGVGDYDRIDELVNEKRSNFTSEVFLASETNERVITGSSYHAYVKLSEGCNQACSFCAI
FT                   PSFKGKLHSRTLQSLVKEVKALVAKGYVDFSFVSQDSSSFLRDLDIKNGLELLVEEVEK
FT                   IEGIKTARILYLYPSTTTLSLIDKIADSKVFVNYFDMPLQHITPSMLKIMKRGKGVEQL
FT                   NELMNHMKSKPNSFVRTTFIAGHPGETEDDFEALCNYVENFKFDRANVFSYSDEEGTTA
FT                   ETRTDKVEQELIDERAEVLGEIISQTTQESLESEVGKTFEVYIDGESEEHEYLLSARKT
FT                   IWAPSIDGEIYINDNELSEGEQIKFGQIYTVKITELVGDKLLATVIK"
FT   gene            complement(212139..212957)
FT                   /gene="panC"
FT                   /locus_tag="Abu_0215"
FT   CDS_pept        complement(212139..212957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="Abu_0215"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="Pfam match to PF02569 Pantoate_ligase, score 462.5,
FT                   E-value 4.9E-136"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66492"
FT                   /db_xref="GOA:A8ERB8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERB8"
FT                   /protein_id="ABV66492.1"
FT                   /translation="MQVLKTIEELQNIRKNSLGKVGLVPTMGALHNGHISLIKQARNEN
FT                   DIVIVSIFVNPTQFLPGEDLDAYPRRDEADKKICQMCKVNYVFMPEISTMYTKEEVLVK
FT                   APNKSYILEGKTRPGHFDGVLQVVLKLFNLTQPTNAYFGKKDAQQLTLIQQMVKNFFLP
FT                   INIVPCDIVREEDGLALSSRNIYLNPTQRKDALLISKSLYMAGSLISSGERSVKAVKDK
FT                   IYEVMSILDVEYVAIVDKEFNELETIEPTNTIILVVARFGNTRLLDNIWL"
FT   gene            complement(212977..213936)
FT                   /locus_tag="Abu_0216"
FT                   /note="AB0213"
FT   CDS_pept        complement(212977..213936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0216"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="Pfam match to PF00528 BPD_transp_1, score 154.1,
FT                   E-value 3.4E-043"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66493"
FT                   /db_xref="GOA:A8ERB9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERB9"
FT                   /protein_id="ABV66493.1"
FT                   /translation="MKLFIKKLLYLIVMLFIISLISFIAINAAPNSFFASGELNPNITP
FT                   ESIEQLKAIYGLDKPLYVQFFSWIYSILKLDFGISFSSGEMVKDEILNRIPITLTINLI
FT                   SMFLIFIISLYFGIKSALNKNSFFDKATEQLSLLSFAMPSFYLALILVLVFAINFEIFP
FT                   IAGLHSVPNDGSLTYYLDYAWHLVLPIFIIVFGGIGSLILYIKSLTVEILKSDYIFFAH
FT                   ARGLSKKQILRFYILPNLYPPVITLLGLSLPGIIGGSVILETIFSIDGMGLLFYQSALS
FT                   HDYPVIMGILIIGAFLTLIGNMIADLFLLKLNPNYQEK"
FT   gene            213966..214322
FT                   /gene="acpS"
FT                   /locus_tag="Abu_0217"
FT   CDS_pept        213966..214322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="Abu_0217"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="Pfam match to PF01648 ACPS, score 56.5, E-value
FT                   7.9E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66494"
FT                   /db_xref="GOA:A8ERC0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERC0"
FT                   /protein_id="ABV66494.1"
FT                   /translation="MIGIDITSTDRIKKMYEKFGDKFYEKFLNPDEIELIKKPETAAGF
FT                   WAAKEAASKAIGTGIGGSCSFHDIKIKKDALGAPKIKYKKEIRKKFGIKKSHLTITHDA
FT                   GFAIAVVVNVLKKK"
FT   gene            complement(214357..215583)
FT                   /gene="gltS"
FT                   /locus_tag="Abu_0218"
FT   CDS_pept        complement(214357..215583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="Abu_0218"
FT                   /product="sodium:glutamate symporter"
FT                   /note="Pfam match to PF03616 Glt_symporter, score 680.5,
FT                   E-value 1.1E-201"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66495"
FT                   /db_xref="GOA:A8ERC1"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC1"
FT                   /protein_id="ABV66495.1"
FT                   /translation="MNFTFNPYYTLIVAVIVLLIGKVLVNKIDFLKRYNIPEPVAGGLV
FT                   AALCTTAIHYFFGYSISTSTELQTSFMLIFFASIGLSANFYKLKEGGKSLVIFLFVIAF
FT                   FIVVQNFVGISLATILGIDPLIGLIAGSITLTGGHGTAGAWGSILETKYGIENATALGM
FT                   AGATFGLVMGGIIGGPLAKLLINRYKIKNGHLQKDESDTGNKKVIDEFVPFEYPKAVRL
FT                   ITTNSAITTLGLFAACLAFADFMTGFSKGTSFELPTFVWALGGGVILRNVLENILKVEI
FT                   FDRAIDVFGNASLSLFLAMALLSLKLWQLSNLAGALSVILVTQVVVMILYAYFVTFRAM
FT                   GKNYDASVLAAGHCGFGLGATPTAVANMQAITNVYGVSHKAFLIVPLCGAFFVDLINAT
FT                   IIQVILKLL"
FT   gene            complement(215607..215987)
FT                   /locus_tag="Abu_0219"
FT                   /note="AB0216"
FT   CDS_pept        complement(215607..215987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0219"
FT                   /product="conserved hypothetical protein, putative Holliday
FT                   junction resolvase"
FT                   /note="Pfam match to PF03652 UPF0081, score 105.4, E-value
FT                   1.6E-028"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66496"
FT                   /db_xref="GOA:A8ERC2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC2"
FT                   /protein_id="ABV66496.1"
FT                   /translation="MKLASIDVGLKRIGVAICLTSDIVTPQNAILRKNRNQAANDVNTF
FT                   LKEWEIEKLIVGFPTSSEDMQNRIKHFVNLLELQIPYEFCEENMSSIEAEELIKGEIKY
FT                   KRDGRVDSLAAKIILERYLKNK"
FT   gene            complement(215984..216895)
FT                   /gene="metF"
FT                   /locus_tag="Abu_0220"
FT   CDS_pept        complement(215984..216895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="Abu_0220"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="Pfam match to PF02219 MTHFR, score -39.4, E-value
FT                   4.1E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66497"
FT                   /db_xref="GOA:A8ERC3"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC3"
FT                   /protein_id="ABV66497.1"
FT                   /translation="MFKTLIQKLQEDKYLTLETTPQHEPSMHNIIEKIKKFNLQDKIDG
FT                   FSCTDNPLAKLRYNSLFAALKLQQEFEKPVIATMTMRDRNKIALQSDLLGANDFDVRAI
FT                   LALTGDPAKMSDQPNSKGVFEANSLMLLKMIKSFNYGMDFAGHPFKIEPKQIFPFAVVN
FT                   SYAKNFSSLEKKLHLKIQNGAIGIITQPIFDIENAQKLLESFDIAKENVEGDKRKSQLI
FT                   FGIFPVTKLRTALFLSAQVPGIHVPQFWIDALEKAHSIGEEEEYKVGMELSSNLFKELN
FT                   KLHPKIHLMTANRFDVANEIIS"
FT   gene            216976..217602
FT                   /gene="serB"
FT                   /locus_tag="Abu_0221"
FT   CDS_pept        216976..217602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="Abu_0221"
FT                   /product="3-phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="Pfam match to PF00702 Hydrolase, score 77.7, E-value
FT                   8.1E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66498"
FT                   /db_xref="GOA:A8ERC4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC4"
FT                   /protein_id="ABV66498.1"
FT                   /translation="MKLAVFDFDSTLMDGETIDFLAQELNLGAKVAKITEEAMSGRLDF
FT                   FESLTTRVALLKGLEYKKVVEICENLPLMNGSYELIPELKKMGYKVVCFSGGFRVGTTP
FT                   AKIKLGLDADFSNVLHEKNGVLTGLVGGDMMFGFSKGDMLQRLQSILGVSRENTLVCGD
FT                   GANDLSMFEYADTRVAFCAKEILKKEANIIVDTKDLTKILDNIKA"
FT   gene            217605..218597
FT                   /gene="tal"
FT                   /locus_tag="Abu_0222"
FT   CDS_pept        217605..218597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="Abu_0222"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="Pfam match to PF00923 Transaldolase, score 169.7,
FT                   E-value 6.7E-048"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66499"
FT                   /db_xref="GOA:A8ERC5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC5"
FT                   /protein_id="ABV66499.1"
FT                   /translation="MGLKEEINYSLWCDFIERDFLENRFKEIINKGIIQGATSNPAIFE
FT                   SSITTSVAYKQQLDMLQANNEKTIYEELALTDIKRAAFLLDDLHKKDADDGFISIEVDP
FT                   LLCDDAAGTIEEGIRLYSSINAENVMIKIPATDAGYIAMRELTSRGINVNATLIFSPQQ
FT                   AIKCAQALDEGIKDSNKDIKAVISVFVSRFDRLMDNDLSNKGLQKSKLGIINATKCYYE
FT                   VTKFENSNIRTLFASTGVKGNELNPSYYIDNLIYPNSVNTAPLATIEDWLTDGKKEQTA
FT                   IMSETDCDKYFELLKDKGIKMEEVYEKLLADGLESFKNSFKDLLSKLKH"
FT   gene            218665..220017
FT                   /gene="dhs"
FT                   /locus_tag="Abu_0223"
FT   CDS_pept        218665..220017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhs"
FT                   /locus_tag="Abu_0223"
FT                   /product="3-deoxy-D-arabinoheptulosonate 7-phosphate
FT                   synthase (DAHP synthetase class II)"
FT                   /EC_number="2.5.1.54"
FT                   /note="Pfam match to PF01474 DAHP_synth_2, score 863.2,
FT                   E-value 1.2E-256"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66500"
FT                   /db_xref="GOA:A8ERC6"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC6"
FT                   /protein_id="ABV66500.1"
FT                   /translation="MNNWTPSSWRNFPIKQQPTYNDVETLAQVEKELASYPPLIFAGEA
FT                   LNLKKQLAKVVNKEAFLLQGGDCAESFNVFNATNIKDLFKVMMQMAVVLTFSGGCPVVK
FT                   VGRVAGQFAKPRSADFEDINGLSLPSYRGDIINDIDFSLESREPKAKKLLKAYNQSAAT
FT                   MNLLRAFARGGMADLNQVHLWNLDFVKDNTLGTKYEELANKISESLAFMKACGITSENT
FT                   PQLNQTTLFTSHEALLLNYEQALTRRDSITGDWFNCAAHMLWIGDRTRELDGAHIEYFR
FT                   GINNPIGCKVGPSMKEDELLKLIDTLNPNNEAGRLNLIVRMGANKIADHFPKLLKRVEE
FT                   EGKKVLWSSDPMHGNTIKAENGYKTRDFEAILSEVKQFFQIHRAQGSYAGGIHLEMTGQ
FT                   NVTECTGSKSSAVTQGDLASRYHTQCDPRLNADQALELAFMIADTLKEARK"
FT   gene            220083..220925
FT                   /gene="tsx"
FT                   /locus_tag="Abu_0224"
FT   CDS_pept        220083..220925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="Abu_0224"
FT                   /product="nucleoside-specific channel-forming protein"
FT                   /note="Pfam match to PF03502 Channel_Tsx, score 145.8,
FT                   E-value 1.1E-040"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66501"
FT                   /db_xref="GOA:A8ERC7"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC7"
FT                   /protein_id="ABV66501.1"
FT                   /translation="MKKITFYKILFLFFFISINCFAKDKTSIENSQWANLILMKGIEQR
FT                   GGPFSFDDTYVEFEFGGRHEWLDLYGYVDFVDVLNSKSSDKHGQNNFFVDIEPRISIDY
FT                   LTNTDLSYGVLQELYFAFDFYYADEPTGKGLKVLWMGLGSDIDIPWLGKSGVNFYTRYI
FT                   DENYGASNENSFDGYVAHINWFKPFYFFSKNNFLSFHGYIDYEFGSNLDKTAFEKEYRT
FT                   SDSLQSYLGLYLHEKKWLIGYGLKVYKNMTQWRDNQELNDKKTDTTGFGHYFSIAYKF"
FT   gene            220994..224499
FT                   /pseudo
FT                   /locus_tag="Abu_0225"
FT                   /note="type I restriction-modification system, M subunit;
FT                   AB0222; probable pseudogene due to frameshift mutation"
FT   gene            224501..225496
FT                   /locus_tag="Abu_0227"
FT                   /note="AB0224"
FT   CDS_pept        224501..225496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0227"
FT                   /product="conserved hypothetical DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66502"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC8"
FT                   /protein_id="ABV66502.1"
FT                   /translation="MKDIIIYNTQDGKTSVSLLAKDGMVWMSQMQIAELFNTSIPNISM
FT                   HISNIFEDEELDKNSVVKDYLTTANDGKNYSVTHYSLEMILAIGFRVRSKRGTQFRQWA
FT                   NKNLKEYMIKGFIIDDERLKNLDGKPDYFDELLERIRDIRASEKRFYQKVKELFMLSSD
FT                   YDSSDKSTQLFFAQTQNKLLFAITGQTAAEIIINRADEMKPNMALTSFKGAKVRKEDIY
FT                   IAKNYLNSDELDSLNRFVIVFLETAELRAKNKEDITMDFWRENIDRIIEFNDKKLLKDN
FT                   GSISNEQMKKMVEKVYETFDSKRKKQEAIEADYEDLKELKQIEERAKKKL"
FT   gene            complement(225491..225832)
FT                   /locus_tag="Abu_0228"
FT                   /note="AB0225"
FT   CDS_pept        complement(225491..225832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF03960 ArsC, score 110.6, E-value
FT                   4.3E-030"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66503"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERC9"
FT                   /protein_id="ABV66503.1"
FT                   /translation="MITVYGIKTCGSVRNALKFFKDHNIEVDFFDFKQKSPTASQIKDW
FT                   TKKVDINILFNSKGTKYKTLNLKELNLDDNGKYEWLCKEPMLFKRPVIEYGDKLVVAWD
FT                   EEEYKKTFL"
FT   gene            complement(225983..226273)
FT                   /gene="gatC"
FT                   /locus_tag="Abu_0229"
FT   CDS_pept        complement(225983..226273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="Abu_0229"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="Pfam match to PF02686 Glu-tRNAGln, score 76.5,
FT                   E-value 7.7E-020"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66504"
FT                   /db_xref="GOA:A8ERD0"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERD0"
FT                   /protein_id="ABV66504.1"
FT                   /translation="MTVDDKLIAKLEKLSSLQVDDERKEKLKSELADIINFVENLNDID
FT                   VSNIEATFSTIEGGTPLREDTSKQDLELSNHILNHAPKSEDGYFIVPKIIE"
FT   gene            complement(226317..227438)
FT                   /gene="tgt"
FT                   /locus_tag="Abu_0230"
FT   CDS_pept        complement(226317..227438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="Abu_0230"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="Pfam match to PF01702 TGT, score 413.1, E-value
FT                   3.7E-121"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66505"
FT                   /db_xref="GOA:A8ERD1"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERD1"
FT                   /protein_id="ABV66505.1"
FT                   /translation="MEFKIDGTSQGARACTIKTAHSTILTPVFMPVGTQGTVKALDAND
FT                   MLELGAKIILGNTYHLYLRPGSKLIKKFGGLHGFSKFPNSFLTDSGGFQAFSLSNNSKP
FT                   DENGITFKSHIDGSRHYFTPKSVLDTQYDLNSDIMMILDDLVALPNTDERIKTSIQRTT
FT                   KWAQEAINYHMEQKQKGIGTHQNIFAIIQGGTSKEFRKLSAQQLCDMSDFDGFAIGGLS
FT                   VGEPNEQMYETVEWTTQFMPKDKPRYLMGVGTPEDLIENIERGVDMFDCVMPTRNARNG
FT                   TLFTSFGKLNIKKAEFKDDANPIDNECSCYTCKNFSRAYLNHLFRAAEITYFRLASIHN
FT                   IHYYLNLMKQAREAILADNWSEFKKEFYVKRSK"
FT   gene            227540..228982
FT                   /locus_tag="Abu_0231"
FT                   /note="AB0228"
FT   CDS_pept        227540..228982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF02080 TrkA_C, score 41.5, E-value
FT                   2.7E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66506"
FT                   /db_xref="GOA:A8ERD2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD2"
FT                   /protein_id="ABV66506.1"
FT                   /translation="MPMKKILVILDGIVAKKLLQRIVEANTSDNSYDVIYINDVILPVQ
FT                   KPSNFTFYKFDPTSKSKLSMVLDKNIHTEVLMALNSKDEILNVIKNIREYKKNLQITIL
FT                   DYWGMKVSNDPMLNIYRGIDVLANGMVERLPNIPVLAQNIGLKQGEIMEIRVPFGSSYA
FT                   YRSIGSIEQKQWRIFGLYRNQKMIDINPTLVLKPNDLILVIGKPSILMNIYNAIGKTQG
FT                   QFPMPFGSKIYLYLDLYLENENSVRKAIDEAKYMNEKLKNSLLIVKVTRPTTVAIMDLI
FT                   KNELKHFPTIILQIDYANKGFVKILKEDSRKYNIGMLMLTSEMFKYKEFIKDTLFDLKI
FT                   PIFKFGKESLKAVKRTGVVLNDIKSYEQISPIVFDVSSQLKIKTKLFDLDPIGEKDGKI
FT                   TLVDHFENLAKLYNEKIEIVSSSENPIRELKKQKDMLQILPLKRKMFKKRFLFKIFNTN
FT                   SDVIAFDMNKFNQLLIPVSEDN"
FT   gene            228992..230122
FT                   /gene="aspB2"
FT                   /locus_tag="Abu_0232"
FT   CDS_pept        228992..230122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB2"
FT                   /locus_tag="Abu_0232"
FT                   /product="aspartate aminotransferase, aminotransferase,
FT                   classes I and II"
FT                   /EC_number="2.6.1.17"
FT                   /note="Pfam match to PF00155 Aminotran_1_2, score 82.4,
FT                   E-value 6.7E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66507"
FT                   /db_xref="GOA:A8ERD3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD3"
FT                   /protein_id="ABV66507.1"
FT                   /translation="MNFEKYPFEKLNELLKDIVPNEKYELSVLTIGEPKFETPQFIQDK
FT                   LKETSSFLRKYPSTIGEPFLRESMINFVKNRFNVSLKMSQIIPTFGTREVLFNFPQFAL
FT                   FDKKNPVIAFTNPFYQIYEGAAIASRAEVIYINLTKENNFKANLSDEELKRCDLVILNF
FT                   PNNPTSASMDIDELGIWVKKALEFDFILVNDECYSEIYFDENTKPASLLEASIKVGNSE
FT                   FKNVLVMNSISKRSSAPGLRSGFIAGDETILKDYLQYRTYIGCASPVPLQEAAAVAWND
FT                   QNHVAEFRKIYKRNFEIAQEILGIPTPEATFYIWLEVENDLEFTKNLYKEKNIKVLPGS
FT                   FLGRGGLGKEYVRIALVENEEKTKESLKRLKDFIDG"
FT   gene            230115..230699
FT                   /locus_tag="Abu_0233"
FT                   /note="AB0230"
FT   CDS_pept        230115..230699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66508"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD4"
FT                   /protein_id="ABV66508.1"
FT                   /translation="MDKEELFQARTNPDFLKYLNETRVNSIKAKDIALMYETLDSMLVL
FT                   DLDEEQINELYQEILKLAFENVEKIINKNKKLKLEDEHLFYARALYEHAIEKWSNENFD
FT                   GAKELLFVMVNLIEDELLQKALNVLIIFLSSKMELDEFYDSKVDLEKASDEKYGYFIVN
FT                   FNFDSQKYLKENKKVLEQEYENLKHLIVEHK"
FT   gene            230699..232006
FT                   /gene="murC"
FT                   /locus_tag="Abu_0234"
FT   CDS_pept        230699..232006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="Abu_0234"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Pfam matches to PF01225 Mur_ligase, score 101.8,
FT                   E-value 1.8E-027, and to PF02875 Mur_ligase_C, score 59.8,
FT                   E-value 8.3E-015, and to PF08245 Mur_ligase_M, score 17.8,
FT                   E-value 2.1E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66509"
FT                   /db_xref="GOA:A8ERD5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD5"
FT                   /protein_id="ABV66509.1"
FT                   /translation="MKVHFIGIGGIGLSALARFLNFDGHEVSGSDMKNSPITKALEDEG
FT                   IKVSCPQDASNIKDDFDLVIYSAAVTDENPELIQARLKQIRTLSRKEALPIILGDKKNY
FT                   CVAGAHGKSTTTAMLASILNSSALIGAISKDFGSNFRYVDKLVAFEADESDASFLLSNP
FT                   YCAIVTNAEPEHMEYYHYDYDKFYESYEKFLSLAKVKVVNGEDKDVAKLKIENATILYP
FT                   SKDIKNLCYTLKDNQPCTKFDLKDLGTFEVWGFGFHMATNASLAILAALNELDIETIRK
FT                   NLLNYKGIKKRFDIVQANEKFVVIDDYAHHPTEIEATMKSIELYDNLTNLNKRIVLWQP
FT                   HKYSRTSDNLEGFKKCFRRCDELIILPLWTVAGEKKIEIDFPKEFASYNPIFADRVVAT
FT                   KGKIELIKDDKIIRTYEEGIFLGVGAGDITYQLRLK"
FT   gene            complement(232015..232791)
FT                   /gene="dprA"
FT                   /locus_tag="Abu_0235"
FT   CDS_pept        complement(232015..232791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="Abu_0235"
FT                   /product="SMF protein, DNA processing chain A"
FT                   /note="Pfam match to PF02481 SMF, score 106.1, E-value
FT                   9.4E-029"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66510"
FT                   /db_xref="GOA:A8ERD6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD6"
FT                   /protein_id="ABV66510.1"
FT                   /translation="MIKTIDFRISELLSMKKYPSEIFYIGNCELLKKRKISIIGTRKPN
FT                   SYTKEFTHKLASKLSSNNICIVSGAAMGVDSIAHTGAKSNNTIAVVANGLDIRYPSINK
FT                   NLIIDIENNGLILSTYKEKEIARKYTFVLRNELVVALGEVLIVTQADLNSGSLTSVEFA
FT                   LNMNKKIYTLPHRLNESLGTQELVKNGLAEVIYDIDEFVENFTGNKNKKEQLDEVLEYC
FT                   KTSPNIEDAMQKYPNEILEYELDGKIKIENGKVFLN"
FT   gene            complement(232834..233913)
FT                   /locus_tag="Abu_0236"
FT                   /note="AB0233"
FT   CDS_pept        complement(232834..233913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF04748 Polysacc_deac_2, score 199.5,
FT                   E-value 7.2E-057"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66511"
FT                   /db_xref="GOA:A8ERD7"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD7"
FT                   /protein_id="ABV66511.1"
FT                   /translation="MNLKKIRLRKKLLQRYLKRKKLAQIFLLISLLLLLIPTISYFYIN
FT                   NESSSKEDTKLEQKATNEEVMKEVLTQLEISKKDILKENNIFSKEIDINHKILEKVKEI
FT                   KDNKKEYEQTTEIGEENIPLVEEKAAPIKKDTYVYNKKDKPKIAIIIDDVVSDSQKSKI
FT                   SNIGYPITMAFLPPTNTHKDSAKIAQNVPFYMIHFPLQASSAFKGEEINTLKITDSYET
FT                   IENRVKQLRNWYPNAKYTNNHTGSVFTENDEAMDKLFKALVKYNFIFVDSKTSAKSVGQ
FT                   KYANKYNLPYISRNIFLDNEKSYEYIKAQLIKTVELAKKHGYAVAIGHPYDITLKVLKE
FT                   SKHLLNDVDPILVNKLPHL"
FT   gene            complement(233955..234977)
FT                   /gene="ilvC"
FT                   /locus_tag="Abu_0237"
FT   CDS_pept        complement(233955..234977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="Abu_0237"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="Pfam matches to PF07991 IlvN, score 382.8, E-value
FT                   4.8E-112, and to PF01450 IlvC, score 286.9, E-value
FT                   3.6E-083"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66512"
FT                   /db_xref="GOA:A8ERD8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERD8"
FT                   /protein_id="ABV66512.1"
FT                   /translation="MAINVFYDKDCNIDLIKSKKVAMIGFGSQGHAHAENLRDSGVEVI
FT                   VGLRKDGSSWKKAEAKGFKVLTVAEATKIADVVMILLPDENQADIYANEIKPNLKDGAY
FT                   LAFGHGFNIHYKRIIPCSKTNVMMIAPKAPGHTVRSEFVKGGGIPDLIAVHQDASGDTK
FT                   QVALAYASAIGGGRTGIIETTFKDETETDLFGEQAVLCGGATALVQAGFETLVEAGYEP
FT                   EMAYFECLHELKLIVDLMYEGGIADMRYSISNTAEYGDYVSGPRVINDESRAAMKQILK
FT                   EIQNGVFAKDFILEGQAGYPRMNAERAYTKASLLEQTGVKLRNMMPWIASKKIVNQETN
FT                   "
FT   gene            235102..236955
FT                   /gene="rnr"
FT                   /locus_tag="Abu_0238"
FT   CDS_pept        235102..236955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="Abu_0238"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="Pfam match to PF00773 RNB, score 249.9, E-value
FT                   4.9E-072"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66513"
FT                   /db_xref="GOA:A8ERD9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERD9"
FT                   /protein_id="ABV66513.1"
FT                   /translation="MLKELFIKIQTNLKDYTKEELIEIEKFIKEEIVLRNTNNEFELNS
FT                   KYKIATLKIEKNFAILEDLVTPLKNIKIELDELNGAFDGDLVIAKRVFNPKSKIKAKII
FT                   KIISSKKAEILVYVKDRAFYTVKENIRIENKKALTFNENDVLVVDNKSFEVIKNVGNIS
FT                   DSKVDEFISLYLYKELYRLEKLDFEIDAKMDDKNQRVDLRELPFCTIDPNSAKDHDDAI
FT                   YFDKDENILYVAIADVSYFVKEGSDLDKLAFKKSTSIYLPSKVLPMLPPILSEEMCSLK
FT                   EGLDRYSFVFKLHLDLEKLSVKKAELFEAVINSHKNFSYGRIDRVIEGHLDLYSKLDKE
FT                   IFDYLIPLYEITKKFRKKRLEKGYDFRTTENRLKLRNSELESIEVETSTASHQLIEECM
FT                   LLANIEASKKVSNIAIFRVHEEPSFKAISKLVDDVNILGVNVKLQKDVHETITHIQKSA
FT                   KTSMLSAEVDELIIQSQTQAKYSSKNLGHFGLGFSSYSHFTSPIRRYSDLVLHRILKTK
FT                   QTPKNIDEICEHISLNERKVDQLVWDFEDRKYARWANKHIGEELKVKVVDIEKAKAVCY
FT                   EKIIGMKVVLENYKGQKLFSKMRVKIKSADLVTKVIVATIV"
FT   gene            complement(236945..237322)
FT                   /locus_tag="Abu_0239"
FT                   /note="AB0236"
FT   CDS_pept        complement(236945..237322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0239"
FT                   /product="hypothetical protein (DUF180 domain protein)"
FT                   /note="Pfam match to PF02623 DUF180, score 26.4, E-value
FT                   5.4E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66514"
FT                   /db_xref="GOA:A8ERE0"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE0"
FT                   /protein_id="ABV66514.1"
FT                   /translation="MYKVVLPILGFENVETLEIEKLDDLMSFLILGEKTKMSVVNIDGL
FT                   SKVSFDFQIDEDVLEKLKIKSRDDFNIYFSVVSQNPVEYSIINLVSPIFINEKEKLIGQ
FT                   YVTSEKVEPYLASINKCSTIQ"
FT   gene            237387..238367
FT                   /locus_tag="Abu_0240"
FT                   /note="AB0237"
FT   CDS_pept        237387..238367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0240"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="2.7.7.7"
FT                   /note="Pfam match to PF06144 DNA_pol3_delta, score -22.1,
FT                   E-value 6E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66515"
FT                   /db_xref="GOA:A8ERE1"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE1"
FT                   /protein_id="ABV66515.1"
FT                   /translation="MYKNEFDNYLKQNKRFKTYMFYGQSTFLVEQYSLSIARMFGQDDE
FT                   IEKLYFEEYDFKYAKDKLLQSSLFSSNNILFIKIDKKIPKRELDVLIEACNANPDSTLV
FT                   IACMGDSDFKTMETSFSLKTNSACVRFFQPTDLEATKFLEYEAKMLQIQYEVSALNHLY
FT                   FMHKNDLALCVNDLKKLAILDELITINIVDTHCFGIGSVNFEDFLYDLLAGKDISSDLS
FT                   SILEEGMNEVFLLTQVTSFIQQLFMISSYARTLGQPNPKEILGYIPPKNIWEKKSKLAI
FT                   NIKPEVFQNMLEYLLDIELDFKTSKVENQNLYLQATLRKFTALFR"
FT   gene            238455..238811
FT                   /gene="rpsF"
FT                   /locus_tag="Abu_0241"
FT   CDS_pept        238455..238811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="Abu_0241"
FT                   /product="30S ribosomal protein S6"
FT                   /note="Pfam match to PF01250 Ribosomal_S6, score 128,
FT                   E-value 2.4E-035"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66516"
FT                   /db_xref="GOA:A8ERE2"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE2"
FT                   /protein_id="ABV66516.1"
FT                   /translation="MSKIKHYETMFILKPTLTEEETVAQIDGIKALIEKNGGEISSTDN
FT                   VGIRELAYEIEKCKRGYYYVIYFKGNPSGIAEIERNYRNNENLIRFIFIKYDTKKEIAS
FT                   WTKMSDEAAKKATK"
FT   gene            238832..239344
FT                   /gene="ssb"
FT                   /locus_tag="Abu_0242"
FT   CDS_pept        238832..239344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="Abu_0242"
FT                   /product="single-strand DNA binding protein"
FT                   /note="Pfam match to PF00436 SSB, score 90.8, E-value
FT                   3.8E-024"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66517"
FT                   /db_xref="GOA:A8ERE3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE3"
FT                   /protein_id="ABV66517.1"
FT                   /translation="MYNKVIMVGNLTRDIELRYLPSGSAIAKSAIATSYKYKSTTGEQK
FT                   DEVCFLDFNIFGRSAEVANQYLKKGSKVLLEGRLVFEQWTAQDGSTRSRHSLRVDAMKM
FT                   LDSKGSSEFAGDAQGYSPQQGSYNQPTNQYDEPTSFDNSYGGMNQQKQKVEQRIPEIDI
FT                   DEDEIPF"
FT   gene            239359..239625
FT                   /gene="rpsR"
FT                   /locus_tag="Abu_0243"
FT   CDS_pept        239359..239625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="Abu_0243"
FT                   /product="30S ribosomal protein S18"
FT                   /note="Pfam match to PF01084 Ribosomal_S18, score 85,
FT                   E-value 2.1E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66518"
FT                   /db_xref="GOA:A8ERE4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERE4"
FT                   /protein_id="ABV66518.1"
FT                   /translation="MAERRKYGKKYCKYTEMKVDFIDYKNTELLKLSMSERGKIMPRRL
FT                   TGNSKNAQEMVEKAIKRARHMALVPYIVDTKNITDSAYARSFY"
FT   gene            239698..239898
FT                   /locus_tag="Abu_0244"
FT                   /note="AB0241"
FT   CDS_pept        239698..239898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66519"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE5"
FT                   /protein_id="ABV66519.1"
FT                   /translation="MLNNNLKTALKMRFEYYNLYEGKEEKWHEKYKNHDLYEVVVKSFK
FT                   YDFKEIGEMLPKLLKEFEKNL"
FT   gene            complement(239893..241296)
FT                   /gene="cysS"
FT                   /locus_tag="Abu_0245"
FT   CDS_pept        complement(239893..241296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="Abu_0245"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="Pfam match to PF01406 tRNA-synt_1e, score 541.3,
FT                   E-value 9.1E-160"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66520"
FT                   /db_xref="GOA:A8ERE6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERE6"
FT                   /protein_id="ABV66520.1"
FT                   /translation="MNTLHIFDSVKKEKVEFKPIQEGKVKIYVCGPTVYDDSHLGHARS
FT                   AIAFDLLHRVLKVNDYEVTMTKNFTDIDDKIIKKMYETNKTLENITNQYINAYKADMKA
FT                   LNILDNTIEPKATENLEVMKEMISNLISKDVAYKTSDSVYFDTSKDNLYGTLSHKSNDE
FT                   NSQARVEENQEKRNSADFALWKFEKANDVSFDAPFGKGRPGWHIECSAMIEKHLAYKDS
FT                   PYQIDIHAGGADLLFPHHENEAAQTRCSSGQNLAKYWMHNGFVNINGEKMSKSLGNSFF
FT                   LKDVLKSYSGEVIRFYLMSTHYRADLSFNEEDLIASKKRLDKIYRLKKRVYGIEDSSVN
FT                   KKFKEDILNALNDDINTSIALSVIDEMINSANDKLDSNPKDKNLKKELISNINFIEEVL
FT                   GIGGNDAYAYFQFGINESTKEKIESLILKRNEAKKTKDFQTADKLRDELSSMDISLMDT
FT                   VNGTVWEKL"
FT   gene            complement(241301..242476)
FT                   /gene="nusA"
FT                   /locus_tag="Abu_0246"
FT   CDS_pept        complement(241301..242476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="Abu_0246"
FT                   /product="transcription termination factor NusA"
FT                   /note="Pfam match to PF08529 NusA_N, score 4.3, E-value
FT                   6.3E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66521"
FT                   /db_xref="GOA:A8ERE7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE7"
FT                   /protein_id="ABV66521.1"
FT                   /translation="MDKIIDILDSIAYEKGLKIDDVENSLKEALIKTAQRMVDTTLIFD
FT                   ANIDRANKKLELFQKIEVVSKDDDRLKEGSLTKEGTPINPENYISLEEAKEINSDLDIG
FT                   DFMSYELEFENMGRNAATILLSNFEFRLQRFVEENIVGKYKEKVGKTVSGTVTRIDKSD
FT                   NTYIEIGEIKGILQRKSRIKGEFFKVGDVVKAVVKSVNIDKTNGLLVEISRTSPKFLEN
FT                   LLVLEVPELKDKKIAIEASARIPGTRSKIALSTIDAQIDPIGAVVGVKGVRIGSVSKQL
FT                   NGENIDCVEYSEIPEIFISRALSPAIVHSVKIEKNPENGEKGKAVVTIPSDQKSKAIGK
FT                   AGLNIRLASMLTKYDIELIEIGSKTPTLNNETNVQVDEKTTDTASLEALFK"
FT   gene            242630..242872
FT                   /locus_tag="Abu_0247"
FT                   /note="AB0244"
FT   CDS_pept        242630..242872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66522"
FT                   /db_xref="InterPro:IPR040748"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERE8"
FT                   /protein_id="ABV66522.1"
FT                   /translation="MELLLARNELNEKPKKVQLDKIKEDLEKDGQKIFYFDKDNSHKDM
FT                   MALVSALEKNGLNVYFREVRYGLADDEYMYEVHAL"
FT   gene            242894..244204
FT                   /gene="miaB"
FT                   /locus_tag="Abu_0248"
FT   CDS_pept        242894..244204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="Abu_0248"
FT                   /product="tRNA-methylthiotransferase"
FT                   /note="Pfam matches to PF00919 UPF0004, score 153.2,
FT                   E-value 6.1E-043, and to PF04055 Radical_SAM, score 110.7,
FT                   E-value 4E-030, and to PF01938 TRAM, score 65, E-value
FT                   2.2E-016"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66523"
FT                   /db_xref="GOA:A8ERE9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERE9"
FT                   /protein_id="ABV66523.1"
FT                   /translation="MSSNKKLFIQTLGCQMNDTDSQHIQAELEKHKGYVTTQNIEDADL
FT                   IIINTCSVRERPVQKLFSEIGQFNKKKKEGAKIGVCGCTASHLGQDIIKRAPYVDFVVG
FT                   ARNISKIKDVVDVKGAVEVSIDNDESTYEFSTAKTNKYRASVNISVGCDKKCTYCIVPS
FT                   TRGEEISIPPEMIVEQVRKSVEQGAVEVMLLGQNVNSYGRKFSDKREKYTFTKLLQDVS
FT                   KIDGLERIRFTSPHPLHMDDEFIEEFAKNPKISKCIHMPLQSGSTSVLKAMKRGYSKEW
FT                   FLNRASKMRELVPNLRITTDIIVAFPGETQEDFLDTLDVVEQVKFDQIFNFKYSPRPGT
FT                   EALNLKDKELPDEIGSQRLIDLIELHKRYLEESMPKLIGETLNILVESLKPNGEVCGYT
FT                   DNYLQVFAKGSDELLGKFVNVKITDVTRTSLKGEVVN"
FT   gene            244207..244821
FT                   /locus_tag="Abu_0249"
FT                   /note="AB0246"
FT   CDS_pept        244207..244821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0249"
FT                   /product="putative lipoprotein"
FT                   /note="Pfam match to PF04028 DUF374, score 99.1, E-value
FT                   1.2E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66524"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF0"
FT                   /protein_id="ABV66524.1"
FT                   /translation="MFRYFKLNILPHLLYYLVRLIYATNKKVYHHPKNDNKEAMIICMW
FT                   HGDLMSQPYNYFAFRKNGIVKAMISHNKDGEIITKLVSNFKIGAVRGSTSKGAAKVMIS
FT                   AIKELKDGNDIAITPDGPRGPRYSIADGIVAIAQKSEKNIVCFNTIPTKYWQFNSWDKF
FT                   ILPKPFGRIDFYISEPYDIKDMEFEEAKVFIKEKMLIHSIA"
FT   gene            244832..246400
FT                   /locus_tag="Abu_0250"
FT                   /note="AB0247"
FT   CDS_pept        244832..246400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66525"
FT                   /db_xref="GOA:A8ERF1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF1"
FT                   /protein_id="ABV66525.1"
FT                   /translation="MFTKESLYINVIKYNNQLKLEYKKLRNDEVIKSDNSTFLVDNDIL
FT                   PQNIVQKINTLQKEDDFSYISTLLLSDTTKLIPKSLSSKIKDCEIVEFNKDYDIVVLKT
FT                   TLFETQNYFGKTGIDYIYSAFHIMNQHIERNKSKNELLFFIYNNKAFVLIVDKLGNIVY
FT                   NETIDLLTFDSVKRTHFYEDDLEGQKLFDELYFLELTQTIQKILDDLYSKRKDEVFVQK
FT                   VSILHVLKILTKEQLSQLSQELLLKVDDYSVNVDEEIFKLAKQKDSKNSFIKHRKKKKR
FT                   KDPRYIFLIILLTLLSLGFYKIYSTIDFNPILEKFNIKIGHQKVLESLPNHVILNDKIK
FT                   KRVKAIFDSVPNNVAVKEVNIDENNLELKVFSIQEENLNLLNLALNSLYVNNESKIITP
FT                   NAKTNFDAVVVSKNEIEINTEYDNSTKDYLTDEQFNIESVTEQLKILMPETAIVKYIET
FT                   IDAKKVEVFSYKVAILITEPNEFFELINKLNEELYSINLKYPISFKRTDNGIEVEFNLE
FT                   FNQLK"
FT   gene            complement(246413..247474)
FT                   /locus_tag="Abu_0251"
FT                   /note="AB0248"
FT   CDS_pept        complement(246413..247474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF04055 Radical_SAM, score 77.9,
FT                   E-value 2.9E-020"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66526"
FT                   /db_xref="GOA:A8ERF2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF2"
FT                   /protein_id="ABV66526.1"
FT                   /translation="MNIIEKLENNERLQYEDAIKLYDLDLFTLATYANKIRTEKHGKKT
FT                   YFNINRHINPTNICKDVCQFCAYSASRKNPHQYTMSHEEILEIVKNSSKNNIKEVHIVS
FT                   AHNPHTGLKWYMDVFKLIKENYPNIHVKALTAAEIHFLSTEYKLSYQEIIDMMIENGID
FT                   SMPGGGAEIFDEKVRKRICGGKVTSAQWLEIHKLWHQKGRKSNATMLFGHIESREHRID
FT                   HILRLRNLQDETGGFNAFIPLVYQTENNYLKVKEALTGQEILKTYSIARILLDNIPNIK
FT                   AYWATSTVKLALIAQEFGANDVDGTIEKEAIQSAAGAKSANGIAQSEFVELIKNSGFIP
FT                   VERDSIYNELKVW"
FT   gene            complement(247480..247797)
FT                   /locus_tag="Abu_0252"
FT                   /note="AB0249"
FT   CDS_pept        complement(247480..247797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66527"
FT                   /db_xref="GOA:A8ERF3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF3"
FT                   /protein_id="ABV66527.1"
FT                   /translation="MSYEVRKLPKKTVIIISLIVSIAIVIFLVQKTLKEQRFAEILATL
FT                   GHTNITELKIINKLNVEDVQTKLKSNVFKVKFFDKDLNQTCIGFLHKEKDDLYSKDFDC
FT                   K"
FT   gene            complement(247802..248440)
FT                   /gene="cynT2"
FT                   /locus_tag="Abu_0253"
FT   CDS_pept        complement(247802..248440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT2"
FT                   /locus_tag="Abu_0253"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="Pfam match to PF00484 Pro_CA, score 166.3, E-value
FT                   7.1E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66528"
FT                   /db_xref="GOA:A8ERF4"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF4"
FT                   /protein_id="ABV66528.1"
FT                   /translation="MLINDLIKGNKKFREASFSKYETDLKQLVKTGQKPEVLFIGCSDS
FT                   RVTPDLMLDTKPGDMFILRNVGNFVPPYNPDNDYHGSSAAIEYAVNVLNVKHIIVCGHS
FT                   HCGACKSLYQDLTDTPDLVNVKKWLELGKKAKEYTLLAIQDKSDEENLYRTTEKISIVY
FT                   QMENLLTFPYIEERIKNGELQIHGWYYKIEDGSIEYYDGEECSFKPLSE"
FT   gene            complement(248427..249533)
FT                   /gene="bioF"
FT                   /locus_tag="Abu_0254"
FT   CDS_pept        complement(248427..249533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="Abu_0254"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="Pfam match to PF00155 Aminotran_1_2, score 78.2,
FT                   E-value 1E-021"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66529"
FT                   /db_xref="GOA:A8ERF5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF5"
FT                   /protein_id="ABV66529.1"
FT                   /translation="MYSKELESIKKSNRFRTREIFDENIVDLASNDYLALSSNKTLFQK
FT                   TYENILNLNSFSPKASMLVNGYSKIHKKFEDKLCSTNGFESAITVGSGFLANISMIEAL
FT                   VRKNDTLFIDEEYHASGILATKLLKPEQVVVFNHNDYLDLEKKILDNKRVGRTIIAIEG
FT                   IYSMGGDLAPFEIFEIATKYKSLLIVDEAHSSGVIGKNLLGIFDYYDIKPNNYHIKMGT
FT                   LGKAYGSYGAYILASKDIIEFLVNRAKPIIYSTAPSLFDTALAIESLEYIIENKKILKS
FT                   KIEENLNIIYEILGIKSQSLIIPIVIGDNKKVIEIQKVLKEKGFLVGAIRQPTVKSAII
FT                   RLIAKIDIERNDLIEVCNLIKGFRNVNK"
FT   gene            complement(249711..250043)
FT                   /locus_tag="Abu_0255"
FT                   /note="AB0252"
FT   CDS_pept        complement(249711..250043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF02021 UPF0102, score 54.7, E-value
FT                   2.8E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66530"
FT                   /db_xref="GOA:A8ERF6"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERF6"
FT                   /protein_id="ABV66530.1"
FT                   /translation="MSKEKGDIAEKKAISFLEKSNFEIVEKNFYAKKLGEIDIIAQRNK
FT                   IYHFIEVKSANDYETAINNITSQKLSKIKRSVDFYIQKNNLNISYSIDVIIVVDDKIEL
FT                   LENITM"
FT   gene            complement(250048..250248)
FT                   /locus_tag="Abu_0256"
FT                   /note="AB0253"
FT   CDS_pept        complement(250048..250248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF02597 ThiS, score 58, E-value
FT                   2.9E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66531"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF7"
FT                   /protein_id="ABV66531.1"
FT                   /translation="MKLIINGENKEFTDNLTLNDIIKNLQVENKVMAAAVNMNIVKKQD
FT                   WNSFIPKENDSIELLNFVGGG"
FT   gene            complement(250310..251035)
FT                   /locus_tag="Abu_0257"
FT                   /note="AB0254"
FT   CDS_pept        complement(250310..251035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0257"
FT                   /product="OmpA domain protein"
FT                   /note="Pfam matches to PF00691 OmpA, score 77, E-value
FT                   5.3E-020, and to PF05433 Rick_17kDa_Anti, score 42.6,
FT                   E-value 1.2E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66532"
FT                   /db_xref="GOA:A8ERF8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF8"
FT                   /protein_id="ABV66532.1"
FT                   /translation="MKYINFKFLLSSTIIASLLVGCAQKTGYQTYDNNQNAIIGTTLGA
FT                   IAGIVLGNNIGGGNKGRNKVIGAVAGAAIGGAIGYSMDKQAQEVAQSLNTNVNNNPQAV
FT                   LDPNQDLIVSNTDNYVKIMFRDSMMFETNSANPTYSAQTKISKIYSVLQKYPNTLVQVV
FT                   GHTDSRGTHTYNQTLSEQRATNVGNIIYNSGVSNQIFSRGCSFDKPVALNNSESNMALN
FT                   RRVEVYLYPNQESVFDVCR"
FT   gene            251161..252636
FT                   /gene="pyk"
FT                   /locus_tag="Abu_0258"
FT   CDS_pept        251161..252636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="Abu_0258"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="Pfam matches to PF00224 PK, score 492.1, E-value
FT                   1.2E-147, and to PF02887 PK_C, score 33.5, E-value
FT                   1.8E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66533"
FT                   /db_xref="GOA:A8ERF9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERF9"
FT                   /protein_id="ABV66533.1"
FT                   /translation="MKKRTKILATLGPASHTIEMIEGLIKAGANMFRLNFSHGSHEYHL
FT                   ETLNNIKTAMKNTGKTVGILQDISGPKVRIGDLKEPFSLTRGDILTFVKDEIVGYKKAD
FT                   KEYIVSINYPDILGKIKVDEYIYLYDGTIRAKVIKVGDEVQARIENNGTLSSKKGVNFP
FT                   NTVIDIDVITKKDEKDIAWGIENEVDYFAISFVQNARDMRRARSLLNGYRGKLIAKIEK
FT                   FDAVANIDEIIEASDGLMVARGDLGIEVPYYDVPTIQKMLIKKANLKGIPVITATQMLL
FT                   SMTQNERATRAEISDVANAVLDGTDVVMLSEESAVGEDPVNVVDTMHNIIAKTEGIYDY
FT                   DKQYKMSYLDEFDVIQATVTKLADDLGADGILALTSSGKSAVKMSRYRPKTPIYTFTHK
FT                   KKVLNSLTAIWGIEPVAVIKEAQASKMFQKMLKNLDQKGILNRKGIYVATVGYPVGMPR
FT                   STNTIKILTPSEIEYYFNFEANRKKEKEEKKSK"
FT   gene            complement(252655..253845)
FT                   /gene="argD1"
FT                   /locus_tag="Abu_0259"
FT   CDS_pept        complement(252655..253845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD1"
FT                   /locus_tag="Abu_0259"
FT                   /product="N-acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="Pfam match to PF00202 Aminotran_3, score 283.1,
FT                   E-value 5E-082"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66534"
FT                   /db_xref="GOA:A8ERG0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG0"
FT                   /protein_id="ABV66534.1"
FT                   /translation="MENLEQMDKEYVLHTYARNYVNFKKGINATLFDDNNKDYIDFTSG
FT                   IGVVSVGHGNKQVAQKIFEQASNLTHTSNLYAIEPQAKLAKKIRELSGYDVRTFFSNSG
FT                   AEANEGAIKIARTYGETQFENKKYKIITLENSFHGRTITTVKATGQSSFHQNKFAPYPE
FT                   GFSFNAIDDVYNAIDNETVAVMIELVQGEGGVFPFPKDKIQELAKFLKDNNILLIVDEV
FT                   QTGIFRTGEFLASNLYEIEPDIITLAKGLGGGVPIGAVLTTHKDIWGAGDHGSTFGGNY
FT                   LVTSTGLEVLNILEELKDSGRLDETIIHFTKKLDELYEKNKDIFITHVGLGLMRGLRVK
FT                   DGDTLALLIKTAFDCGVMVLKSGNNTLRFLPPLTISKAEIDEGFKRLQTALDKIKK"
FT   gene            complement(253905..256226)
FT                   /gene="cti"
FT                   /locus_tag="Abu_0260"
FT   CDS_pept        complement(253905..256226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cti"
FT                   /locus_tag="Abu_0260"
FT                   /product="fatty acid cis/trans isomerase"
FT                   /note="Pfam match to PF06934 CTI, score 688.1, E-value
FT                   5.9E-204"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66535"
FT                   /db_xref="GOA:A8ERG1"
FT                   /db_xref="InterPro:IPR010706"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG1"
FT                   /protein_id="ABV66535.1"
FT                   /translation="MKFQIVLIFIFSLFFAACSVKPLEPVKYDKVDKKISFSKDIKPIL
FT                   DSRCVSCHSCYNSPCQLKLDSFDGLDRGSSKADVYANRINAANPTRLFVDALNTSSWRK
FT                   KGFSSMVDKLEESNASIMMQYLFQKEVNPLNLGAYSPETDELTCVKNKDELEEFFDDNP
FT                   HKGMPYGFPALQKDEYNLLMTWLDSGAIDDTKKGVFTAFENAQIKKFEDFLNTPDIKHK
FT                   VTARYIYEHLFLAHIYFDEKSGNFFELIRSSTPTGQKPKIIPTRFPYDEVKEPFYYRLQ
FT                   KIESTIVHKTHMVFKIDDEKLKFYNDIFIKPLWEEEPYIPSYDISLAPNALEVFKQIPA
FT                   SSRYKFLLEDIYFIINTFIKGPVCKGQIALNVIQDHFWVMFLNPNYDLSVKDKNFLKNN
FT                   FKALSIPNQLGEDPSLYETFKNLGREEDTKKYEEYRAKIYKKYYPDGMKLEYIRKSEKN
FT                   DSILTVYRHFDSASLHYGALGSIPKTLWVIDFPLLERIYYSLVAGFDVFGNTAHQLLVR
FT                   THMDRLRVEGESNFLEFLPQKSRLNYFNSWYEGWLAQYLTVYTPSNNETNIKYYSTDYK
FT                   YEFVNMVLDYTNTKRDHINFLENWYKPTPLKKVYNTKKEIEDTLKSLATPNSVDVIKHF
FT                   TQRDANSILIKIEMNNGENLIYSMVINRWHKNVALMFDEDSRLDPTKDDIDFIEGFISS
FT                   YPNMFVVVKQNDLGDFFDLIKNYSKHIEDKEKIKDYVINRANPQFWTVYDWFNDEFKKS
FT                   NPLEYGLFDLNRYYKEAIIE"
FT   gene            256322..257209
FT                   /gene="pyrB"
FT                   /locus_tag="Abu_0261"
FT   CDS_pept        256322..257209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="Abu_0261"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="Pfam matches to PF02729 OTCace_N, score 168.9,
FT                   E-value 1.1E-047, and to PF00185 OTCace, score 72.9,
FT                   E-value 9E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66536"
FT                   /db_xref="GOA:A8ERG2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERG2"
FT                   /protein_id="ABV66536.1"
FT                   /translation="MQHLIRTSDFTKEEILDIFEDARGFLDFKPCEILKGKIIVTLFFE
FT                   NSTRTRSSFEIAAKRLGAEIVNLDVGTSSTKKGETMYDTVANINAMGPDAIVIRHSECG
FT                   LPESLIGYVDCPIINAGDGRHSHPTQALLDLFTIYEHFNGQTEGKKIAIVGDVRNSRVA
FT                   GSNRRLLPRFGIDVNLVAPDCFKYEGNEFKQFNTIAEVIDDMDVVMSLRSQLERHNITY
FT                   FESLQEYAKDFCITPELMEGRDFLLLHPGPVNRNIDISDEVLKDPRCKVLEQVRNGVAV
FT                   RAAILKKLILNNKN"
FT   gene            257206..258165
FT                   /gene="pabB"
FT                   /locus_tag="Abu_0262"
FT   CDS_pept        257206..258165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="Abu_0262"
FT                   /product="para-aminobenzoate synthase, glutamine
FT                   amidotransferase component I"
FT                   /EC_number="2.6.1.85"
FT                   /note="Pfam match to PF00425 Chorismate_bind, score 66.3,
FT                   E-value 3.7E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66537"
FT                   /db_xref="GOA:A8ERG3"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG3"
FT                   /protein_id="ABV66537.1"
FT                   /translation="MNKKIIEEQINKFGFEKEPFLFLISYDFKKFYIEKLSNLSNQIKY
FT                   EINQKETKSNKRVDLEKFPITFEEYKKKFDVLQEEIKEGNSYLLNLTAKTKIKTALNLE
FT                   EIYKNTKSMFKLKVHTKDDNFVCFSPEKFVEIKNSKIFTYPMKGTIDANIKDAKIKILE
FT                   NQKELAEHTMVVDLLRNDLGIIGSNVKVEDFRYVDIINAGNKELLQVSSKISATLQSNW
FT                   LETLGTTIISLLPAGSITGTPKKKTVEILKNVEKYEREFYTGIFGIFDGNSFDSYVLIR
FT                   FIEEKNGELFYKSGGGITCDSDAFLEYEELLDKIYLPF"
FT   gene            258228..258785
FT                   /locus_tag="Abu_0263"
FT                   /note="AB0260"
FT   CDS_pept        258228..258785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0263"
FT                   /product="isochorismatase hydrolase"
FT                   /note="Pfam match to PF00857 Isochorismatase, score 12.7,
FT                   E-value 1.8E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66538"
FT                   /db_xref="GOA:A8ERG4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG4"
FT                   /protein_id="ABV66538.1"
FT                   /translation="MKQTALLLVDFQNDYFSTFEGAKFELEGTEKASSNASKILEFFRK
FT                   NEGKIIHIKHESAKGASFFEIGTQGVNIHKSVEPKEDEIVVTKNFPNSFKDTNLKEILD
FT                   EINIKSLIIVGAMSHMCIDATTRAAKDFGYECTVISDATATRDLQFGDIVVPSKYVHAS
FT                   FMAALEFAYAKIKTTTEILKGF"
FT   gene            258790..259461
FT                   /locus_tag="Abu_0264"
FT                   /note="AB0261"
FT   CDS_pept        258790..259461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0264"
FT                   /product="two-component response regulator"
FT                   /note="Pfam match to PF00486 Trans_reg_C, score 21.3,
FT                   E-value 3.2E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66539"
FT                   /db_xref="GOA:A8ERG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG5"
FT                   /protein_id="ABV66539.1"
FT                   /translation="MKLSNLLVLYVYDKKADEEIVTLLNKEFKKVFLAANFKEAQNSYK
FT                   KYSPCIIIIEDTFKDRKMVDYLQEIRKIDMKTAVIILTNNETNLYSLELIELYITKYII
FT                   TPYKEEVLYSSLLKCLDVIESRIYSNVKLKDNVFFNFQTQSIINEGEIIILNKKETILM
FT                   NLFIQNPNRVITYEELEYHIWNGEVTLAALKSLIRDFRKKTYKTILKNYSGIGYKLNLE
FT                   K"
FT   gene            259478..260056
FT                   /locus_tag="Abu_0265"
FT                   /note="AB0262"
FT   CDS_pept        259478..260056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0265"
FT                   /product="conserved hypothetical protein, putative
FT                   para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66540"
FT                   /db_xref="GOA:A8ERG6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG6"
FT                   /protein_id="ABV66540.1"
FT                   /translation="MESIKYFETIKCEDFEVFNLDYHQKRVANTIGLNINLQEYINPIS
FT                   EELLRCKLIYDENGVVDVLYFPYKKREIKSFKIIFDNEIEYSKKYLNRAKLDELYEKRD
FT                   DCDEVIIIKDGIVTDTTIANIAIFYENSWITSKNCLLGGTTRARLLEEKKLFEKDITLD
FT                   MLKNASKVALMNAMIGFDEIKNFKIKEEI"
FT   gene            complement(260053..260607)
FT                   /gene="phnA"
FT                   /locus_tag="Abu_0266"
FT   CDS_pept        complement(260053..260607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="Abu_0266"
FT                   /product="phosphonoacetate hydrolase"
FT                   /note="Pfam matches to PF03831 PhnA, score 93.1, E-value
FT                   7.7E-025, and to PF08274 PhnA_Zn_Ribbon, score 43, E-value
FT                   9.3E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66541"
FT                   /db_xref="GOA:A8ERG7"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG7"
FT                   /protein_id="ABV66541.1"
FT                   /translation="MSVEQELINRSESSCELCKSPNDLSVYEISPSDGSADQCVLLCAK
FT                   CKEQFEDDSKIDANHWFCLNDSMWSEIPAVKVATYRMLKKLGNQDSLDMMYLEDEEKAW
FT                   ADAGISAIDDSIVHKDSNGVILQAGDTVTIIKDLEVKGAGFTAKRGTAVRNISLTSNPE
FT                   QIEGRVNGVKIVLLTCFLKKS"
FT   gene            260665..261156
FT                   /locus_tag="Abu_0267"
FT                   /note="AB0264"
FT   CDS_pept        260665..261156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0267"
FT                   /product="conserved hypothetical protein, predicted
FT                   metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66542"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG8"
FT                   /protein_id="ABV66542.1"
FT                   /translation="MKYLSHYPKHLQEQVQSLCEKNQLTSYIKSKYPSSHSYTSDKALY
FT                   DYVMDFKNEYFKKYQISKVLYDGKINVINNALGMHTFVSRVQGGKLKSKNEIRVATIFK
FT                   NMPEEFLKMIVVHELSHFKEKEHNKSFYDMCCYMMPNYHQMEFDLRVYLTHIDKFGKIY
FT                   "
FT   gene            261177..261926
FT                   /locus_tag="Abu_0268"
FT                   /note="AB0265"
FT   CDS_pept        261177..261926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0268"
FT                   /product="conserved hypothetical membrane protein,
FT                   predicted permease"
FT                   /note="Pfam match to PF01925 DUF81, score 163.5, E-value
FT                   5E-046"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66543"
FT                   /db_xref="GOA:A8ERG9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERG9"
FT                   /protein_id="ABV66543.1"
FT                   /translation="MEFTVEIFLLLFFVAFIAGLIDTIAGGGGLLTIPTLLYVGISPAA
FT                   ALATNKLQATFGSFTAAMYFIRKKMVNIKEIKLMLIFTFLGAILGVFTLLQIDASILKQ
FT                   VIPILLIIIGFYFLFSPSVGAIDKEKRISIIVFSFTLAFGVGFYDGFFGPATGSFFAIG
FT                   FIALLGFNLTKATAHAKVLNFVSNISSLCFFMFFGKIYWSIGLCMGVGQICGALIGARL
FT                   VLKNGQKIIRPIIVIISFAISIKLFFS"
FT   gene            261999..262565
FT                   /locus_tag="Abu_0269"
FT                   /note="AB0266"
FT   CDS_pept        261999..262565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0269"
FT                   /product="conserved hypothetical membrane protein, HPP
FT                   family"
FT                   /note="Pfam match to PF04982 HPP, score 110.5, E-value
FT                   4.4E-030"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66544"
FT                   /db_xref="GOA:A8ERH0"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH0"
FT                   /protein_id="ABV66544.1"
FT                   /translation="MKRFFKQFKKINSENLDKSNMFWSWIGSFLGIFAISYFHKNFLDD
FT                   TDLTLVLGSFGASAVLIYGAVNSPLAQPKNLIGGHIISAIIGVISFKLFSQNMFFATAF
FT                   AVSTSILVMQLTLTLHPPGGATALIAVIGSEQIHELGFFYVLIPVTSGAFILLIIAMIV
FT                   NNIPNNRAYPESLKIFLDKHFSRKK"
FT   gene            complement(262568..263773)
FT                   /locus_tag="Abu_0270"
FT                   /note="AB0267"
FT   CDS_pept        complement(262568..263773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0270"
FT                   /product="hypothetical periplasmic protein"
FT                   /note="Pfam match to PF03734 ErfK_YbiS_YhnG, score 49.8,
FT                   E-value 8.6E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66545"
FT                   /db_xref="GOA:A8ERH1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH1"
FT                   /protein_id="ABV66545.1"
FT                   /translation="MLRKILLILPIFCTLFVYAQDEKYTISVCTTSNLENALACKKNIF
FT                   EKTIGDVFIVKENNKFHTYLNIYEDKEIAKVTIRNASPYVKQQNPFIKQIDEKIVKQIN
FT                   KRKLYIDVNEQPTQNIKSEIKEIVVKQEETKKEPKKIENQESLIPLVSAIPDNLELVGF
FT                   YPYSENKPAEKKEIKQTQEVSNQNNIDDSEEDDDSLDENDKEELKQISMDEFDKANKIE
FT                   HPIKSYEKKVIKPINNDLTNVQNFQQMIIEVDSATNIMKVKAKINNHLKDIQTYIVSTG
FT                   KDSVKKPFGVGKISQVSLDPVWYPTEDTLKSFEKRGIILPKVVPSGHKYNYMGAAKINL
FT                   THIVDGKSTYRIHGTLNEKTIGTKESAGCIRMRNGDVLQLANLIDEFANYKGLDSIKVV
FT                   LY"
FT   gene            263887..265086
FT                   /locus_tag="Abu_0271"
FT                   /note="AB0268"
FT   CDS_pept        263887..265086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66546"
FT                   /db_xref="GOA:A8ERH2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH2"
FT                   /protein_id="ABV66546.1"
FT                   /translation="MFIEDDFIELNSKFYTTCKPTSRIVTLLSVPIVLFIAVLLCYIGV
FT                   FPLNVEIHSVILIGIILFIYLFFVKHNAYYVSCKFKTQYEDLAYNLKEYINNNLLTIGE
FT                   TTKANGSVDDFLQDYTSNIRNTNLSTIASGIFPTLGILGTFISIALSMPDFTAGTTQAL
FT                   ESEITVLLGGVGTAFYVSIYGIFLSIWWIFFEKFGMSRFDHDSFVIKESTKSFFWTRID
FT                   IESIHIKSNLDNFTKMSNVFNQLTSSDILETINNSIERRFKALDELLNKELILSSKLDE
FT                   NIQMLNSMSKDISSTLNSFEKQKNLYTLSAELLNANIIKLNSHMDNLSSENLKSIYTNI
FT                   VKSIETMKNDMEKIEWKFKKEIDEYDEKITHKLQNSLELIDVETSKIVKDLSEFKELSK
FT                   "
FT   gene            265093..266082
FT                   /locus_tag="Abu_0272"
FT                   /note="AB0269"
FT   CDS_pept        265093..266082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0272"
FT                   /product="conserved hypothetical protein, probable
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66547"
FT                   /db_xref="GOA:A8ERH3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH3"
FT                   /protein_id="ABV66547.1"
FT                   /translation="MYKKNQNNDENFWISYADLMAGLLFVFILVIGAIVIKYVYAQSSL
FT                   ESSEEAKSQLFYELAKTKNLYESTKDELDKAKNQINLKLSEIEKLKALLLEYELNSKDE
FT                   KDKSEKLALELSEKTNLISLKDDELKLLADKLLVLTQVHQKMVEEFDIAKLKIKTLTGI
FT                   KLNVISKLREKLGKSINIDEKSGAIKFSSNILFDQNSYILKEESKKELSTVLKQYLNTL
FT                   LDDKEIKKYIESITIEGHTNSDGTYLSNLQLSQQRALAVMQFLYESNIIDKKLLGTYVN
FT                   SSGRSSSDLILKDGVEDKDASRRIEIKFTIKNEEAMKEIQNFLGEKKE"
FT   gene            266079..266201
FT                   /locus_tag="Abu_0273"
FT                   /note="AB0270"
FT   CDS_pept        266079..266201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66548"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH4"
FT                   /protein_id="ABV66548.1"
FT                   /translation="MKEYLYKPTNLEELSKDISSKLEKKKLSFFQKLFRFIFRR"
FT   gene            complement(266185..267117)
FT                   /locus_tag="Abu_0274"
FT                   /note="AB0271"
FT   CDS_pept        complement(266185..267117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0274"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="Pfam matches to PF02826 2-Hacid_dh_C, score 212.9,
FT                   E-value 6.8E-061, and to PF00389 2-Hacid_dh, score 69.8,
FT                   E-value 1.2E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66549"
FT                   /db_xref="GOA:A8ERH5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH5"
FT                   /protein_id="ABV66549.1"
FT                   /translation="MQIVILDRATLGFDIDVNIFSKFGNVTSYDSTKENETTQRVKNAD
FT                   IVLTNKVVIGKNEIDNSNIKLICITATGMNNVDLEYAKEKNIAVKNVAGYSTSSVVQVG
FT                   FSMILYFVQKLNYYKKYVDEGNWQKSELFTHIDEPFFELDKKRVGIIGLGEIGRNFAKK
FT                   AKAFDCEVVYYSTSGKNSNSEYKSISLEELLKTSDIISIHAPLNENTKNLLTYENMKNM
FT                   KDGAILLNLGRGGIINENDLAKLIDEKEIYCGIDVVSKEPIEESNPLLKVKNKNRLLLT
FT                   PHIGWASIEARTRLVNMVAKNIEDFIDGK"
FT   gene            complement(267133..268110)
FT                   /locus_tag="Abu_0275"
FT                   /note="AB0272"
FT   CDS_pept        complement(267133..268110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66550"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH6"
FT                   /protein_id="ABV66550.1"
FT                   /translation="MNYKNSIEKFLEIFKRSNLSISKFASMINKDRRTVTSWIDSVTDI
FT                   EPNKEVKDKICQIFRYPDYIWEDGCYGEEFLKSITQIPQKEVRIIDEDYKGRLKYIIEH
FT                   EKNRRFVIQAQFPGPMYRDSAVQKVYKNGTSADIEELKQERIDQMLRYDYDTTEWYSIK
FT                   SILSFCFASIGNFFTREEKIKILELIYELFNNNYNKKLFLFDSFSRKIYGMETTYISIN
FT                   VKQKILFFKSPIESVFIEIRNKSLVERMHKYYSSPIEAPSHVNFLESVKIIKILQDALK
FT                   YNNNIKQAYETINRETNYGELFYNNLSVDLQKEVSLPKSGQKRN"
FT   gene            268288..269175
FT                   /gene="prpB"
FT                   /locus_tag="Abu_0276"
FT   CDS_pept        268288..269175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="Abu_0276"
FT                   /product="carboxyphosphoenolpyruvate phosphomutase PrpB"
FT                   /EC_number="4.1.3.30"
FT                   /note="Pfam match to PF00463 ICL, score 40, E-value
FT                   1.3E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66551"
FT                   /db_xref="GOA:A8ERH7"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH7"
FT                   /protein_id="ABV66551.1"
FT                   /translation="MTSAGKRFREALKQESPLQIVGTINAYQALQATKVGHKAIYLSGG
FT                   GIANASYGLPDLGMTMLEDVCIDIRRITSICDTPLIVDADTGWGHAFNIARTVKEFIRY
FT                   GAAGLHIEDQVAAKRCGHRPNKELVSTEEMCDRIRAAVDAKKELDPDFYIIARTDAHAS
FT                   EGQQAAIDRAKAYVAAGADAIFAEAIHTLKEYKEFTDAVKIPVLANITEFGATPMFTTE
FT                   ELASVGIDMVLYPLSAFRAMNKAALNVYQELKDKGTQEAVIDTMQTRMELYDMLNYHSY
FT                   EQKMDELFSKGKAK"
FT   gene            269232..270377
FT                   /gene="prpC"
FT                   /locus_tag="Abu_0277"
FT   CDS_pept        269232..270377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="Abu_0277"
FT                   /product="2-methylcitrate synthase/citrate synthase 2"
FT                   /EC_number="2.3.3.5"
FT                   /note="Pfam match to PF00285 Citrate_synt, score 328.2,
FT                   E-value 1.3E-095"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66552"
FT                   /db_xref="GOA:A8ERH8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH8"
FT                   /protein_id="ABV66552.1"
FT                   /translation="MSTETTFKPKKSVALSGTAAGNTAICTVGKSGNDLHYRGYDILEF
FT                   ADKAEFEEIAYLIVHEKLPNKEELAAYKAKLKSYRDIPQGVKVALEQLPKTCHPMDVMR
FT                   TGCSVLGALNQEKEEHPKNEAQDIIDRLMGSFSSILLYWYHFAYNGKRIDVVTDDDTVG
FT                   GHFLHLLHGEKPRESWVKAMHVSLILYAEHEFNASTFTSRVIAGTNSDMYSCITGSIGA
FT                   LRGPKHGGANEVAFRIQERYKSADEAEADIRARMARKEIIIGFGHPVYSICDPRNVVIK
FT                   KVAKDLSDENKNTLMYDVAERIETVMWNEKKMFPNLDWFSAVSYNQMGIPTDMFTPIFI
FT                   IARVTGWGAHVIEQREDGKIIRPSATYTGPEGLKFVPLEQR"
FT   gene            270479..273070
FT                   /gene="acnA"
FT                   /locus_tag="Abu_0278"
FT   CDS_pept        270479..273070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="Abu_0278"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="Pfam matches to PF00330 Aconitase, score 447.2,
FT                   E-value 2E-131, and to PF00694 Aconitase_C, score 116.8,
FT                   E-value 5.5E-032"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66553"
FT                   /db_xref="GOA:A8ERH9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERH9"
FT                   /protein_id="ABV66553.1"
FT                   /translation="MTNEKYLKQLDGLDVKYYDVKSAVEDIKAGSFAKLNYTSRVLAEN
FT                   LLRKCPSADLKDSLIQLIEKRTDKDFPWYPSRVICHDILGLTAFVDLAGLREAVAKEGG
FT                   DPQKVNPVVPTQLIVDHSLAVECGGYDPDAFQKNRDIEDRRNADRFHFINWAKEAFNNV
FT                   DVIPPGNGIMHQINLEKMSPVVHNIDGIASPDTLVGTDSHTPHVDALGVIAVGVGGLEA
FT                   ENVMLGNPSYMRVPEIIGVEITGTRAAGITATDIALSLTSFLRENNVISAYLEFYGSGI
FT                   KYLDLGDRATISNMTPEYGASAAMFAIDNRTIDYLKITGREAKQVELVEKYAKANGLWA
FT                   DSLNEATYARTLKFDLSTVTRSLAGPSKPHKLVPTSTLEAEGITKKIEITNDVIPDGAV
FT                   LIAAITSCTNTSNPRNVVAAGLLAKKANELGLTRKRWVKSSLAPGSKVAELYLKESGLL
FT                   PELEKLGFGIVGFACTTCNGMSGALDPKLQKEAADSGVYTTAVLSGNRNFDGRIHPFIK
FT                   EAFLASPPLVIAYAIAGSIRFNIETDVLGKDKNGNDIKLKDIWPSDEEIDAVVNSAVKP
FT                   EMFGKIYDPMFARNGLGAKKAEPFYKWNTKSTYINKPPYWEDEYMQMPALKNMRPLGVF
FT                   PDNITTDHLSPSNAILPTSASGEYCIKMGLPIEDLNSYATHRGDHHTASRATLANPKLF
FT                   NEMVKDENGNVKQGSLTKIMPEGKESRMWEAIETYTQRKQPLIIIAGTNYGQGSSRDWA
FT                   AKGVRLAGVEVLIAESIERIHRTNLVGMGVLPLQFKEGETRHTYAIDGTEVFEIVGDIT
FT                   PRCDLTVVMTRANGEVVKFSVLCRLDTSAEVEVYKNGGILQKFAKDVIASK"
FT   gene            273160..274335
FT                   /locus_tag="Abu_0279"
FT                   /note="AB0276"
FT   CDS_pept        273160..274335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0279"
FT                   /product="conserved hypothetical protein (DUF453 domain
FT                   protein)"
FT                   /note="Pfam match to PF04303 DUF453, score 740, E-value
FT                   1.4E-219"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66554"
FT                   /db_xref="GOA:A8ERI0"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI0"
FT                   /protein_id="ABV66554.1"
FT                   /translation="MSYEPQMRVKATYMRGGTSKGTFFNIADLPKEAQEDKVKRDKLLQ
FT                   RIVGSPDIYKQQMDGMGGATSSTSKAILVGKSTVPNHDVDYYFGQVAIDKDFMDWSGNC
FT                   GNLSSAVGPFAIHEGLVDNVPQNGVCCVRIWQANIKKTILCYVTMVDGQVKEMGDYYID
FT                   GVAFPAEEILLEFAEPVDPSEELFPTGNLVDDLEVPGIGTFKATMITAGIPTIFLNAAD
FT                   IGYKGTELQADINSDAEALARFEKIRSYGALKMGLISDLKEAETRQHTPKIAFVAPKSD
FT                   FTTSSGKEVKADEIDLHVRALSMQKLHHAMMGTASVAIGVAACIEGTLVNLAAGGGEKT
FT                   AVEFGHPSGTLKVGAVIKKENGKYIVDKATMSRSARIIMKGEVYAPADIMK"
FT   gene            274409..274900
FT                   /locus_tag="Abu_0280"
FT                   /note="AB0277"
FT   CDS_pept        274409..274900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66555"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI1"
FT                   /protein_id="ABV66555.1"
FT                   /translation="MRDIIKLGLLSLIISLTFTACMEDNPETVTKKYMEALKDGNFNEV
FT                   SKVVSEDMKNNLSNNIFVNCIINPEIKDEVIPKLEEKKIDIDEYNKLTLDKKTKIINEC
FT                   FKHWSKSLENVSSYKILFSKLNEKSNDAIVSVEVKLKNSEIKQEFISLKRIDNEWKVIE
FT                   "
FT   gene            complement(274929..275471)
FT                   /locus_tag="Abu_0281"
FT                   /note="AB0278"
FT   CDS_pept        complement(274929..275471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0281"
FT                   /product="isochorismatase hydrolase"
FT                   /note="Pfam match to PF00857 Isochorismatase, score -18.7,
FT                   E-value 6.8E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66556"
FT                   /db_xref="GOA:A8ERI2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI2"
FT                   /protein_id="ABV66556.1"
FT                   /translation="MRIRVEDALFCLVDVQERLFPHIGNKEILEKNLLTLVKGLKVLNV
FT                   PFIVNEQYKKGIGETIPSLKELVETYSSYEKTTFSCCQNDETMKAIKNANKKVVIVAGI
FT                   ETHVCVLQTCIDLLENGFKVVLVTDCCSSRKENDTKFAIKRLIQAGVIPTTYESILFEL
FT                   TLDAKNPCFKEISSLVK"
FT   gene            complement(275531..277279)
FT                   /locus_tag="Abu_0282"
FT                   /note="AB0279"
FT   CDS_pept        complement(275531..277279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0282"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66557"
FT                   /db_xref="GOA:A8ERI3"
FT                   /db_xref="InterPro:IPR025291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI3"
FT                   /protein_id="ABV66557.1"
FT                   /translation="MSLNTIILNFLKKLLGSALEYKFSSFFIFLFSIASIILVDKNFYY
FT                   GSKEYIYLINIIYASSVGFLLTLVAYFSKKKKILLAVSLFLTGLYFYYLPFNEDYSTVI
FT                   FFSNYLCIIAICISLLLYIPFHNEQKDNQRFLNWAINIIESIVISSIFGIILFVSLYIA
FT                   ITSIVILFDLKIEKFIYAQYLAIIVFGVFCTHYFLLSLNKNPQASELNLTFYNKIGNFF
FT                   SKYILTTIVVIYSLILLGYIIKILFLQEWPNGVVVWLSLTFAIFSLLTYIFWTPYENRY
FT                   KKLLIFVALIQLSLLFVAIYMRIAQYGWSTNRYMIVLTAIWLVGAFVYILIYKKYRYDY
FT                   IFLAFALMLFISQYGYKMNSYYVNDIAQLNRLTQLLSQNSVLSNKTDKTIRCDISSAID
FT                   SLYTHRNIEFLNQAMPNIYDKYKYIKDKEYSNRYYSFPNYATEKLGFKYLSNWECGKNQ
FT                   TAYQNDNIYIYSNNTTDIIDVSGGYDVMNRNTLTIFHENSKYTIKIPTKDNLNFSEFDM
FT                   SDFINKFKKSDTNESKSVKYNNDDLTFVAQDKNMKIKLFFYSMSISELSGDVVYPSTYI
FT                   LIKYLK"
FT   gene            complement(277305..278243)
FT                   /gene="hemC"
FT                   /locus_tag="Abu_0283"
FT   CDS_pept        complement(277305..278243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="Abu_0283"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Pfam matches to PF01379 Porphobil_deam, score 397.4,
FT                   E-value 2E-116, and to PF03900 Porphobil_deamC, score 70.3,
FT                   E-value 5.7E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66558"
FT                   /db_xref="GOA:A8ERI4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERI4"
FT                   /protein_id="ABV66558.1"
FT                   /translation="MEKLVIATRRSQLALWQSEYVKSRLLEHYPNMQIELQEFVTKGDK
FT                   ILDVPLAKIGGKGLFTKELEVAMLEGSAHLAVHSLKDVPTQFEDGLMLAAVTKRFDPRD
FT                   AFLSNKYTSLEELPKGAIVGTTSLRRRMALKILRPDIELKDLRGNINTRIAKLNAGEYD
FT                   AIILAATGIQKLGIENEVKYFSPISTDIMIPSMGQATLGIETTNDPKVLEILKVLNDNN
FT                   AHIESTVERSFVDTLQGGCQVPIGVKATILDENSIRVQAIVGMPDGSEYISEDITADIE
FT                   DYETIGQNLAQIFIDQGAKELLEKAEKVAFK"
FT   gene            complement(278259..279089)
FT                   /locus_tag="Abu_0284"
FT                   /note="AB0281"
FT   CDS_pept        complement(278259..279089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0284"
FT                   /product="conserved hypothetical protein, putative DSBA
FT                   oxidoreductase"
FT                   /note="Pfam match to PF01323 DSBA, score 9.9, E-value
FT                   1.5E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66559"
FT                   /db_xref="GOA:A8ERI5"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI5"
FT                   /protein_id="ABV66559.1"
FT                   /translation="MNFSKILSLSVILSASLFANDSTVVDFEKKRVAQNPNVKVKDVKV
FT                   NTKKDLPLAGWNGYILDVEAIVQEKSLKVKDILFSNGDYIALDLIDAKTGKSLKDLVTP
FT                   NLTSNYYDKTKLIAGNHNAKDKIVVFSDPLCPFCMEYIPEVINYVNKNSDSIALYYYAF
FT                   PLVQIHPASEALSKIIEVAKNKGVKDIELKAYKTDWETYFSPKENDEKKILEAFNKELK
FT                   TNIKLEEIASKDINEKLSKDMSMGEEVMVTGTPTIFVNGVKDTTRELYKTLGKK"
FT   gene            complement(279151..281082)
FT                   /gene="dnaX"
FT                   /locus_tag="Abu_0285"
FT   CDS_pept        complement(279151..281082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="Abu_0285"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="Pfam match to PF00004 AAA, score 32.4, E-value
FT                   1.3E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66560"
FT                   /db_xref="GOA:A8ERI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI6"
FT                   /protein_id="ABV66560.1"
FT                   /translation="MNKEILEDRVLALKYRPKRFEDLIGQSTISQTLSLALDSNRLSHA
FT                   YLFSGLRGSGKTSTARIMAKALLCSQGPTSKPCDICDNCKSANASKHLDIIEMDAASNR
FT                   GIDDIKDLIEHTKYKPSSARFKVFIIDEVHMLTTQAFNALLKTLEEPPGFVKFILATTD
FT                   PLKLPATILSRTQHFRFNKIAQSDVVHHLSYILNKENIDFEQNALEILARSGQGSLRDT
FT                   LTLLDQAIIFSKGKVNTTSVVDMLGLIDPKMMDNIFSMILNKEDITKLVKELEVYEVSQ
FT                   ICDEMTIYLKDKMLSRDNKFDLLLFDRFFRILSDAKQLLAINSDGTFVLILTFMKMIEA
FT                   TNLRTIDDIINQVEKIEPKKELISEKTTPIIESSLVKNPEIPQKEVIKEKVNTLIVEEE
FT                   TKIEEVTALDEVLIQTNNIIDLGITNSIETINYSTPFDELPITKPIENQKEEKIEEIKE
FT                   LEIEHISFESEVSFNPTQEVEIIPLEDESDKFLDLYNQLTAKVYDRDYSLGECFEKNFI
FT                   FNGFSDDKLHIISYAQDEDRKLLFKYFGLIKAFAQDIFGSNVELDFKKEEATILEEKPL
FT                   VSENVEETSSMIEDIELGSGCVADMTKSSVITPSQKELQINDILNSKMVDKAKELFDIK
FT                   KITVKTRS"
FT   gene            complement(281079..281864)
FT                   /gene="murI"
FT                   /locus_tag="Abu_0286"
FT   CDS_pept        complement(281079..281864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="Abu_0286"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="Pfam match to PF01177 Asp_Glu_race, score 219.5,
FT                   E-value 6.8E-063"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66561"
FT                   /db_xref="GOA:A8ERI7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERI7"
FT                   /protein_id="ABV66561.1"
FT                   /translation="MKVGVFDSGLGGLTVLKSILKVLKNAEIFYIADTAYAPYGEKDSA
FT                   LILKRCEDITNYLLKEYKIDALIVACNTATSAAIKHLRDNFSSLIVIGTEPGIKPAILN
FT                   TKSSNIGILATPSTLKSDKYQLLVNELSSIKKVNLFEQACPGLAMQIEKGEINTLTTYK
FT                   MLEEWLIPMKEANVDTIVLGCTHYPLISQTIKKIMGEDITLIQTGDAIAKRLLSLSEEK
FT                   GHKNIGDLKVTVLHTGLINLDMIENILENKNIEVRKCEI"
FT   gene            complement(282089..283441)
FT                   /gene="gdhA"
FT                   /locus_tag="Abu_0287"
FT   CDS_pept        complement(282089..283441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="Abu_0287"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="Pfam matches to PF00208 ELFV_dehydrog, score 458.9,
FT                   E-value 5.7E-135, and to PF02812 ELFV_dehydrog_N, score
FT                   266.8, E-value 4E-077"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66562"
FT                   /db_xref="GOA:A8ERI8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI8"
FT                   /protein_id="ABV66562.1"
FT                   /translation="MTYIDELLDYLKRTSPGQEEFHQATEEVLHSLEPLFEKYPIYKEN
FT                   KILDRLVEPERQILFRVAWVDDSGEIQVNKGYRIEFSSTLGPYKGGLRFHPSVNTGIIK
FT                   FLGFEQIFKNALTGLQIGGGKGGSDFDPKGKSDREIMKFCQAFMSELFRHIGATTDVPA
FT                   GDIGVGGREIGYMFGMYKKLANRYDGTFTGKSLKWGGSLARTEATGYGCVYFAKNMLEA
FT                   KGETLKDKRCVVSGSGNVAIYTIEKLYHMGALPIACSDSAGMILDEEGIDLNLLKDLKE
FT                   NQRARLSEYVKYRKNAKYTPVTEYPKGRNAIWSIPCYAAFPSATQNELNLEDAKELIKN
FT                   GCKCVSEGANMPSTNEAVDFFVEQKIAYGPGKAANAGGVATSQLEMAQNASMVSWTFEE
FT                   VDAKLEQIMRNIFESVSTTAAEFGQPTNFVLGANIAGFRRVADAMIEQGIV"
FT   gene            complement(283581..284903)
FT                   /gene="rho"
FT                   /locus_tag="Abu_0288"
FT   CDS_pept        complement(283581..284903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="Abu_0288"
FT                   /product="transcription termination factor Rho"
FT                   /note="Pfam matches to PF00006 ATP-synt_ab, score 253.2,
FT                   E-value 1.3E-075, and to PF07497 Rho_RNA_bind, score 146.6,
FT                   E-value 5.9E-041, and to PF07498 Rho_N, score 45.7, E-value
FT                   1.4E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66563"
FT                   /db_xref="GOA:A8ERI9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERI9"
FT                   /protein_id="ABV66563.1"
FT                   /translation="MEESKEETKVKNVKKTRTHIPVEGYKIEQLRELPLEVLIDIANEL
FT                   DVENPQELKRQDLMFMILKSQIDAGGFILFTGILEIKEGGFGFLRAIDGNFSDTSNDSY
FT                   VSATQIRKFALRTGDIVSGQVRPPNKESEKYNALLKIEAINYLPVKESKNRPLFDNLTP
FT                   LYSTSRFNFEYDSQKMTGRMLDLFAPMGKGQRGLIVAPPKTGKTELLKELAHAISRNHP
FT                   EVTLMVLLIDERPEEVTDMQRSVKGEVYSSTFDLPAQNHVRVAEIVIEKAKRLVEMKKD
FT                   VVILLDSITRLARAYNTVTPSSGKVLSGGVDANALHKPKRFFGAARNIEEGGSLTIIST
FT                   ALIETGSKMDEVIFEEFKGTGNSEVVLSRNAANKRVYPALDIIKSGTRKEELLLTPDIL
FT                   QKTWILRNAISQMDEVEALKFLYSKMQKTKDNEEFFASMNE"
FT   gene            complement(285063..285659)
FT                   /gene="tsaA"
FT                   /locus_tag="Abu_0289"
FT   CDS_pept        complement(285063..285659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaA"
FT                   /locus_tag="Abu_0289"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant"
FT                   /note="Pfam match to PF00578 AhpC-TSA, score 325.3, E-value
FT                   9.9E-095"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66564"
FT                   /db_xref="GOA:A8ERJ0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERJ0"
FT                   /protein_id="ABV66564.1"
FT                   /translation="MLVTKKAPDFTATAVLADGQIVENFNLYENIGEKGAILFFWPLDF
FT                   TFVCPSEIIAFSKRTDEFKARGINVIGCSVDSQFSHFAWRETAVENGGIGRVKFPMVAD
FT                   LNKQISKDYDVLFGESVALRGSFLIDKDGTIRHAVINDLPLGRNVDEMIRMVDAMLFTN
FT                   EYGEVCPAGWQKGDEGMKANKDGVADYLAKNEGKL"
FT   gene            285865..286137
FT                   /gene="fdxA"
FT                   /locus_tag="Abu_0290"
FT   CDS_pept        285865..286137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="Abu_0290"
FT                   /product="ferredoxin"
FT                   /note="Pfam match to PF00037 Fer4, score 25.7, E-value
FT                   3E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66565"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERJ1"
FT                   /protein_id="ABV66565.1"
FT                   /translation="MAVKITDICISCDACLDECPVEAIVDNDDNPTGEDTYYVYADKCV
FT                   ECVGHNDAPACADACPTEGCIVWDEAGSGSIEKEDRGTPGTPVVE"
FT   gene            286249..286662
FT                   /gene="ndk"
FT                   /locus_tag="Abu_0291"
FT   CDS_pept        286249..286662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="Abu_0291"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="Pfam match to PF00334 NDK, score 279.7, E-value
FT                   5.3E-081"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66566"
FT                   /db_xref="GOA:A8ERJ2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERJ2"
FT                   /protein_id="ABV66566.1"
FT                   /translation="MEQTLSIIKPDAVAKNVVGKILDRFESAGLKIAATKKLQLSQADA
FT                   EAFYAVHAARPFFKDLVEFMISGPVVVSVLEGENAMAKNRELMGATNPKEAAAGTIRAD
FT                   FADSIDANAVHGSDSLENAKNEIAFFFAQREIC"
FT   gene            286690..287067
FT                   /locus_tag="Abu_0292"
FT                   /note="AB0289"
FT   CDS_pept        286690..287067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66567"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERJ3"
FT                   /protein_id="ABV66567.1"
FT                   /translation="MKIEFKKVPQTAKELLTQFNSVEIEGIFCRISSSLVKVEAVLKGN
FT                   TAIDCCRCGVSEIVEVNEELRLLLSDGIYKGNEEEFLVIEIENSLIDFDEIIESELNSI
FT                   KSDYYICKNCLQNSDNFEKEF"
FT   gene            287079..287231
FT                   /gene="rpmF"
FT                   /locus_tag="Abu_0293"
FT   CDS_pept        287079..287231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="Abu_0293"
FT                   /product="50S ribosomal protein L32"
FT                   /note="Pfam match to PF01783 Ribosomal_L32p, score 34.1,
FT                   E-value 4E-003"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66568"
FT                   /db_xref="GOA:A8ERJ4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERJ4"
FT                   /protein_id="ABV66568.1"
FT                   /translation="MAVPKRRVSHTRSAKRRTHYKITLKKPVKDSDGSWKMPHMVNPNT
FT                   GEYKN"
FT   gene            287231..288232
FT                   /gene="plsX"
FT                   /locus_tag="Abu_0294"
FT   CDS_pept        287231..288232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="Abu_0294"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /note="Pfam match to PF02504 FA_synthesis, score 485.4,
FT                   E-value 6.3E-143"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66569"
FT                   /db_xref="GOA:A8ERJ5"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERJ5"
FT                   /protein_id="ABV66569.1"
FT                   /translation="MLRIAIDAMGGDFGPEPIIEGLVLALRKNNNFTAIAVGNKEQLLP
FT                   LIPQGLLPRIEILDTNDVISMHDNATDALKRKDSTIYKAIELVREGNADAVVSAGHSGA
FT                   SMSLATLRIGRIKGVSRPAIATLMPTSENQNTLVLDVGANVDSDAKNLFEFAVMGQVYA
FT                   QYALRLDEPIVGLLSNGEEDSKGNEVTKEAYKLLSKLPGFAGNVEGSDIFKGTVDVVVC
FT                   DGFIGNILLKTAEGVADTIGKIIKKNLKRSLISIAGAVLMRKVFKNLKVRVDYAEYGGA
FT                   PLLGVKAPVIISHGKSNSKAIQNAIFQAINAASSNLDSIIEQRLVEYSNKID"
FT   gene            288259..289260
FT                   /gene="fabH"
FT                   /locus_tag="Abu_0295"
FT   CDS_pept        288259..289260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="Abu_0295"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="Pfam matches to PF08541 ACP_syn_III_C, score 177.9,
FT                   E-value 2.3E-050, and to PF08545 ACP_syn_III, score 155.4,
FT                   E-value 1.4E-043"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66570"
FT                   /db_xref="GOA:A8ERJ6"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERJ6"
FT                   /protein_id="ABV66570.1"
FT                   /translation="MIYAAFRSIGAYIPPKIMSNADFEKIIDTSDEWITKRTGIKERRI
FT                   ANEGEASSDLGARAGELAIERAAISKEEIDLVICATVTPDFLCMPSTACLIAAKLGLSN
FT                   VMAFDVSAACTGFVYALNVAKAFIESGMKKNVLIVGAEKYSAILDYTDRTTCFLFGDGA
FT                   GAAIISATNDKSESIIDINCSSDGNYEDLIKTPGGGSKNPCSQEVLENKMACIKMKGNE
FT                   TFKLAVKTLTSDVKTMLEKHNLTNEDINHFIPHQANYRIIKAVGEALDLSDEKTVVTVD
FT                   KYGNTSAASIPMAMNYAFEQGKIKAGDTILFDAFGGGLTWGSALFKFAPIKR"
FT   gene            complement(289277..289711)
FT                   /locus_tag="Abu_0296"
FT                   /note="AB0293"
FT   CDS_pept        complement(289277..289711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66571"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERJ7"
FT                   /protein_id="ABV66571.1"
FT                   /translation="MIKDIIENPNYKELIEKQIHDIIVFLLDNNQEFSITANITPISFN
FT                   PALPEEIKSQLHKFSLFVLSNYTYTTIEINEEFLSFEAGFGSENFGSIVKIPLHAIFQI
FT                   IVEDSILYLNSIATVEKFNRDLEKNSFNIFKNNPNNKKFN"
FT   gene            complement(289713..291737)
FT                   /locus_tag="Abu_0297"
FT                   /note="AB0294"
FT   CDS_pept        complement(289713..291737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0297"
FT                   /product="conserved hypothetical protein, predicted
FT                   ATP/GTP-binding protein"
FT                   /note="Pfam match to PF00350 Dynamin_N, score 113, E-value
FT                   7.6E-031"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66572"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERJ8"
FT                   /protein_id="ABV66572.1"
FT                   /translation="MSANLNILKSFVNEFKETYTVVEAIYEDGLVGDIRKIQDKLLDEK
FT                   FFPSTQLKAILNKQIRRARYPMEVAITGQFSAGKSTFLNALLSRNILPTGITPVTSKVN
FT                   FINYGEEYKLKITYYSGAQEYAPIESIADFTDQREHEMKDIKYLTLYAPMDILKDISFV
FT                   DTPGLNSQSQSDTDTTRKVLRDVGGIIWLTLIDNAGKLSEAEVLEEYMQHFKNKSLCVL
FT                   NQKDKLTPEQVETTTKYVSEKFGKYFAKVVPISAMMALEGRAQHKDILLEDEYTKIVNQ
FT                   FKKDLLEKNVDEIDFFDKSFKDYKNKINSIKNLDATTNTELLKESNIQDVLDFINDTIR
FT                   PQAAEAKEFAIKKDLKSFCDILIKEYETIIKVYDALVDVLKNCEPLVIEHFDTIQKKYS
FT                   KELFTIYNSLESIMEKIAHETYKNIKRKKSIRFEESKSLFGEKIEKFEYETFWIDSDAI
FT                   YKVLFYDDQTIDKMFKRSIKLLKNVELNSDEAFREAYRIIKNDVVKWQEPYELIRKQRE
FT                   IASDIEFSNTRHFAAKVYENVLKSFHRAILENISALRKKFAYFNGALSYSYIQTTQATI
FT                   AHFEQQISESEELYKKEPTRFAISHPREDEIIAKLKANFGFEKIEDFLTSKRNYLFKIV
FT                   KYSKEQYLEINEDRIKFVLSKKEQYLNKIKDLERIKEEI"
FT   gene            complement(291737..294088)
FT                   /locus_tag="Abu_0298"
FT                   /note="AB0295"
FT   CDS_pept        complement(291737..294088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0298"
FT                   /product="conserved hypothetical protein, predicted
FT                   ATP/GTP-binding protein"
FT                   /note="Pfam match to PF00350 Dynamin_N, score 140, E-value
FT                   5.8E-039"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66573"
FT                   /db_xref="GOA:A8ERJ9"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERJ9"
FT                   /protein_id="ABV66573.1"
FT                   /translation="MSLVNDYFLLYHGITFEQNLDTEEIDTILNEDTFTIFALILSATR
FT                   KNCDKYLPLTSFKTLCQQINVKSPSNITELNHLQHNIVDTISRNKTKNNITILHSSFEY
FT                   LKNENILNSEHYNKLLSLFDLKELNVTEEQNHISVQKIDDEHKSSFKDLKHNLENIINE
FT                   LKTDLTNKEILAELENTHNYLNNQKFSIGITGVMNAGKSTMLNALMGREILGSAVVPET
FT                   ANLTIVKHNPTDNAKVYYWNEQEWDRIKKSASQLESMKDFVEETNKIFGDNLKNYIRPV
FT                   SRFDEIDIKDLSSYTSAEASGKKCNLVKYVELGSKLDFLSDGIEIVDTPGLDDPVIQRE
FT                   EITKEYISQCDMMIHLMNVSQSATLKDVEFIIDALLYQNISKLLVVITRADTVSKEQLE
FT                   EVIKYTKTSIEKQLKAQNKDSQLDYILKTIRFIPISGRMALLHRTGREKEALDAGFTIE
FT                   DTGILEIEKYLMDTLFGTNSQKGELVVQSTKNQLQKVIEKQISFNNYELTLLSKSKEEL
FT                   EKELEEFNKKKAVNTRIFQAMSEDITYYKNDAKSYIDSLETFLESELIDLQTVIKQRVV
FT                   SDVKYSFEKMKKRPENSRIKVIVETAIKDGIIDVIRDYRYKFIKKSQTIGEQCEQKYHD
FT                   LGFAIGHKNENFDARGFFQEDFKSGFLTSNNEVLISQIIDAVSKSKDSRINELDREIEA
FT                   LISTQFTSIEDDLKVKAKKVSNMLIDSFFTTLNAPLKQFEQKLKNDEETLQNQLNSFEE
FT                   NDKNKDVISINIHKNIKKLENISATIKGLN"
FT   gene            complement(294188..294919)
FT                   /gene="frdB"
FT                   /locus_tag="Abu_0299"
FT   CDS_pept        complement(294188..294919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="Abu_0299"
FT                   /product="fumarate reductase, iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66574"
FT                   /db_xref="GOA:A8ERK0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK0"
FT                   /protein_id="ABV66574.1"
FT                   /translation="MSTQKGREITISVLKFNPRSKVSKPHFVEYKLEETPGMTLFIALT
FT                   QIRENLDPDLSFDFVCRAGICGSCGMVVNGKPSLACRTLVSNYPSGKLQLMPMPAFELI
FT                   KDLSVNTGKWMDGMSKRVESWIHNDHEVDISKLEDRIDPDVANDTFELDRCIECGICVA
FT                   SCGTALMRPNFVGPVGLNRVARFDIDPHDKRTAEDFYELIGDDDGIFGCMSLMACEDHC
FT                   PKHLPLQNKIAYLRRKLVALR"
FT   gene            complement(294919..296904)
FT                   /gene="frdA"
FT                   /locus_tag="Abu_0300"
FT   CDS_pept        complement(294919..296904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="Abu_0300"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="Pfam matches to PF00890 FAD_binding_2, score 560.9,
FT                   E-value 1.1E-165, and to PF02910 Succ_DH_flav_C, score
FT                   183.3, E-value 5.3E-052"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66575"
FT                   /db_xref="GOA:A8ERK1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK1"
FT                   /protein_id="ABV66575.1"
FT                   /translation="MKINYCDALVIGGGLAGLRAAVAAQKKGLSTIVLSLVPVKRSHSA
FT                   AAQGGMQASLGNSKMSDGDNEDLHFADTVKGSDWGCDQEVARMFVHTAPKAIRELAAWG
FT                   VPWSRVKAGTREAVINAKKTTITEDEDRHGLITSRDFGGTKKWRTCYTADATGHTMLFG
FT                   VANEALKHNVDIRDRKEALSLIHENGRCYGAIVRDLITGELEAYVAKGTCIATGGYGRI
FT                   FKQTTNAVICEGTGAAIALETGIATLGNMEAVQFHPTPIVPSGILLTEGCRGDGGILRD
FT                   VDGHRFMPDYEPEKKELASRDVVSRRMIEHIRNGKGVPSPYGYHVWLDISILGREHIEK
FT                   NLRDVQEICQIFNGIDPADEGPKGWAPVLPMQHYSMGGIRTKPTGESQKLSGLFACGEA
FT                   ACWDMHGFNRLGGNSVSETVVAGMIIGNYFADYCLENDVTIPTKTVQKFLDEQEAYIDE
FT                   ILSYNGNEDIFKIKNRMKELMDEKVGIFRSGEPLKEAVEELKDLLAKTKKINIKSKERS
FT                   GNPELEEAYRVPKMLKVALCVAKGARDRTESRGAHYREDYLKRDDANWLNRTLTSWPSK
FT                   DALEPEITYEPLDIMTMEMPPAFRGYGAKGMIIEHDLSAVRQAQVDEITEKMQAEGKDR
FT                   HEIQHALMPFDLPMNYKEKNERAGDK"
FT   gene            complement(296904..297704)
FT                   /gene="frdC"
FT                   /locus_tag="Abu_0301"
FT   CDS_pept        complement(296904..297704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="Abu_0301"
FT                   /product="fumarate reductase, cytochrome b subunit"
FT                   /note="Pfam match to PF02967 Fum_red_TM, score 387.3,
FT                   E-value 2.1E-113"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66576"
FT                   /db_xref="GOA:A8ERK2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK2"
FT                   /protein_id="ABV66576.1"
FT                   /translation="MSDLIEGYLGKTEEGKKSRLPAKLDFIQSFTGGFLALFMWAHMML
FT                   VASILVSNDFMYAVTKLLEGSFIFEGGNPLLVTIVAAVIFTIFIVHAALGMRKLPGNFK
FT                   QYQVMKAHAKSMNHDDTKLWFIQAFTGFAMFFLGSVHLYVIMTNSADIGPYESADRIWS
FT                   EYMWPLYILLLLAVEFHGTIGLYRLCVKWGWFDGENPKATRKALKKVKWVLTVFFLVLG
FT                   FASLAAYMKIGYENAKNGTVGQKYTPTAQIMNYNLTNKSLGGIA"
FT   gene            complement(297902..299422)
FT                   /gene="nuoN"
FT                   /locus_tag="Abu_0302"
FT   CDS_pept        complement(297902..299422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="Abu_0302"
FT                   /product="NADH-quinone oxidoreductase, N subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00361 Oxidored_q1, score 192.1,
FT                   E-value 8.5E-056"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66577"
FT                   /db_xref="GOA:A8ERK3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERK3"
FT                   /protein_id="ABV66577.1"
FT                   /translation="MSQFLYLVPTLTILVGALVLMFMSMYDKFNIKNHIFASSVFLIIA
FT                   LLFALSNVSNSFSVQPYESFLNNVLTFDSFSNFFNILLIAGTLLTLLIGEHYFQHRSYF
FT                   KGEFFSILLFALFGMMVLAQANELITAFIALEIASFSIYIMVGYNSDDSKRVEAIFKYL
FT                   VLGSFIGAFYLLGMVLVYGATTSTNLADVSTFIATANQQDMILVYIGLTLILFTFLFKI
FT                   AAFPFQSWLLDVYRGAPMIITAYMASTFKIAIFSFFLRVILDYISPIIDFWDTILSVVI
FT                   ILTLVFGTWLAVTQQIVKRMLAASSIVHTGYLLLAFIALGYKDGHLINIDSAYAVMFYL
FT                   IAYLLSALGAFGLASHIISETNVKVTFDDFKGLAKQRPFLAAMMTIFLLSLAGIPSTIG
FT                   FIGKIYVFTEAIASGYTLLTVIAILATIVSVYYYFRLIAVMYFYPAPDNCETEEFDDKR
FT                   VSTYAIMFVAILTVLGGIGSAIVFFIPAMNIDTLINFSQVAVQSLFIR"
FT   gene            complement(299419..300906)
FT                   /gene="nuoM"
FT                   /locus_tag="Abu_0303"
FT   CDS_pept        complement(299419..300906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="Abu_0303"
FT                   /product="NADH-quinone oxidoreductase, M subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00361 Oxidored_q1, score 196.1,
FT                   E-value 5.9E-057"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66578"
FT                   /db_xref="GOA:A8ERK4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK4"
FT                   /protein_id="ABV66578.1"
FT                   /translation="MSSDILSFIIFLPAVVAFGLMITTRDVNAIRNIAFLTTTVILGLV
FT                   LKIYIEFDPNSTMQFVTNVSWIETYGINYYVGLDGFSLTILMMIAILIPTSYLLLWEGK
FT                   TKGYWINMLLVQTGVTGSLLSLDVVLFYFFWEVMLLPVFLLIGQYGFGNKVFTTIKVTV
FT                   YTMAGSLLMLIAILYLGVAYYSEFGTWSFAYDKLMTISTLDYSTKAWLFLAFLAAFAIK
FT                   IPIFPLHTWIMETYKNAPTGAVFLLSSIMAKLGVYAIVRFMIPIFPDIYVEFSTWFVAI
FT                   GLFGLIYFGIAALMQDDIKRMFAYSSASHLSFISAGIFSLNAYGINGALYLIIAHAIAT
FT                   GALFLLVGLMQEQTGFKTIKDLGGIAKKAPIFTFIFAVMLFANVGLPGTNGFVSELLII
FT                   FGIYEFNAYLGYISALTVIIGASYMLWMFQRAILQDRPEGAPELTMRDLKIKEIIGLAP
FT                   WVILVFVMGFYPEIFMDKFEPTVTHYLQDILQIGAAK"
FT   gene            complement(300908..302794)
FT                   /gene="nuoL"
FT                   /locus_tag="Abu_0304"
FT   CDS_pept        complement(300908..302794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="Abu_0304"
FT                   /product="NADH-quinone oxidoreductase, L subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam matches to PF00361 Oxidored_q1, score 322.2,
FT                   E-value 8.4E-094, and to PF00662 Oxidored_q1_N, score 79,
FT                   E-value 1.4E-020"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66579"
FT                   /db_xref="GOA:A8ERK5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK5"
FT                   /protein_id="ABV66579.1"
FT                   /translation="MNTSALVWIILAPLFGAILNGSLYFYHIKKSKISENYFALIGTIT
FT                   PLISFLITLSLFLRMLEEKIIFKQHIFTWLNVDKLNIEMAFLGDNLSIFMSMFVTFVGW
FT                   LIHIYAIGYMKGDDGFGKFFAYFNLFLASMLILVLADNPIILFIGWEGVGVCSYLLIKF
FT                   YYGSKDNVIAANKAFIVNRVGDFGFLLGVVTLFFALGQVDLSFGTIEANIGNTTNSLLI
FT                   LSGFLLFVGAMGKSAQVPLYVWLPDAMAGPTPISALIHAATMVTAGVYMVARFHFLYAG
FT                   IEEIGIFIAYIGAISALLAAVIATKQTDIKKILAYSTMSQLGYMFIAVGLGFYSTGLFH
FT                   VFTHAFFKAMLFMGAGGIIIALHHEQNIFKIAKHRANLPIIGLTFLIGVIAISGIPPFS
FT                   GFFSKDAILAAAFQEGQYLIYGIALFTAFLTAYYMFRMYFIVFVAPNHHDVDYVYTSKT
FT                   ITLPLLILAIGAVGAGFLNLPSIFGGNHFVDTWLGQLNSKVIHLDHSTEYILMILSVVV
FT                   AACGIFVAYKKYANFDLSKEETETGFVGRKLYVDELYDFLFVKSAKAISTFIDKVLDDK
FT                   IIDAFIMKSSISFVNVGKKVAMIQNANVRFYAVFMLIGMTCIFVYLYITLGL"
FT   gene            complement(302796..303107)
FT                   /gene="nuoK"
FT                   /locus_tag="Abu_0305"
FT   CDS_pept        complement(302796..303107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="Abu_0305"
FT                   /product="NADH-quinone oxidoreductase, K subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00420 Oxidored_q2, score 89.8,
FT                   E-value 7.5E-024"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66580"
FT                   /db_xref="GOA:A8ERK6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERK6"
FT                   /protein_id="ABV66580.1"
FT                   /translation="MVSLTSYAFVSMMLFSIGAIGVIARKNIFVIYMSIEMMLNGINLF
FT                   LITFARYHFNIDPQIITVMVISIAAAEAAIFLSVIILLFRSKKSLNTDVFTSLTQGEN"
FT   gene            complement(303111..303632)
FT                   /gene="nuoJ"
FT                   /locus_tag="Abu_0306"
FT   CDS_pept        complement(303111..303632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="Abu_0306"
FT                   /product="NADH-quinone oxidoreductase, J subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="Pfam match to PF00499 Oxidored_q3, score 107.5,
FT                   E-value 3.6E-029"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66581"
FT                   /db_xref="GOA:A8ERK7"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK7"
FT                   /protein_id="ABV66581.1"
FT                   /translation="MVDLIFIALAFFAITGAIAMIVYKNPMFSALGVLITMLSVAGMFA
FT                   LLNATFLFLVQIIVYAGAIMTLILFILMFLNIKEEDLPHEPNKYKLIALGAVIMIPLNV
FT                   LVLKAVSNLPQKDFNIVQGDFGDIKPVGIELYNHWIVAFELISILLLIALVGSVVLAKK
FT                   RKSKIISKED"
FT   gene            complement(303632..304132)
FT                   /gene="nuoI"
FT                   /locus_tag="Abu_0307"
FT   CDS_pept        complement(303632..304132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="Abu_0307"
FT                   /product="NADH-quinone oxidoreductase, I subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00037 Fer4, score 32.9, E-value
FT                   1E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66582"
FT                   /db_xref="GOA:A8ERK8"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK8"
FT                   /protein_id="ABV66582.1"
FT                   /translation="MGIKVVQRHGKSFKDRLYLPGIAGGMKTTFKHFVKNLKDVESINT
FT                   LQYPEVQPTDITDRYRGVHRLTKFDDGSEKCVACFMCATACPAECIFIEAEERFDEHNE
FT                   KRPKEFKIDLLECVFCGYCVEACPCDAIRMDTGIFSFTASKREDFVLDKKALMANERSK
FT                   DLK"
FT   gene            complement(304134..305408)
FT                   /gene="nuoH"
FT                   /locus_tag="Abu_0308"
FT   CDS_pept        complement(304134..305408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="Abu_0308"
FT                   /product="NADH-quinone oxidoreductase, H subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00146 NADHdh, score 338.9, E-value
FT                   8.1E-099"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66583"
FT                   /db_xref="GOA:A8ERK9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERK9"
FT                   /protein_id="ABV66583.1"
FT                   /translation="MSDIIIILVNIILAVVLAVGLTPLWVWWERRICGFIQDRSGPNRC
FT                   NIGPMRLGGLIQALADMLKLVFKEDFTPSHIKHKFFFTIAPVIVFLCSFLTFAVVPYAD
FT                   VLVIDDKSHIMQAIPNQLGIMWFIAFAGLSVYGIILGGYSSGNKYGLLGSIRASAQVIS
FT                   YEAAMGLAIISMIISYGSIHLTDMVNAQSGTYLGVIPMWGIFIQPLAAIIFIVCSFAET
FT                   NRAPFDLAEGESEIVAGYHTEYSAMKFGLFQVGEYAAMSASSAIIVTLFFGGYQIPWMD
FT                   TQTIQANINYVILAIIILLPIKIFIFTKWMKKNNKAIGEDKSRLKETKILTVLFWSICI
FT                   IVVGFLISFLVNGLGTNGVNIATAVIQIGTFLIKFFMMVFVYMWVRWTVLRFRYDQLQM
FT                   LGWKVLIPLALLNIVITAIIVVVGN"
FT   gene            complement(305405..306841)
FT                   /gene="nuoG"
FT                   /locus_tag="Abu_0309"
FT   CDS_pept        complement(305405..306841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="Abu_0309"
FT                   /product="NADH-quinone oxidoreductase, G subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00111 Fer2, score 35, E-value
FT                   5.5E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66584"
FT                   /db_xref="GOA:A8ERL0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL0"
FT                   /protein_id="ABV66584.1"
FT                   /translation="MAEVVNITINGVQMQATKGSLLIDKLLDENIHIPHFCYHQALGKD
FT                   GNCRMCMVEIEGQKRPQIACDTPVKDGMVVRTKGQNIEKVRRDILELELINHPIDCPTC
FT                   DQAGECKLQDYYMESGFYDSRVNLEVKNHARKRIDLGSNVMLDQERCVLCTRCVRFCST
FT                   ITKTNELGVISRADHSVIGTFPGRPLNNPYAMNVVDLCPVGALTSKDFRFKQRVWFLES
FT                   FDAICNGCSKACNIHVDHRKEKYKDDVIYRFRPRVNKAINGWFMCDEGRLSYTKENENR
FT                   FETPLINKNESDMNSVNASIFKELSTNKNILILLSPNLSYEEILNAKNLASKLNISISG
FT                   YSPNTIDETFGDDYLRNSDRSANRASFKELEIDETKEFFEEKLNNSSLVIIIENSYFEN
FT                   NLKLLENKKVISFFSHHCLTIGYSNIAVPVASFYEKTGTYINCDGIKQKVVSKMNKNEP
FT                   IKTITTIIEDLKSMIEKGTL"
FT   gene            complement(306878..308164)
FT                   /gene="gltA"
FT                   /locus_tag="Abu_0310"
FT   CDS_pept        complement(306878..308164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="Abu_0310"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="Pfam match to PF00285 Citrate_synt, score 541.9,
FT                   E-value 6.2E-160"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66585"
FT                   /db_xref="GOA:A8ERL1"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL1"
FT                   /protein_id="ABV66585.1"
FT                   /translation="MPKNTMTFTDNRNGKTYEYNIVDGTRGPSVVDISTFYKDSGMFTY
FT                   DPGYTSTASCESKITFIDGENSELRYRGYDITELAGKHSFLDVAYLLMRGKLPTPEASK
FT                   NFDLEIRHRSFLNEGIIRLFDALPDGAHPMATMGAATMALSAFYKDHLHLEDEDAFKMM
FT                   RRRILAKMPVIAAMAYRNSIGTPLIYPDVNRYFTENFLYMLRAYPGGRMKYLGDGKNQE
FT                   ITQIEVDALDAILTLHADHEQNASTTTVRNVGSTEAHPYVAIASGISALWGSAHGGANE
FT                   KVMDQLKLIGDVKNVPTYIAKAKDKNDPFRLMGFGHRVYKNRDPRAETLKGLQDKLREK
FT                   LNLDSKLLDIAAAVEKAALSDDYFKERGLYPNIDFYSGVILTALKIPVEMFTPIFVIGR
FT                   TPGWLAQWSELKQDPKHKIARPRQLYTGN"
FT   gene            complement(308189..309439)
FT                   /gene="nuoF"
FT                   /locus_tag="Abu_0311"
FT   CDS_pept        complement(308189..309439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="Abu_0311"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF01512 Complex1_51K, score 349.9,
FT                   E-value 3.9E-102"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66586"
FT                   /db_xref="GOA:A8ERL2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL2"
FT                   /protein_id="ABV66586.1"
FT                   /translation="MLTKIVSKNFDIPNSHKLEVALANGRYSSIDKLFTMKPEEVTAEV
FT                   TKSGLRGKGGGGAACGPKWELMPPVDERPRYLIVNGDESEPGTFKDRQIFQYDPHILIE
FT                   GIICTCWAIQANHAYIYIRGEYKFFIDRLNEAIKEAYEAKIIGDKIMDKYDFKVDITVH
FT                   RGGGAYICGEKSALIESLEGKRGHPRLKPHGKECEWFFDNPATVNNVETISSVPNIVEN
FT                   GAEGYTKYGTEKSPGTMLFAISGPVKNPGVYEMAYGNKMIDFLNVLGGGMLEGKKLKAI
FT                   IPGGSSCPILTASEVEKAVLDYESMWEIGSTLGTGGMIVIDEDTSMVEVAKNIIEFYHH
FT                   ESCGQCTPCREGTGWIDKILKKVIAGEASDKDLKTIMDVCDTLNGKTVCVFAPAVKDII
FT                   ASIVKKFPEEFKAYLKN"
FT   gene            complement(309429..309914)
FT                   /gene="nuoE"
FT                   /locus_tag="Abu_0312"
FT   CDS_pept        complement(309429..309914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="Abu_0312"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF01257 Complex1_24kDa, score 232,
FT                   E-value 1.2E-066"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66587"
FT                   /db_xref="GOA:A8ERL3"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL3"
FT                   /protein_id="ABV66587.1"
FT                   /translation="MNSFKYTSENEIKFQEYVSRYPKIDSCMLPALWLVQEQEGWVSPE
FT                   AMVYVADRLGKTPIQVYEVATFYTMFNLKPIGKYHIELCKTVSCMVCGAKELKQYIKDV
FT                   LGLESGQTSADGLFTFTEVECQGACGDAPMIALNNVYHGKLTKEKLEKIIWECKNAN"
FT   gene            complement(309914..311548)
FT                   /gene="nuoCD"
FT                   /locus_tag="Abu_0313"
FT   CDS_pept        complement(309914..311548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoCD"
FT                   /locus_tag="Abu_0313"
FT                   /product="NADH-quinone oxidoreductase, C/D subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam matches to PF00346 Complex1_49kDa, score 278.5,
FT                   E-value 3.7E-096, and to PF00329 Complex1_30kDa, score
FT                   99.1, E-value 1.2E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66588"
FT                   /db_xref="GOA:A8ERL4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR026662"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERL4"
FT                   /protein_id="ABV66588.1"
FT                   /translation="MLNCDMLIDSKELKSTISKLKNEDNYTILLDVTAVDYLKFPDVTP
FT                   SRFAVIYILRDSTFTKEITIKSYVDDNTLEIDSLYDLYESADWAERETFDQYGIKFVGH
FT                   PNLKRVLNHHQFIGHPLRKDYKITKGQICTETEDLMDEMVPKLKSKGYKKEEIDDLMLL
FT                   NVGPSHPASHGTIRNFVAMEGETITACVTEIGYLHRGFEKACEHHTYSQIIPYTDRLNY
FT                   CSAILNNIGYSKAVEEMLGIEITPRAKMIRVIIGELSRILDHLVCNAANMVDLGGLTNF
FT                   WYLFSPRDMAYDLLSKLTGARLTNTYTRIGGLEFDLYDGFDKDLEEVLKAVEKGVEDAL
FT                   SLIAHNRIYHDRTQDVGVIKADFALRNGISGPNLRAAGVACDLRKDKPYYGYENFDFDV
FT                   VIGSHGDVYDRMMCRFEEMRQSTKIIRQAMKNLPDGAINVYAPGVILPSKKDVYGNIEG
FT                   LMNQFKLTFEGIQVPKGEYYSFSEAANGELGFFIVSDGSGRPYKVKCRPPCFYSLAAYS
FT                   KIVEGTMLADAVVTMASMNFIAGEFDR"
FT   gene            complement(311541..312056)
FT                   /gene="nuoB"
FT                   /locus_tag="Abu_0314"
FT   CDS_pept        complement(311541..312056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="Abu_0314"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF01058 Oxidored_q6, score 170.9,
FT                   E-value 2.9E-048"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66589"
FT                   /db_xref="GOA:A8ERL5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERL5"
FT                   /protein_id="ABV66589.1"
FT                   /translation="MGLGVESKLGDSIVTTRLDHAVNWGRSYSLWPMAFGTACCGIEFM
FT                   AVAGAKYDVSRFGAEVVRFSPRQADLLIVAGTISYKQAPILKKIYEQMCEPKWVISMGA
FT                   CACSGGFYDNYTTVQGIDEIIPVDEYVAGCPPRPEAVLDAIMRIQEKAKTESIIKDRVK
FT                   EYKGFLDA"
FT   gene            complement(312047..312409)
FT                   /gene="nuoA"
FT                   /locus_tag="Abu_0315"
FT   CDS_pept        complement(312047..312409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="Abu_0315"
FT                   /product="NADH-quinone oxidoreductase, A subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Pfam match to PF00507 Oxidored_q4, score 116.7,
FT                   E-value 5.9E-032"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66590"
FT                   /db_xref="GOA:A8ERL6"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL6"
FT                   /protein_id="ABV66590.1"
FT                   /translation="MSTELILASTIFIAIALVLASVFVLTKFIGPRNENSEMKNSVYES
FT                   GITTPIGTTNIRFSIKFYLVAISFLLFDVEIIFMFPWAINVVELGYAGLFKMFVFMGLL
FT                   FAGLIYIYKKKALSWD"
FT   gene            complement(312542..313708)
FT                   /locus_tag="Abu_0316"
FT                   /note="AB0313"
FT   CDS_pept        complement(312542..313708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0316"
FT                   /product="aminotransferase/L-cysteine desulfhydrase"
FT                   /EC_number="2.6.1.-"
FT                   /note="Pfam match to PF00155 Aminotran_1_2, score 101.4,
FT                   E-value 3.3E-028"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66591"
FT                   /db_xref="GOA:A8ERL7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL7"
FT                   /protein_id="ABV66591.1"
FT                   /translation="MIYNFDEETNRKNTNCAKYDGLKKYFGYEDLNPLWVADMDFKTPS
FT                   FINDAIVKAASNSLYGYSVDTPELYASIINWQKNEHDWEIEQKDIFMINGVVPAYSACI
FT                   EAFSEVGDEVIVQTPIYPPLFKCVKANERKLVINELKKDENGYYTMDLEDLEKKITSKT
FT                   KILALCSPHNPVGRVWSKEELEKLANICIKHNITIVSDEIHSDITFKKFTPLASISKEI
FT                   ANQTITLNSAGKTFNIAGLNCAYAVCKNTEILEKFKKVAIKREINSINFFGYVSTRAAY
FT                   ENGSAFVKELKAYLMNNIIFTKDFFEKNSLNIDFFIPEATYLLWLDFSKTGLSHLEIKN
FT                   ILLTKSKIALNDGVSFGSNGNKFFRLNTALSKKALNIALNQFVKNFSK"
FT   gene            313793..315604
FT                   /locus_tag="Abu_0317"
FT                   /note="AB0314"
FT   CDS_pept        313793..315604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0317"
FT                   /product="carboxylyase-related protein"
FT                   /note="Pfam match to PF01977 UbiD, score 503.1, E-value
FT                   2.9E-148"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66592"
FT                   /db_xref="GOA:A8ERL8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL8"
FT                   /protein_id="ABV66592.1"
FT                   /translation="MKKAIELLKKNDLLRVIDDELDIYLEIPHVAYIEVKKEDSKALLF
FT                   TNVVDKKSNKKFDIPVLMNVFCNEKAVKLFIGDGDKIGAEIESLLKMKPPSTFSEKLST
FT                   FGKLFALKNVVPKRLKGKGECQEVIKLGTDAKLSDLPILTTWEQDGGPFITMGQVYTTS
FT                   LNGELKNLGMYRLQVYDDQTLGMHWQIHKDSNHFFHEYKKAGKKMPVSIGIGGDPMYIW
FT                   CGQAPLPIGIFELMLYGFVKNKNAQLVKSITNDIYVPKDNDFIIEGFVDPSKMRIEGPF
FT                   GDHTGYYTLEEEYPFMEVSAITSKKNPTYLATVVGKPPLEDKYMGFATERIFLPLLKTT
FT                   APDLIDYYMPENGVFHNLIIAKIKTLYPGHASQMMHAFWGVGQMSFVKHAIFVNDDAPE
FT                   LTNHEEIIKYILNRINIEDMLISKGVVDALDHSSPKFAIGGKLGLDCTGDEVKELGITL
FT                   LEDDELLQKMQNISNEVKDLKQYFKDTKNPICVISIDKTKNQKYLFEELKPLFSHIKIL
FT                   IIVDSAKNDVNNPYMLVWRVANNIDSNRDIFIDGHTIGVDATDKNSFDNFNRRWPDDVD
FT                   CTKSVLDSLRERKIIDVSDEFINKFYL"
FT   gene            complement(315626..316093)
FT                   /locus_tag="Abu_0318"
FT                   /note="AB0315"
FT   CDS_pept        complement(315626..316093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0318"
FT                   /product="conserved hypothetical membrane protein (DUF1212
FT                   domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66593"
FT                   /db_xref="GOA:A8ERL9"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERL9"
FT                   /protein_id="ABV66593.1"
FT                   /translation="MDFVLKLIVEGLFASFAAVGFAIVFNVPKETLKYCAIGGAIAYDV
FT                   RTVLLNLNLGIELSTFLASTIVGIIALYWSRKYLIPRPVYTVASIIPIIPGTFAFSAMI
FT                   SLVDMNTHGVTPELIQVFLYNGLKAVAILGAITFGLALPSLYFMRFNRPII"
FT   gene            complement(316095..316868)
FT                   /locus_tag="Abu_0319"
FT                   /note="AB0316"
FT   CDS_pept        complement(316095..316868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0319"
FT                   /product="conserved hypothetical membrane protein (DUF1212
FT                   domain protein)"
FT                   /note="Pfam match to PF06738 DUF1212, score 166, E-value
FT                   8.7E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66594"
FT                   /db_xref="GOA:A8ERM0"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM0"
FT                   /protein_id="ABV66594.1"
FT                   /translation="MEKLSYQEQTIITRGIIKSAVLMSEYGAESILIEQTAQRLGRALG
FT                   VDSVEISMIPSAIVLTTLNNGQSVTTTRRVHHKPINMSIVCQIQKIVLNMEKNEHDINY
FT                   LYTILKNLEPNYYNRWLVIFVVALACGSFAHLQGSDWGAFFITCLAAGTAMFVRQELSK
FT                   KRFVMIITFGVTAFVATLIASISQLDGISQTPHIALASSVLLLAPGFAFVNSFLDSLKG
FT                   YLMMGWGRWMEGFLLTIATSLGIILAMAVLNIKGW"
FT   gene            316929..317261
FT                   /locus_tag="Abu_0320"
FT                   /note="AB0317"
FT   CDS_pept        316929..317261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66595"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM1"
FT                   /protein_id="ABV66595.1"
FT                   /translation="MKKLTTYYTNKNILFKEIKQIFPKEIDSRKKIDIYSATTIDSKFY
FT                   AIFIVDSKSRFIRKNAQDLMELCEKLASYLGHNFKKKELLVSSPLCSKAKEYLKQNDWS
FT                   VRVDFM"
FT   gene            317230..317874
FT                   /locus_tag="Abu_0321"
FT                   /note="AB0318"
FT   CDS_pept        317230..317874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0321"
FT                   /product="transcriptional activator, putative, Baf family"
FT                   /note="Pfam match to PF03309 Bvg_acc_factor, score 39.6,
FT                   E-value 1.9E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66596"
FT                   /db_xref="GOA:A8ERM2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM2"
FT                   /protein_id="ABV66596.1"
FT                   /translation="MIGVLELILCDIGNTTFHFLINGKHKKYFLDEKVPKFDEEIYFVS
FT                   VNEKASKKLLKKNPKAKDIKEILNFETKYQGLGIDRKIACSFQKDVIVVDAGSAITVDI
FT                   MENDEHKGGFILLGVQSFINAYPKISKKLKFDFEKNINLDKIPLRTFDAIQYAMLKSII
FT                   LPIKEVSLNKKIIFTGGDGEFLSKYFENSIYKKDLIFENMKRIIDANNCIA"
FT   gene            317852..318460
FT                   /gene="hisG"
FT                   /locus_tag="Abu_0322"
FT   CDS_pept        317852..318460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="Abu_0322"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="Pfam match to PF01634 HisG, score 182.1, E-value
FT                   1.3E-051"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66597"
FT                   /db_xref="GOA:A8ERM3"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM3"
FT                   /protein_id="ABV66597.1"
FT                   /translation="MLTIALPKGRIADETLDRFEKAFGEKFVFEDRKLILKKSGFTFLN
FT                   VRNQDVPTYVMHGAADLGVVGLDVLEEKEYDLIKLLDLKLGRCKVAFGLRAGEKLNFDK
FT                   SKITIATKHEKIAKKYFEEKAMAVEIIKLYGSIELAPLVGLCDCIVDIVETGETMKQNG
FT                   LEVGPTIMESSAHLISNKNSFYAKKDLILDLKEKIEVFL"
FT   gene            318460..319152
FT                   /locus_tag="Abu_0323"
FT                   /note="AB0320"
FT   CDS_pept        318460..319152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0323"
FT                   /product="conserved hypothetical protein, putative
FT                   methyltransferase"
FT                   /note="Pfam match to PF08242 Methyltransf_12, score 50.5,
FT                   E-value 5.3E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM4"
FT                   /protein_id="ABV66598.1"
FT                   /translation="MGLDLYAKVEPYLDFEEEVYTLHKEFLRFVMVNDLDNIIDIGCGQ
FT                   GYFLENLKVNKKKYFGIDLSVEQIKVCQEKNLNAQAIDLKDVKEKFDCATAIFDVLNYI
FT                   PKNELKIFLEQTYEILNQNAYFIFDVNSYFGFDEVAQGTITIDAEDKFIAIDANFENNK
FT                   LQTDITLFEKQENGLFSKEQDSIIQEYHSKEFLTKILEEIGFKLIEIKEFNLHTDEIAD
FT                   KLIFICKK"
FT   gene            319275..321203
FT                   /locus_tag="Abu_0324"
FT                   /note="AB0321"
FT   CDS_pept        319275..321203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0324"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam match to PF00015 MCPsignal, score 136, E-value
FT                   9.4E-038"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66599"
FT                   /db_xref="GOA:A8ERM5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM5"
FT                   /protein_id="ABV66599.1"
FT                   /translation="MNKNSLKLKLLIITMVPFILGIFILSGINFEKTQHTLNSTLSKFE
FT                   NTITREKESLIRHQFEVVQTLIQTVINSEKDTQVAKAKVIELLSGIRYLDDKSGYFFAY
FT                   EKRDDDYYFGFHPANPALNNTKTDIKAPDVKGYAFREDLIKYAKEQKYITYYYQNPATK
FT                   EVVLKMASSIYIPQFNWVLVTGIYADDIEREIKQLTVEINKDINTLFWIAIIVTILLSI
FT                   VLVFIIIPSINKIIIKPLNIFQDTLETFFKYLNGESKEVHRIKNYSKDEIGQMSKTLDK
FT                   NIEIARKEIDDNNIFIENTITILSKFQNGDLSQRLNVEVDVPNLVKLKSVMNKMAEELE
FT                   QNIVNVLKVIDEYSEYNYVNKVDTAKFSNHILKLANGVNNLGDSITKMLVENKTNGTTL
FT                   AHSSNILLENVDKLNKSSTSTAANLEETAASLEEMTSNLRSSTENVQKMSSIASSVTNR
FT                   AKNGEELANQTVESMQEINSQITSINEAITVIDQIAFQTNILSLNAAVEAATAGEAGKG
FT                   FAVVAAEVRNLATRSAEAAREIKEIVESATSKANDGKVIATQMINGYTELNKDIMETIE
FT                   LIKNFENSSKEQLLGIEQINNAVSILDQKTQENAQVTSHTRDIALSTDNIAKLIIKDVD
FT                   EKNFIDK"
FT   gene            321178..322050
FT                   /locus_tag="Abu_0325"
FT                   /note="AB0322"
FT   CDS_pept        321178..322050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF06977 SdiA-regulated, score 49,
FT                   E-value 1.5E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66600"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM6"
FT                   /protein_id="ABV66600.1"
FT                   /translation="MKKILLINKKLLIFFLTIITFVVIHSMDLDDKLLYKFFHWEEEFS
FT                   ILKQNHKKELVVINEIEKNLSGITYNENTDTLFAITNSPRDIYELDKNGNVLRKISLKG
FT                   FKDTEDITYIKDNKFAILDEELNGLFIVDINDDTKFISIEDSIKKFIFDIKKFENFGLE
FT                   GISYDKTEDKFYMVNERNPKKIVSVKGIIGNNQLEVNIKDELLENNFYLADLSAIHFDD
FT                   IDRRLYVLSDESALLGRIDDKKDFKKYLDLMDNEISSKMKNSEGITRDKEGNIYIVSEP
FT                   NLFFSIKKE"
FT   gene            322146..322751
FT                   /locus_tag="Abu_0326"
FT                   /note="AB0323"
FT   CDS_pept        322146..322751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66601"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM7"
FT                   /protein_id="ABV66601.1"
FT                   /translation="MIYPQFFNKIPTIKLQDDLASFLGAFEDGLIEFSYLDVVKSAGHS
FT                   CPTVLGAYLMTLKGLEALYKNEIPKRGEIIVEFKEAQNVGVVGVIGNVIMNITGATTTN
FT                   GFKGLAGKYDRNHLMKFEQDINSANVRFTRVDTLKSVDVFYDTSSVKPHEDMNFLMQKS
FT                   LQGNATNEEKKEFAKLWQKRVEDISNNINEVIKIDIKE"
FT   gene            complement(322769..323734)
FT                   /gene="trpS"
FT                   /locus_tag="Abu_0327"
FT   CDS_pept        complement(322769..323734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="Abu_0327"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="Pfam match to PF00579 tRNA-synt_1b, score 187.6,
FT                   E-value 2.8E-053"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66602"
FT                   /db_xref="GOA:A8ERM8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM8"
FT                   /protein_id="ABV66602.1"
FT                   /translation="MRILSGIQPSGTIHIGNYFGMIKKMIESQNEGELFAFLASYHALT
FT                   SVKDKEALENNTYEAAINFLALGMDPEKSTFWVQHDVKEVLELYWILSNHTSMGLLERA
FT                   HSYKDKTARGIVAGHGLFSYPVLMAADILLFDSNIVPVGKDQIQHVEMTRDIATSFNHA
FT                   YGKEIFILPEAKVDEIVATVPGTDGAKMSKSYNNTIDMFTSPKQRKKQVMGIVTDSKEL
FT                   DEPKEWETCNIYTLCKLFMNEDELKDLQKRYATPGEGYGHFKMTLLEKINQYFAPYEEK
FT                   REYYLNNKKEVREILAFGASKAKKIASAKMEIIRDTVGLI"
FT   gene            complement(323774..325879)
FT                   /locus_tag="Abu_0328"
FT                   /note="AB0325"
FT   CDS_pept        complement(323774..325879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0328"
FT                   /product="TonB-dependent receptor protein"
FT                   /note="Pfam matches to PF00593 TonB_dep_Rec, score 101.5,
FT                   E-value 2.3E-027, and to PF07715 Plug, score 67.1, E-value
FT                   5.2E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66603"
FT                   /db_xref="GOA:A8ERM9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERM9"
FT                   /protein_id="ABV66603.1"
FT                   /translation="MKPIKKTITYSICLSMSLLSQTFAQETTLLDEIKVSTENSNYSTQ
FT                   NDNYYKTKSQSATKTDTPIRETPQSVQVVSNEIIKELNAVKIEDVLDYTSGVSRQNNFA
FT                   GMWDNFSIRGFAGNENTGMSLLKNGFADNRGFNAPRDTANIESIEFLKGPSGSLYGNSE
FT                   PGGTINIVTKQPKFTSEHSIKTDVGSYDFYRMALDSTAPINDNLAYRLNVATEKKGSFR
FT                   DHIESQRYVVAPSLLYSINDDTFVSYMGEFIEQKAPFDRGIALIDGKNVMNPKNFLGNP
FT                   DDGDVTLKNQTHQLKLEHYFSDSWSSRMGVAYKNNSLKGFGSEVTPATKITTDSINLRT
FT                   RYRDYSSDDIQFQVDLQNVTDIKDATNTLLFGVETYRFEQDSILYTNKDTVRVDNIRSN
FT                   PTYTVLKTGLGSLSTDKYEEQKGVALFVQDEIAYKDFRFLTGLRYDEVRMDNVNHLDSS
FT                   SVKQNDYAVSPRVGITYLIDDMWSVYTTSGTSFRPNTGTDIDGKTFESERSVSIETGLK
FT                   FESEDKKTGGTLSLYQIEKKNVLTKDPNDDLFSIAAGKVKSKGIEFDFNGKITDNIKAN
FT                   FNYTYTDAKVVEDSTYEGKELLNIPKHTSSVLLMWEDTLSLNSSYGIGTGVTYVGRKAG
FT                   NVNNDFYLPDYTTAKIVSYYKVNKELNFSLNIDNLFDKEYIASSYDRSWLTVGNPRTAT
FT                   LSMTYKF"
FT   gene            complement(326001..327164)
FT                   /locus_tag="Abu_0329"
FT                   /note="AB0326"
FT   CDS_pept        complement(326001..327164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0329"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66604"
FT                   /db_xref="GOA:A8ERN0"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN0"
FT                   /protein_id="ABV66604.1"
FT                   /translation="MNTTSTTQQLNQRLFSIDILRGFVMVIMILDHVRETFFLHYQMIV
FT                   PIDIASTDTILIICRFLAHICAPTFIFLTGLSAYLYMQKVQSKKETSWFLFTRGLFLIF
FT                   LELTLVNFAWTFEFPMEKLYLQVIWAIGFSMIFLSVLIYLPKKILFIVAIIIVFGHNLL
FT                   DSVHFEKDSIFYIPWAVLHERTWIEFSQDFKLRTSYPILPWIGVISLGFIAGEWFNKNV
FT                   NFQTRKNYLIKTTLILLSSFIVIRFINVYGDTPYINYDSISNTILSFINVSKYPPSLLF
FT                   ILLTLGICTFLLMLFEKYQNLKSISWLKNFGAAPMFFYLLHLYFLKFLYLSAVAIYGLN
FT                   QGQYFGLSQTWQMPLLSILFAFILYFPTKWYANLKQKRRDIKWLKYL"
FT   gene            complement(327248..328423)
FT                   /locus_tag="Abu_0330"
FT                   /note="AB0328"
FT   CDS_pept        complement(327248..328423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0330"
FT                   /product="MFS family, AmpG related permease"
FT                   /note="Pfam match to PF07690 MFS_1, score 94.5, E-value
FT                   2.9E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66605"
FT                   /db_xref="GOA:A8ERN1"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN1"
FT                   /protein_id="ABV66605.1"
FT                   /translation="MNQLTKKNILFSILFTAILTPMIFFVMGLPMILQIKGFDASLIGI
FT                   FQLAGLPMIFKFLMSPPIDKIVFEKKHYKKWTFYIGILYILLLTIISFLSLENSIYPVF
FT                   IAILITAFISTFMDIPLNALAIKTFTKEQSLSAGSYKISAYSMASLLGGGIFLLVFNHL
FT                   GWNLTFILMALLVLFSLFALYFIEENDEIIYVEKISSKNIITFFKQKDVGIWIFILSFY
FT                   FVSISALWVFMKPYLIHKGVKPDDVAIWVGIYGSFIAILGGALSNYIGKKFSKKSLLII
FT                   FMFFNIFSTSLLIFIEQYNLTFYYLIISVTFIALAIALSSAIIFSMIMDYSRKESRAID
FT                   YSVQSSIFSFTRIISAVIAGIIVSNFGFDKMFIFELFCLVLVTFVIYKKYI"
FT   gene            complement(328427..329416)
FT                   /locus_tag="Abu_0331"
FT                   /note="AB0329"
FT   CDS_pept        complement(328427..329416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0331"
FT                   /product="O-methyltransferase"
FT                   /note="Pfam match to PF08242 Methyltransf_12, score 53.2,
FT                   E-value 8E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66606"
FT                   /db_xref="GOA:A8ERN2"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN2"
FT                   /protein_id="ABV66606.1"
FT                   /translation="MQNINNYLSLLLAQQKTEILELALELKIFKLIEENINTIFIISSK
FT                   ININEHKTKILLDSLVFMELLDINQDKYLNTKFAKESFIYGASSYCGDVFLHRKQLAEN
FT                   GKKMMKSMFEEKKELEEIKIPKLWADASKKFLKQEQKNLIAPMAVDIIKNLKEFSSLNK
FT                   MLDLGCSSGVIGLEITKNHPNIKTTLFDYEEVTNITKEHINEYNLQNRVFVLSGDIEKN
FT                   DIGKNYDLIWCSNIFYFFKDKKEVIKKIYDALNPNGILVSCHVEIDTKNSLDENSFFYF
FT                   LSLNLQGKNILKPMELSDIFEEVGFKSINSYTTYKTPMTPSQIHICKK"
FT   gene            complement(329419..329643)
FT                   /locus_tag="Abu_0332"
FT                   /note="AB0330"
FT   CDS_pept        complement(329419..329643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66607"
FT                   /db_xref="GOA:A8ERN3"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN3"
FT                   /protein_id="ABV66607.1"
FT                   /translation="MIEKKYEKLVFIIVMSFIMSCIMSFIVSFINLGLIDDFFIKWIEA
FT                   WIKAFIISIPIVSVVVPISKKIVFKIIKG"
FT   gene            complement(329652..331721)
FT                   /locus_tag="Abu_0333"
FT                   /note="AB0331"
FT   CDS_pept        complement(329652..331721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0333"
FT                   /product="TonB-dependent receptor protein"
FT                   /note="Pfam matches to PF00593 TonB_dep_Rec, score 86.1,
FT                   E-value 1E-022, and to PF07715 Plug, score 68.4, E-value
FT                   2.1E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66608"
FT                   /db_xref="GOA:A8ERN4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN4"
FT                   /protein_id="ABV66608.1"
FT                   /translation="MILTITFLKYILEQINFILKEINIMIKSKTINLSFLAFILLTNNL
FT                   VAKEETTTLEAITVTAQKKEENVQKVPISVSVFDEMSIEDKSIDSLEDIAKYTPNLMLY
FT                   NTGQEGLIVPSIRGISGNVLSYSTPVGLYVDGVPTTSAFGFDDAIGDIERIEVLRGPQG
FT                   TLYGKNSEAGVINIITKQPNNETRGKIFSTIGNEGRKDIGLNVSGPIIKDKFYAGVAYK
FT                   HKEKDGFIKNTVTNEYINDKKSDYAKLILRATPTDNLDVSLISSINKEDNGDHNWVSST
FT                   NNKKEVTSNLKGSSTPKDTTFALNVNYNIDENSKIKSITTKKEYKDKAIVDADFTPLTL
FT                   RHIYKNNELNTISQEFRYETIFNKTELISGIYLDKKDDDLYTRIFAPFNPTGFANPQDM
FT                   SSRSIGIFTNIIHPLNDFWVLNAGIRYDKEKKEMEVKNTTIDLENSYSSVSPKIGIQYN
FT                   INENQMSYFTIAKGYRSGGFNPFATSNAQAYDEENLISYELGYKGMFFDNRLKFNTNIY
FT                   FMDIKDMQVEETPMLGTTYMVNAATATSKGFEVEIEGVISDEISLFASAGVNETTFDDF
FT                   KDLAGDYSGNYNPLAPKYNFNIGTLYRANNGLYARVDFNGYGKTYFDKANTTSQKAYSL
FT                   VDTKIGYEANDFDIYFYVNNLFDKDYDAIGAYFSGTTTILRPEQEFGIKLAYRF"
FT   gene            331763..332692
FT                   /locus_tag="Abu_0334"
FT                   /note="AB0332"
FT   CDS_pept        331763..332692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0334"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66609"
FT                   /db_xref="GOA:A8ERN5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN5"
FT                   /protein_id="ABV66609.1"
FT                   /translation="MTKYYLKDLISSNLNSKKNIIKNSFPLEIGTDYMEKIYIQDGFLF
FT                   SKTNYNIEKPIFLEAKQEERKFVITISLKGNTTYINSGDKKIIPFKEGFTTISLFENTQ
FT                   GFREFKDKQINQIRLILSESFLRRNFQKSLVEKYFFNKQNLQLIDFRLTSIQSQFLLND
FT                   ILNCSLVGELANIYKQGKIFELLSLEISKLQKNEDDIFLDDYDRSAILKAKEILLNNLQ
FT                   NPPSIVGLAKMVHLSEVKLKRGFKQIYKTSPYQLLVSHKMNLAKNMLESGEYNINEIAL
FT                   QVGYKFANNFTNAFYKEFKIRPKDILKK"
FT   gene            complement(332681..333220)
FT                   /locus_tag="Abu_0335"
FT                   /note="AB0333"
FT   CDS_pept        complement(332681..333220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0335"
FT                   /product="conserved hypothetical membrane protein (DUF204
FT                   domain protein)"
FT                   /note="Pfam match to PF02659 DUF204, score 70.3, E-value
FT                   5.8E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66610"
FT                   /db_xref="GOA:A8ERN6"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERN6"
FT                   /protein_id="ABV66610.1"
FT                   /translation="MLEVLILAFALSMDAFAVSIGLGIKNKQNLKALALKAGLFFGIFQ
FT                   ALMPFLGFLGGIGLREYIQGYDKIVAFILLLAIGGKMIYEAFNENVEEEISQITNKILL
FT                   TLAIATSLDAMAAGYSLHLFNLNIYLSLFVIGFTTFIISYIGVYVGSRGGEKYESKAEI
FT                   LGGVVLILIGLKILLF"
FT   gene            complement(333214..334389)
FT                   /locus_tag="Abu_0336"
FT                   /note="AB0334"
FT   CDS_pept        complement(333214..334389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0336"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="Pfam match to PF07690 MFS_1, score 159.7, E-value
FT                   7.1E-045"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66611"
FT                   /db_xref="GOA:A8ERN7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN7"
FT                   /protein_id="ABV66611.1"
FT                   /translation="MKEIKPLMVITILCVSSMMAFLAVVGPIVRNLGLQEWHAGVMVAL
FT                   AGIAWIFLSRFWGKKSDIYGRKNILLLAIFGFFISYLLLAIFVNYAVITPPLVIISLLV
FT                   LVATRLLIGVFYSAVPPVSNALIADKVEAQKRTSYMASLGASNGLGMILGPVLGGALAS
FT                   FGLAIPLYAAAILPLLAVFMVLFFLEKDKKIQKTKDTPLHFFDKRLRLPMIASFITMFS
FT                   IVTSQVCLGFFILDKFQMNEIDTAKTTGYILAIIGVVFIATQIVVSKLKNVKSISWLIL
FT                   GSIFATIGYFLISLISSKIELTLAFCIGTIGLGMIMPAFMAITSNSVNSNEQGIAAGTV
FT                   SSAQGFGIIVGPLLSTVLYKISPEFPFLFASLIFAILVIISLSYKKRGILC"
FT   gene            complement(334386..335594)
FT                   /locus_tag="Abu_0337"
FT                   /note="AB0335"
FT   CDS_pept        complement(334386..335594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0337"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="Pfam match to PF07690 MFS_1, score 67.7, E-value
FT                   8.6E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66612"
FT                   /db_xref="GOA:A8ERN8"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN8"
FT                   /protein_id="ABV66612.1"
FT                   /translation="MKKKLTWSAMTLLFSLYTTQFLGLGFFMEAFIGILRQNGVPLENL
FT                   GFIYMLGLFWVFRFLWAPFIDRIYFKKMGHYRAWIIIFQSLMVITIFAISILHINEHLN
FT                   IIIFLAIFFAFFAASQNIALDAFAFKITFKKERSIINAIKTSGGLIGMALGGGVGLILY
FT                   SKIGWHFTMFIMTIVTAISLLQIIFFSEPTMKHDYFIEKINYKQFFTFWKTKEKKLWFI
FT                   LLFVYPVTISSAFGLTTPLLVDLGWALDKIGFAVHIVGYGIGFLASFGASYVINKFGRK
FT                   NILIFAAFGQVIGILMMLLLFNHHNNDILVMFVIGLVFMFYTPSQVLMNTIMMDLSSKK
FT                   TPASQFAIQHSIYMFSGIFFSSMSVSMSGILGYEKIILICAVIGLISMYLSTKIEYIIK
FT                   GKE"
FT   gene            complement(335591..337372)
FT                   /locus_tag="Abu_0338"
FT                   /note="AB0336"
FT   CDS_pept        complement(335591..337372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0338"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Pfam matches to PF00005 ABC_tran, score 208, E-value
FT                   2E-059, and to PF00664 ABC_membrane, score 34, E-value
FT                   8.3E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66613"
FT                   /db_xref="GOA:A8ERN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERN9"
FT                   /protein_id="ABV66613.1"
FT                   /translation="MYKEKISSFWNSYKITLEVAKGKEALIKRSYLYFIISFIFQGLAF
FT                   AFFYPLLNTIFSDNFDLNKTIFWFGVIVLLSLFSFIFKWLASNFNYSGDLVETTHDLRV
FT                   RLGEKIKTMPLQKLYSYRTGELNSILASDVDASVLHMGIIAGMFFEIAIVPFVIIVATF
FT                   FINPILAIALLIAIPLSIPIYKWSRKETKWEKTEVTKANATLEADTVEYLQGLPVLRAV
FT                   NQIGLNAKQLQKSIATVREVQKKGLFASSIPMVIMNTLIEFLFLFILTIGTIFILKGEL
FT                   TLATLLALLIILSRLSEPLANFLAVTAVLDIMEAGFRNIKKLLDIKEFEIQKPIQNPKN
FT                   FDITFDNVSFSYDSNNQKVLQNLSLNIKENSLTAIVGPSGSGKTTITKLIMRYADPSNG
FT                   DIKIGNINIRQMKQHTLMSYISVVFQDVYLFDDTILNNIKMGKPNATKEEVLVASKAAF
FT                   VHEFVSRLPKGYDTKVGEIGGSLSGGERQRISIARAILKDSPIVILDEPTSALDTQSEV
FT                   AVQAALDELIKNRTVIVIAHRLTTISHANNILVIEDGKLKESGTHENLVSLKGKYYSMF
FT                   EAQQRVKEWNINNKGTL"
FT   gene            complement(337365..339158)
FT                   /locus_tag="Abu_0339"
FT                   /note="AB0337"
FT   CDS_pept        complement(337365..339158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0339"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Pfam matches to PF00005 ABC_tran, score 210.6,
FT                   E-value 3.3E-060, and to PF00664 ABC_membrane, score 36.2,
FT                   E-value 2.2E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66614"
FT                   /db_xref="GOA:A8ERP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP0"
FT                   /protein_id="ABV66614.1"
FT                   /translation="MKKQKVGLWAIMSPVKFKIRLAMLLASIGAISLISSLLLLSLTLS
FT                   NILINTPLIIFCIELDLIKTILLLAILTIIAFVSRLAGFIVSHLGAFHLEQILRTNLSQ
FT                   HLATVPLGYIISNGSGTLKKVMQDDVKTLHTFVADSTPMIAKSIVAPISTLIILLIIDY
FT                   RFALATLSVFILGWITMAFSMRDSKTLRIKYEKSQSNINKAVIEFAQAMPVVRTFDDGT
FT                   TSFKRYNDALLEYKTNLQHWMNISAFSAKLGMIILSPLPTLIAVLITGIYLLNFGTLEL
FT                   FAFISALFLSTGMADAMMPLMWINNHIKKSQASALRIQEVLEIKSLEIPKETKTIKTYD
FT                   IEFENVSFKYDSVEKYALKNISFKAKEGSVTALVGPSGAGKSTVAKLIPRFWDVTSGEI
FT                   KIGDVNIKELSSETLMNTVSFVFQDTFLFQDTIYNNIKMANEKATKEDIVNACKAAQIH
FT                   DFIQSLPDGYETLAGDRGTNLSGGQKQRITIARAILRNTPIIVLDEATAFADPENEEEI
FT                   VKALANLTINKTVIMIAHRLSTIKDSDQIIVFDEGKISEIGKHDELLEKQGIYSKLWSN
FT                   YEKASSWNLEKIEDKKGKNNV"
FT   gene            complement(339261..341348)
FT                   /locus_tag="Abu_0340"
FT                   /note="AB0338"
FT   CDS_pept        complement(339261..341348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0340"
FT                   /product="TonB-dependent receptor protein"
FT                   /note="Pfam matches to PF00593 TonB_dep_Rec, score 86.1,
FT                   E-value 9.6E-023, and to PF07715 Plug, score 76.7, E-value
FT                   6.5E-020"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66615"
FT                   /db_xref="GOA:A8ERP1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP1"
FT                   /protein_id="ABV66615.1"
FT                   /translation="MLKKKNIILFSLFVSSLLFANETTKLEEITVSANKMEENIQDVPQ
FT                   SITVIDEETIEQKGIKNISDVIKEVPNMNIMANTGMGTTTSFRGLNASMFTNNNPVVIY
FT                   IDGVPYYDRFDFNPSLANVEQIEILRGPQGTLYGKDAIGAVINITTKSPSNEWHGNIGA
FT                   EYGNDNTFNTKLNTSGAIINNKLFAGINGSYNHSDGWITNHYPGMKEDANEKNDRKTSG
FT                   FLLYKPTDELSAKLTLADNYTKNYFMDGFSSDPSLDINSLKRKDAENANYDVPAWDKQK
FT                   VKSQALNLSYELEKVKIDSTSTHKKFDLNAEFDSDNRADNANDGLRQWNYTKVDTYSQE
FT                   LKLSSKNQDIKWVTGLYFDKENRKQGPYGAEQLYLGAVYVGDAYSDSDSKTQAIFGQTM
FT                   IPLGEDFELTLGGRYQKINKEIDVVAKSSWAGMSIPDVSYEDEKTWNTFLPKAALSYKI
FT                   NDNLTTYVSVSKGYMPGGFNYYPSTSNGQDNTFEPQKSTNYEIGAKYIGDSFALNTSIF
FT                   RMDIEDIHVYKQLMGGTVFATSNAKKAHSQGIEVDGTYFLTDNLSLFGAVGLIQAKYDD
FT                   YDNGTRKYDGEKIENTPSYTANFGISYLANSGLYGRLDFNARGNTSYLDGGNNDRLIRA
FT                   DGGITANTKIGYRIKNWDIYSYVNNITDEDYVTSYMSKSGSSWVGFNDPRRFGIGAIYK
FT                   F"
FT   gene            341462..342424
FT                   /locus_tag="Abu_0341"
FT                   /note="AB0339"
FT   CDS_pept        341462..342424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0341"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Pfam match to PF00165 HTH_AraC, score 26.4, E-value
FT                   9.1E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66616"
FT                   /db_xref="GOA:A8ERP2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP2"
FT                   /protein_id="ABV66616.1"
FT                   /translation="MSHNFTIDDISEFMSSSSNKEFNLTFPDNFGYMNCKKEIVSDDIY
FT                   LFKTHAQANKDFSIQTNSKVDSLFINIILDGKVQYQSNTDDKIETFKKNDTYIKYIDEA
FT                   DSMTALDKNSFSKGLAISIKNDFLEKQLSTYSYLLDKIKTSSSFIHRVDNSLNIKLANE
FT                   LFNSPFTNELHNIYLQSKVLEIIYNQIKEFEKCFCKKECNCEKIKLSNEDIQALYKARD
FT                   IVLLTHDFPDLSTLARKVAINEFKLKFGFKKLFNTTVGQMILEHKMIHAKQLLETSEFS
FT                   ILEIANFVGYKYQQSFSNAFFQFFGLRPKDVMKSRNYYY"
FT   gene            complement(342451..344481)
FT                   /locus_tag="Abu_0342"
FT                   /note="AB0340"
FT   CDS_pept        complement(342451..344481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0342"
FT                   /product="TonB-dependent receptor protein"
FT                   /note="Pfam matches to PF00593 TonB_dep_Rec, score 93.2,
FT                   E-value 7E-025, and to PF07715 Plug, score 36.2, E-value
FT                   1E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66617"
FT                   /db_xref="GOA:A8ERP3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP3"
FT                   /protein_id="ABV66617.1"
FT                   /translation="MKSNHNKIKKLSLTLLVPCISFAQTTVLDEIEIKEKKELKTNSMN
FT                   IDLEKTEQEQANSFKEIFKNNSSIEIGGGAINVQRIYLRGIESSNLNISLDGAKQGKNM
FT                   FQHRSNELGINPDLLKIVDIKTAPDATKNSALGGSIEMSTKDAQDFVKGNKNYGSIFKT
FT                   GYNTNAKQKYGNATTYQVFNDYVGAYASVSGVNSDNYKDGNNNEEIATAYHDRDYLFKI
FT                   SMLNANDHDLRLTINHNENSGDTRWRGTEYRPLPSELEKIVSSTTNYALQHNYNPNNLI
FT                   NLDTDLNLTNITLEREDENQKYENQNIGLKVQNHFDFDISSSSNRVSLGAQLQKENGEG
FT                   PLIPHNLDKNITQYSDLDSSTKSLFVQNRTQINSLGIDYGLRFDKYDFETGLGKASDDT
FT                   FSPNMGVDYSITPNSLIYANYGKASRMSGLIPFTWALNTKKGSTYSKDLEAEKSTRYET
FT                   GYKYEKRDTFLNDDYITFNVNIFKTTIKDLIVSKDTNCKNGICGSGEGGRTLQDIYNRE
FT                   DDFESKGFELKLSYNYDIFSTSLAYTQIDTNNVNSDTNGVANINEDQNIRRVGGYDSKK
FT                   FIWNSGIEITKDLAIDYTLNAVASSDVLDSNNNEINRAGYTTHDINMKYKLNSDWTLFF
FT                   AVNNLTDKQYAKATTISTKNQADVYRYEMGRDYRFSVKYEF"
FT   gene            344649..344948
FT                   /locus_tag="Abu_0343"
FT                   /note="AB0341"
FT   CDS_pept        344649..344948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66618"
FT                   /db_xref="GOA:A8ERP4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP4"
FT                   /protein_id="ABV66618.1"
FT                   /translation="MAYCCDVERKKLQNRISRIHGQIHSLKNKFDDEKFKLEEDPYETI
FT                   RQLTAIKGAVTGMITSYVEHFAKGHMIENIKNGTQADAEAQIDNLLEIIKVYGK"
FT   gene            344960..346015
FT                   /locus_tag="Abu_0344"
FT                   /note="AB0342"
FT   CDS_pept        344960..346015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0344"
FT                   /product="cation efflux system, membrane protein"
FT                   /note="Pfam match to PF01545 Cation_efflux, score 295.2,
FT                   E-value 1.1E-085"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66619"
FT                   /db_xref="GOA:A8ERP5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP5"
FT                   /protein_id="ABV66619.1"
FT                   /translation="MANCGFGLNEHKPFLNKESEHHHHHDNKHKLSNKNLEQNIEQKFV
FT                   FSAKQENHIHSHEHGCGHDHGVAGHTHDHRGTDKRVLKWALGITMITMFLEFFYGFLSN
FT                   SLALISDAIHMFTHSFALIVSLFAIIIASKTAPISKTFGYYRAEVLAAFINGITIVLSI
FT                   IWIIYEAIERFLNPQIIDIKTAMIVAIIGLIVNIITGVILMQGDKDNINLKSAFIHMLT
FT                   DALSSVAIIIGYIVIYFTSWYFIDIILAVIVALVIAKWAIDILKSSTNTLLESSPVDVK
FT                   EVQEYIEKNEKVLELHDVHIWEITQDMYNMTAHVKIDKKYLDDYEEILHKINHNLKEKF
FT                   KIVHTTFQFEW"
FT   gene            346070..347308
FT                   /gene="serS"
FT                   /locus_tag="Abu_0345"
FT   CDS_pept        346070..347308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="Abu_0345"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="Pfam matches to PF00587 tRNA-synt_2b, score 227.1,
FT                   E-value 3.5E-065, and to PF02403 Seryl_tRNA_N, score 91,
FT                   E-value 3.3E-024"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66620"
FT                   /db_xref="GOA:A8ERP6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERP6"
FT                   /protein_id="ABV66620.1"
FT                   /translation="MIDIKLLQKDFDYVVKALQKKGVDNALLNNLKDLALKTKQKRQEM
FT                   EDVTAEQNLLSKEFGRYKKENLDISELQEKINALKTKKQELEDEVRTLEDDLNSIILSV
FT                   PNMPDENVPFGVDENENVILEVIGEKPTFNFTPKEHWDLSCDWLDFERGVKLAKSRFTA
FT                   IKGDGARLERALINYMLDFNRQRGFNEWYVPFMANSNTLQGTGQLPKFADDLFKIEGED
FT                   LYLIPTAEVSLTNLYNDEIIDKSELPLLLTSYTPCFRKEAGSAGRDTRGLIRQHQFDKV
FT                   EMVAITSQEQSDEIFEKMVNCASDLLSSLGLCHQKVQLCSGDLGFSAAVTIDLEVWLPG
FT                   QNKFREISSISNTRDFQARRAKIRYKEDKKNILAHTLNGSSLAVGRTLLAIMENYQQAD
FT                   GSVKIPEVLKKYL"
FT   gene            complement(347580..350705)
FT                   /gene="nrfI"
FT                   /locus_tag="Abu_0346"
FT   CDS_pept        complement(347580..350705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfI"
FT                   /locus_tag="Abu_0346"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="Pfam match to PF01578 Cytochrom_C_asm, score 146.5,
FT                   E-value 6.5E-041"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66621"
FT                   /db_xref="GOA:A8ERP7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP7"
FT                   /protein_id="ABV66621.1"
FT                   /translation="MINFLKNIFSMQIMTIFLIFMALACAVATFVENDFGVLGAKSFVY
FT                   GQTWFELIMLILTVGIAVNIIIFKMYKKNKFFTFLIHISIIFIFIGSAMTRYLGYEAVM
FT                   TIPEGSMENKVYSTNEYIQIKILDKDGEKSYEKEVMITPLNQTKFEYETTINNKPLSIK
FT                   YNNYVNNAIEKLVPNPNGKISMDILLSEAMGAKNILLQDKEKFDSNFLTFTLNNNIKNE
FT                   TKPTINFETINDEFYLTSNLQITLYSNDLENEKTINANTQTKIEKNKIYKIGQTQFKIF
FT                   EALMNGKLEVVNSDKMFDKSEQVNAIIVDFKYDNKTSQIPLYKKADSSLGVTQTLFIED
FT                   KKIELQWGAKEIVLPFSILLNDFVLQRYPGSNSPSTYSSFVKIYDPIENNSFDYTIFMN
FT                   NVLDYKGYRFFQSSYKMDETATILSVNKDPGKIPTYIGYFLLFLGLILTLFVKNSRFSK
FT                   LVHKRYTLEDIKKSYYLKKSLCLVIFSFFIFLPQKSFTQDLELIYNIDKIHSQKFGSLL
FT                   VQDYQGRIKPLNSLAIEILNKTTKKSLIGNLDENQFFISMMMYPEIWRTIPIYKVKDEN
FT                   IKKLLGLSIDKSYFSFDDVYDKYGGYKLADELEISNNKSASNRTIYDKELIKIDEALNI
FT                   SYSLFNGDFFKVFPLKDDLNNKWLNIIEANSYKNEQSLQINNLVKNYYFSLLDASKNND
FT                   WEKANNYLDEIKSYQYNLASNIIPNKIKIQAELLLNKFDIFERLMPFYLILGVILLFIV
FT                   FINIINPSIKVEKITKLTFYLLIFGFIFHTFGLALRWYVAGHAPWTNGYESMIYISWAI
FT                   AISGIIFSKQSHLALSCTAILSGITLFVAHLSWLEPQITTLAPVLKSYWLTIHVSVITA
FT                   SYGFLALSCLLGFFSLILYIFANAKNENERFFRILLSIKEASRINEISILIGIILLVIG
FT                   NFLGGIWANESWGRYWAWDPKETWTLISIIIYIIIIHLKYIKDVINDYVLNLLSVISYF
FT                   SIIMTYFGVNYFLSGKHSYVAGEPIVIPNFVYITIVIIALTIIISFKNRKVL"
FT   gene            complement(350755..352245)
FT                   /gene="nrfA"
FT                   /locus_tag="Abu_0347"
FT   CDS_pept        complement(350755..352245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="Abu_0347"
FT                   /product="cytochrome c552 nitrite reductase catalytic
FT                   subunit NrfA"
FT                   /EC_number="1.7.2.2"
FT                   /note="Pfam match to PF02335 Cytochrom_C552, score 837.2,
FT                   E-value 7.6E-249"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66622"
FT                   /db_xref="GOA:A8ERP8"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017570"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERP8"
FT                   /protein_id="ABV66622.1"
FT                   /translation="MKKYKFLFAISIIAIGLMTVLLASINEKKEEKENLLSVPKIEKWE
FT                   TKNEEFRKFYPREFDSWKQTKNSDQIDDMLKLHPEMVVLWAGYAFSKDYNAPRGHFYAI
FT                   DDVSNSLRTGAPTDKESGPLPSACWTCKSPDVPRIMHEQGNNEYFTGKWAKYGADIVNP
FT                   IGCVDCHNPETMELQVGRSYLNDALKAEGKSPTLATATQQDMRTLVCAQCHVEYYFKKT
FT                   PLENGKTAMAVTLPWANGTTVEDMEKYYDTIEFSDWVHQVSKTPMIKAQHPEYETWKTG
FT                   AHGRNNVSCADCHMPYTQEGGIKYTDHKIGNPLENMDKTCMNCHRVSEKSLLANIQDKK
FT                   ARKDDLNQKAMEQIVAAHLEAGKAWEVGATPEEMKDILTDIRHAQWRWDFAAASHSAFF
FT                   HAPEETLKTLGTAIEKAGNARIKLAKVLAKHGVTDYKAPTITDKKQAQELIGLPMGKLI
FT                   EEKKQFTNGLLKDWKNEAEQKGLYNPKSREGVETKTSY"
FT   gene            complement(352259..352789)
FT                   /gene="nrfH"
FT                   /locus_tag="Abu_0348"
FT   CDS_pept        complement(352259..352789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfH"
FT                   /locus_tag="Abu_0348"
FT                   /product="cytochrome c nitrite reductase, small subunit
FT                   NrfH"
FT                   /note="Pfam match to PF03264 Cytochrom_NNT, score 94.8,
FT                   E-value 2.4E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66623"
FT                   /db_xref="GOA:A8ERP9"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017571"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERP9"
FT                   /protein_id="ABV66623.1"
FT                   /translation="MKNKKIIIYGAILSATIAALLLVYTMYASSMLSYLSSDPKACINC
FT                   HVMHSAYTTWDNSSHKNVAKCIDCHLPVGDEVAKYTAKAIDGWNHSVAFTLNTYKNNIR
FT                   ISDNAAERVQANCVRCHSGVSETVQKNASSYHNKGNFDKDRKCWECHKYVPHGKVRSLI
FT                   STPYSLGIKEHLK"
FT   gene            complement(352914..353300)
FT                   /locus_tag="Abu_0349"
FT                   /note="AB0347"
FT   CDS_pept        complement(352914..353300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66624"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ0"
FT                   /protein_id="ABV66624.1"
FT                   /translation="MKKAIFILTFFISNIFAIDSDIQKAFAVGIFHENETGENVQHVTS
FT                   TTQNYNGTCYSKIVILGNYNKNTNVEVRIGDSIGIYQSYIPISNKITKKIFAYELTFKH
FT                   QNVTQGYFEVKVNNKLYDSKVFVK"
FT   gene            complement(353307..354923)
FT                   /locus_tag="Abu_0350"
FT                   /note="AB0348"
FT   CDS_pept        complement(353307..354923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0350"
FT                   /product="EAL/GGDEF/PAS domain protein"
FT                   /note="Pfam matches to PF00563 EAL, score 233.5, E-value
FT                   4.2E-067, and to PF00990 GGDEF, score 38.4, E-value
FT                   9.4E-011, and to PF08448 PAS_4, score 35.5, E-value
FT                   1.6E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66625"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ1"
FT                   /protein_id="ABV66625.1"
FT                   /translation="MKPTIDPENLLILISEYSPDMLWIKDLEGRYLYANNAICKGLLIA
FT                   TPDEVFGKDDNFFVERVREKHKENPEYHTFSSCSDSDEETLKAMKSLRFIEKGNIRGKL
FT                   TYLEVDKAPFFDENGKLVGVIGTARDITEKILLKEKNEKLAYYDQLTTLPNRQKIILDI
FT                   NTNFPTACIVFNIDDFKEINDFFGTENADKILQDIANRFLDYKYIVYRIDGDEFAILFY
FT                   ENLSIDQLKSQAQKILTLFDEEPFYVEDQTISIGFSIGIAKAKDNLLTKVDIAVNNAKN
FT                   SSSDISVYEESENIEKKYKQNLEMATSIKEALLEDRIVCHYQPLIDIETGEIYSFETLV
FT                   RMIDKDGNIIPPIKFLDFSKKVKLYSSITRKVIKEACETFKHRNENFSINLNIADIKDK
FT                   ETVKEIIKNITETNTASKVTFEILESEGIENYDEVISFINQIKALGAKIAIDDFGTGYS
FT                   NFEHLLRLDVNYIKIDGSLIKNIASDEKHRIIVETIVSFARRIGIKTVAEFVADKQILE
FT                   IIKEIGVSCAQGYYIGKPEKL"
FT   gene            complement(355015..355458)
FT                   /locus_tag="Abu_0351"
FT                   /note="AB0349"
FT   CDS_pept        complement(355015..355458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0351"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam match to PF08447 PAS_3, score 53, E-value
FT                   5.4E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66626"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ2"
FT                   /protein_id="ABV66626.1"
FT                   /translation="MEFLSGKFLCETIVPRNELIVSRTNLKGVITYANDTFAEISGYSV
FT                   DELIGKNHNIVRHPDMPKVIFKDLWTKLKAEGHWSGFVKNLRKDEGFYWVYAEISQVIK
FT                   NGELVEYKSVRTPISFENKIKYQLYYDELKEKNKELLRRVIYQ"
FT   gene            complement(355460..355843)
FT                   /gene="napD"
FT                   /locus_tag="Abu_0352"
FT   CDS_pept        complement(355460..355843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="Abu_0352"
FT                   /product="putative periplasmic nitrate reductase assembly
FT                   protein NapD"
FT                   /note="Pfam match to PF03927 NapD, score 27, E-value
FT                   4.5E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66627"
FT                   /db_xref="GOA:A8ERQ3"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ3"
FT                   /protein_id="ABV66627.1"
FT                   /translation="MNISSIVVQTLPKNLEEVVKALKASGVCDYFMHDELGRIIVTIEG
FT                   DGVQEELKKLKVIEAIPNVISADMQMAYSQEELDSHLEVLENSDAVPRVLNEDVKPEDI
FT                   VYNGDLKQKDLIGFATNFDKTGK"
FT   gene            complement(355845..356804)
FT                   /gene="napL"
FT                   /locus_tag="Abu_0353"
FT   CDS_pept        complement(355845..356804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napL"
FT                   /locus_tag="Abu_0353"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66628"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ4"
FT                   /protein_id="ABV66628.1"
FT                   /translation="MKIFNYFILIFTLTYNLFANDLKPVNILETSGGVTDLVLDKNRLL
FT                   AATVNSTIDIFDINSKEKIDTIKIPKIKDFLGDLIESKIYSTDILENKILILSQGESGG
FT                   RNLFIYEDKKLINIIDDKKRLFIAYAKFLDENHIIYALLSNQLFIYDIKNKTTLNEVQV
FT                   SQSKFSHFKLSLDKTKVIVADESGALSLFDSKSLKLLQVFKSQNVDNVFQVDLKNNTLI
FT                   SAGQDRRCAIYNIDKNNSFYKDSNFLVYSVALSPSSKKGAFSSDENNNVTVFDVSSKEN
FT                   LFRLTNIQNTLTNILFLNENELFIASDDNKINYYKLGE"
FT   gene            complement(356813..357289)
FT                   /gene="napF"
FT                   /locus_tag="Abu_0354"
FT   CDS_pept        complement(356813..357289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napF"
FT                   /locus_tag="Abu_0354"
FT                   /product="ferredoxin-type protein NapF"
FT                   /note="Pfam match to PF00037 Fer4, score 30.3, E-value
FT                   5.7E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66629"
FT                   /db_xref="GOA:A8ERQ5"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ5"
FT                   /protein_id="ABV66629.1"
FT                   /translation="MQRRELLSSLFAYKEKENKEKIIRPPYFNDEEVFFSNCTSCEGLC
FT                   SKVCEENIIIIQEDSTPKLDFSISGCTYCDECAKACPNDVLNIENKKHIDAKIEIDVIS
FT                   CLSWHQTMCFSCKDPCFYDAIDFLAMFRPTINQNCTACGLCIKSCPTDAIKIIS"
FT   gene            complement(357289..357894)
FT                   /gene="napB"
FT                   /locus_tag="Abu_0355"
FT   CDS_pept        complement(357289..357894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="Abu_0355"
FT                   /product="periplasmic nitrate reductase, small subunit,
FT                   cytochrome c-type protein NapB"
FT                   /note="Pfam match to PF03892 NapB, score 87.9, E-value
FT                   2.9E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66630"
FT                   /db_xref="GOA:A8ERQ6"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ6"
FT                   /protein_id="ABV66630.1"
FT                   /translation="MKLHKLTLVVIAIASFFISSAFAADSKIKDSTLGLRHTNLLSEEK
FT                   TVSDETKYGTDAAGTSTKIKRAFENAPPMIPHDVEGMLPIEINNNQCTACHDPLVAESM
FT                   GATPIPKSHFTSFREEVKLDSNGNLEREGKVVENSSDLKGVKKPLDHLSNARFNCSACH
FT                   APQSNSANVPKNNFSPEFRSGGLNDRSNLIDTISEGVK"
FT   gene            complement(357896..358702)
FT                   /gene="napH"
FT                   /locus_tag="Abu_0356"
FT   CDS_pept        complement(357896..358702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napH"
FT                   /locus_tag="Abu_0356"
FT                   /product="methylamine utilization ferredoxin-type protein
FT                   NapH"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66631"
FT                   /db_xref="GOA:A8ERQ7"
FT                   /db_xref="InterPro:IPR011886"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ7"
FT                   /protein_id="ABV66631.1"
FT                   /translation="MIKKYKFLIARRFTQISIMALFILANIYGLEILMGNLSSSLILKT
FT                   IPLSDPYAVAQMLFAGAVLSFDVILGALIVTIFYMLIGGRAFCSWVCPVNIITDSANFL
FT                   RRKLGFNQIQKKQPASRSIRYFVIGISFVISFFMGITAFELISPVSMINRGIIFGLGFG
FT                   WATMIVIFLFDLFVLKNGWCGHICPLGGFYSLIGKFSLIRVHHNAQNCTACMKCKEVCP
FT                   ENQVLFMVTKTSMPVLSGECTNCGRCVEVCDDEALNFSIKNLKKEI"
FT   gene            complement(358699..359511)
FT                   /gene="napG"
FT                   /locus_tag="Abu_0357"
FT   CDS_pept        complement(358699..359511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napG"
FT                   /locus_tag="Abu_0357"
FT                   /product="Fe-S ferredoxin-type protein NapG"
FT                   /note="Pfam match to PF00037 Fer4, score 25.4, E-value
FT                   3.3E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66632"
FT                   /db_xref="GOA:A8ERQ8"
FT                   /db_xref="InterPro:IPR004494"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ8"
FT                   /protein_id="ABV66632.1"
FT                   /translation="MNIEQKKTIQEQDRRKFFLTVARAAGLAILGGLTWSAYVDEVKAT
FT                   SLILRPPAALDEDDFLATCIKCGLCVEACPFDTLKLARPGDNKPLGTPFFEPRKTPCYM
FT                   CVDIPCVPVCPTDALNIKSVQNENKELDISKARMGVAVIDDSSCIAFWGIQCDACYRAC
FT                   PLLGKAITIEYTKNERTGKHAFLKPVINPDICTGCGLCEKACVTQKAAIFVLPRDIALG
FT                   EVGDHYIKGWDEKDEQRVENAQIGTTKTYINKKDAVDSLNSGMEDLLK"
FT   gene            complement(359529..362339)
FT                   /gene="napA"
FT                   /locus_tag="Abu_0358"
FT   CDS_pept        complement(359529..362339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="Abu_0358"
FT                   /product="periplasmic nitrate reductase, large subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="Pfam matches to PF00384 Molybdopterin, score 259.5,
FT                   E-value 6.2E-075, and to PF01568 Molydop_binding, score
FT                   114.4, E-value 3E-031, and to PF04879 Molybdop_Fe4S4, score
FT                   86.7, E-value 6.7E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66633"
FT                   /db_xref="GOA:A8ERQ9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERQ9"
FT                   /protein_id="ABV66633.1"
FT                   /translation="MSLSRRDFLKSSAAASAAAAVGMAIPADLQAQADVAEGGWRWDKA
FT                   ACRFCGTGCGIMLATKEGKIVAVKGDPAAPVNRGLNCIKGYFNAKIMYGADRLKQPLLR
FT                   VNSKGEFDKKGDFAPVSWKRAFDEMEKHIRIALKEKGPEGVAVFASGQHTIMEGYAALK
FT                   MMKAGFRSNAIDPNARHCMASAVVGFYQTFGIDEPSGCYDDIELTDTIVTWGSNMAEMH
FT                   PILWSRVTDRKLSNPDRVKVINISTYRHRTSDLADIEIIFTPNTDLALWNYIAREIVYN
FT                   RPEAIDWDFVKEHIVFAASPINIGYGMRKSDEKSIKDGKYSKAEMETISKEMEKIVSEA
FT                   EAPALAPYGYKAGDKIVNKNAGLAHWEISFEEYKKFLEPYTLNYVAKISKGNPDEDIEE
FT                   FKKKLQQLADWYIEKDRKVVSFWTMGMNQHTRGTWVNTLSYNVHFLLNKQAKPGSGAFS
FT                   LTGQPSACGTAREVGTFTHRLPADMMVENPKHREITENNWKIPKDTLNPKGHQHIMKIH
FT                   RDIEDGNIKFAWVNVCNPYQDTASATHWVKAAREMDNFIVTSDAYPGISAKVSDLILPS
FT                   AMIYEKWGGYGNAERRTQLWRQQVVPVGDAMSDTWQWVELSKRFTVKDLWGEQVLASTK
FT                   GETKLPNVIEAARAMGYNENSTMYEILFANEKAKSYKADQKDPIQTGFDNTEAFGDNRN
FT                   VLGSDGKPWKGYGFFIQKYLFEEYADFGRGHGHDLADFDTYHKVRGLKWPVVDGKETSW
FT                   RFNTKYDPYAKKASPDSDFAFYGTLAKELAQGDLTGIKDQTKKSLKNKAKIFARPYMDP
FT                   PEVPSKEFPVWLCTGRVLEHWHSGTMTMRVPELYRAVPEALCYMHPDDATQYGVKQGSL
FT                   CWVESRRGKVKARVETRGRNRPSRGLVFVPWFDEKVFINKVCLDATCPQSGQTDFKKCA
FT                   VKIYSA"
FT   gene            362606..363598
FT                   /gene="dctP"
FT                   /locus_tag="Abu_0359"
FT   CDS_pept        362606..363598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="Abu_0359"
FT                   /product="C4-dicarboxylate-binding periplasmic protein"
FT                   /note="Pfam match to PF03480 SBP_bac_7, score 419.7,
FT                   E-value 3.8E-123"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66634"
FT                   /db_xref="GOA:A8ERR0"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR0"
FT                   /protein_id="ABV66634.1"
FT                   /translation="MKKVVLGTIAAAMLATSGLAADYVMKISHVVSASTPKGMAADYLE
FT                   KRIEELTKGKIDVQVFPNSQLYGDGDEMKALAMNNVQVIMPSLSKFPSIVPQIQLFDLP
FT                   FLFRDKEHLYKVMDGEVGAKLKSYVDAKKQMIAFDYWDAGFKHFSSSKQPIINPEDAKG
FT                   LKFRIQSSKVLEAQFKAVGGNPQILPFSEVYSALQQGVVDATENPLSNFYTKKFNEVQS
FT                   SLTLSSHGYLGYLVVMNQQFWEKLPKDLQEKVAIAMKEATELERKETAIEDVKIMEALK
FT                   KYSADTKKLEIYQLTDEQVAKWRKVMEAIYPQFYDVIGEDLIKKAIETK"
FT   gene            363612..364157
FT                   /gene="dctQ"
FT                   /locus_tag="Abu_0360"
FT   CDS_pept        363612..364157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctQ"
FT                   /locus_tag="Abu_0360"
FT                   /product="C4-dicarboxylate transport system, permease small
FT                   subunit"
FT                   /note="Pfam match to PF04290 DctQ, score 144.5, E-value
FT                   2.6E-040"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66635"
FT                   /db_xref="GOA:A8ERR1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR1"
FT                   /protein_id="ABV66635.1"
FT                   /translation="MKKLFSILDIIVGTINQTIAVYGMILGVLLAFINVVLRYIFDMSL
FT                   PWAAELTNYLFIWAALFGAAYGFKQGAHISITLLIEKCSPAVMKGFLIFASLLSIAYLL
FT                   LISYFGYELVLFLMDFGEINVDLQVPMWIPQLVIPIAFLLAAYRVFEKLIELYRTDADK
FT                   IKLFSEHEAILEEIKGEK"
FT   gene            364160..365440
FT                   /gene="dctM"
FT                   /locus_tag="Abu_0361"
FT   CDS_pept        364160..365440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctM"
FT                   /locus_tag="Abu_0361"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="Pfam match to PF06808 DctM, score 532.1, E-value
FT                   5.4E-157"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66636"
FT                   /db_xref="GOA:A8ERR2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR2"
FT                   /protein_id="ABV66636.1"
FT                   /translation="MVIATLFILLFGLMLIGVPVAVALGASTLVSAFLFTNLDLMGTAS
FT                   HIFDGLNKYTLMAIPMFVLAGSLLSKGSAATRIINFAKSLVGHLPGGLPIAAILASIIF
FT                   AAISGSSPATVAAIGSVMYGAIKQAGYNEQFAIGTITTSGTLGILIPPSVVFIVYGVSA
FT                   DESIGKLFMAGVIPGLMIGGMMMIATYILARKNGFKAGKMASLKEIVIAFKESFWALLI
FT                   IFVVIGGIYGGIFTPTEAGAVSVMYAFFISFFVYKDIKMKDLHKIALDSAQTSSMIFFI
FT                   IANAMIFAHFLTDEQIPQQITQMIIEADVSPLMFLLIVNILLLVMGQFMEPSSVVMITV
FT                   PLLLPIGIALGIDPIHLGVIMVVNMEIGMLTPPVGLNLFVASGITGLSMGQVIKASLPM
FT                   TVVLLIGLMLITYIPAISLWLPNLMFG"
FT   gene            complement(365467..367029)
FT                   /locus_tag="Abu_0362"
FT                   /note="AB0360"
FT   CDS_pept        complement(365467..367029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0362"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam match to PF02518 HATPase_c, score 69.3, E-value
FT                   1.1E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66637"
FT                   /db_xref="GOA:A8ERR3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR3"
FT                   /protein_id="ABV66637.1"
FT                   /translation="MNLSMENNLSKSIIFTFIVIMSSMIFAISYFYVNNTYDDFEIEMN
FT                   KFVEEYYLNKRITLKKEINTIFDILNYNTNKSNLTDEQEKAEAIKLLNNVTFEENKSNY
FT                   FFVYEVKNMQGGDNFAILVVNPNRPDLVGQLISTNYKDADGKKFREEFLKDIRETGESY
FT                   TQYAYKKPDSNESKHKLSYFKYYEKWNWIISAGIYTDDIENEIEIKRQDLQKKVKNQVA
FT                   QNIILFLMFLSIAILISIAISQKIDLTLMNYEKKVKANAKELEELNQFLEEKVKEEIEK
FT                   NREKEQLLVQKSKFIALGEMISNIAHQWRQPLSELSSILMFIKFKYSINALDKETMEKK
FT                   SQEADRVLEFMSHTIDDFRNFFIPKKEKEEFNLLKEVQLVINIISSTLDNYNIKIEINI
FT                   DKDLKIISYLNEYKQVVLNILNNAKDVLIDKEIKNPLIKLTANEDTNYVILNIEDNGGG
FT                   VFVEPKSKIFEPYFTTKENSNGTGIGLYMSKIIVEKNMKGNLKVENTNKGAKFSIHIPK
FT                   SSF"
FT   gene            367096..367794
FT                   /locus_tag="Abu_0363"
FT                   /note="AB0361"
FT   CDS_pept        367096..367794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0363"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 82.6,
FT                   E-value 7.2E-025, and to PF00486 Trans_reg_C, score 33.2,
FT                   E-value 8.4E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66638"
FT                   /db_xref="GOA:A8ERR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR4"
FT                   /protein_id="ABV66638.1"
FT                   /translation="MQKNFINKLSAFCVLYVEDENGIRSNIEEILKHLFKEVLSATDVN
FT                   EAYNKYLQNKPDLIITDIKMKDKTGIELLKKIRETDSKIRIIITSAYTDLDYLLEATEL
FT                   HLIKYIVKPITNDKLMEALESFVKSYDENKIYNLDQNWIFDSSKSSVSNGKEDFILTKK
FT                   ESAFLKLLITKNRIITYEELENSVWDDDSIMTANAMRLFIKNLRKKLPDNFLKNMQGIG
FT                   YYHNIRDKNT"
FT   gene            complement(367813..368295)
FT                   /gene="menG"
FT                   /locus_tag="Abu_0364"
FT   CDS_pept        complement(367813..368295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="Abu_0364"
FT                   /product="S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase"
FT                   /note="Pfam match to PF03737 Methyltransf_6, score 113.2,
FT                   E-value 7.1E-031"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66639"
FT                   /db_xref="GOA:A8ERR5"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR5"
FT                   /protein_id="ABV66639.1"
FT                   /translation="MNTQTADLCDNNREKKIEVLSAKFKNYGGLKEFSGQIVTLKLDKS
FT                   NWQLLEMLRDEDGEGKIVVVDNSEEFFGVVGDKLMTFAKNNNWRAIILNGYVRDIDETK
FT                   NIDVGLFAIGTCPLRNFEKTESFRDIELNFGGVTFNSGDYLYADNDGVIISKDKLL"
FT   gene            complement(368451..369182)
FT                   /gene="cysG"
FT                   /locus_tag="Abu_0365"
FT   CDS_pept        complement(368451..369182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="Abu_0365"
FT                   /product="uroporphyrin III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="Pfam match to PF00590 TP_methylase, score 265.7,
FT                   E-value 8.7E-077; non-fusion protein; does not contain
FT                   precorrin-2 dehydrogenase or sirohydrochlorin
FT                   ferrochelatase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66640"
FT                   /db_xref="GOA:A8ERR6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR6"
FT                   /protein_id="ABV66640.1"
FT                   /translation="MPKVYLTGAGPGDVELLTVKAVKAIQNADILIYDRLVNPEILELA
FT                   KKECELIYVGKEDKKHTLPQEDINELIYQASLKYENVVRLKGGDPFVFGRGAEEALYLR
FT                   QRGIKFEIIPGITSAIAVPAYAGIPVTHRGLTTSFRVVTGHENPKKKISQIEWETFLND
FT                   ETIIFLMGYHNIEIISSKLLSLGKRKDYPCAVISKGTTTQQKVVVGTLEDIVEKSKDLP
FT                   TPVMIVIGEVVNLREQINWFN"
FT   gene            complement(369238..370239)
FT                   /locus_tag="Abu_0366"
FT                   /note="AB0364"
FT   CDS_pept        complement(369238..370239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66641"
FT                   /db_xref="GOA:A8ERR7"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR7"
FT                   /protein_id="ABV66641.1"
FT                   /translation="MKKNKISTKIKLIGFLFIVLMISIITTTIYLNDKNKKDALTINIV
FT                   GKQRMLTQNITKNIFYLYQHKNASMTELDNSTTEFIYNLNTLIQGNKLSKIQEAPTRQI
FT                   ANQLVKVDILWKSFHENIVKFKELLQKNDKDSLQLLDNVVNSIYLTNSTLLNEVDNLVS
FT                   IYTIYSEEKLNNLQYIQYLFAFLILLLMIYSFIQLRTMEDNVKKFLEESEKIVKQSFDE
FT                   PLTPIKLEGENEIIEMSKNINCFVDKINSVMSYSTNAIEQSKNASLKLDELNAEFDNIL
FT                   DELTNSPDIAKQLNKSEDIFIQSQEHLINSTRRLQDLKKELENIVISCKVPS"
FT   gene            complement(370236..370901)
FT                   /locus_tag="Abu_0367"
FT                   /note="AB0365"
FT   CDS_pept        complement(370236..370901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0367"
FT                   /product="putative transcriptional regulator"
FT                   /note="Pfam match to PF00027 cNMP_binding, score 37.2,
FT                   E-value 5.3E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66642"
FT                   /db_xref="GOA:A8ERR8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR8"
FT                   /protein_id="ABV66642.1"
FT                   /translation="MHLIEYIKKIDFFKNLNEEEMKLLCSISTMSKYENNSILFYENDI
FT                   KNSLLFLVEGLLKIYKFDKFGNEIFLYHIYENSLISELSSLKSTDISCFSNASFIEDST
FT                   ILSVNFEKLQEYFLSKNILTNELMQALLDKSHQLQCLVNRELVFDATAKVAFMLKQDLP
FT                   MFNKLKRQEVSFMLHIQPETLSRVLKKLSREGIINIENGYVSIEDNEKLISIFKGVAI"
FT   gene            370987..371904
FT                   /locus_tag="Abu_0368"
FT                   /note="AB0366"
FT   CDS_pept        370987..371904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0368"
FT                   /product="glycosyltransferase, putative"
FT                   /EC_number="2.4.2.18"
FT                   /note="Pfam match to PF02885 Glycos_trans_3N, score 51.9,
FT                   E-value 2E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66643"
FT                   /db_xref="GOA:A8ERR9"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERR9"
FT                   /protein_id="ABV66643.1"
FT                   /translation="MNFKKYIKAVATGPKGNKDLTIDETADAIEQILLNKVTPAQAAAF
FT                   LIGWRTKYETDDELKGAILALRKFMKFKKIEDSIELGYSFDGRCDNPFLFPLYENILEE
FT                   FYKKNQDVKRLNLVISGDYLQPAKVGITTKDIFSQIDEGQYIHFFDRVQYLKELSDMTT
FT                   LRQELGLRTAFNTIEKLLNPSLSEYGVTTAFHKPYVQKYLDIFSFHFKKVVVLKGSEGS
FT                   PEVFKDGKYWIREDKDIIERSFSLKDFGINYDKEFKNITLEESLNIVNNHDNNILKLAK
FT                   FNVALILLFANRVSSLDESWQRLN"
FT   gene            371920..372891
FT                   /gene="moaA"
FT                   /locus_tag="Abu_0369"
FT   CDS_pept        371920..372891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="Abu_0369"
FT                   /product="molybdopterin biosynthesis protein A"
FT                   /note="Pfam matches to PF04055 Radical_SAM, score 148,
FT                   E-value 2.3E-041, and to PF06463 Mob_synth_C, score 140.2,
FT                   E-value 5E-039"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66644"
FT                   /db_xref="GOA:A8ERS0"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERS0"
FT                   /protein_id="ABV66644.1"
FT                   /translation="MLIDGFGRKVDYLRVSVTERCNFRCQYCMPEKPFSWVPRENLLSY
FT                   EDLFKFIKASIDEGIKKVRITGGEPLLREDLDFFIKMVFDYKKDIDLALTTNGYLLSKM
FT                   AKKLKDAGLKRVNISLDTLNKETAQKIAQKDVLEKVLEGIEEASKVGLKIKINCVPLKG
FT                   VSEKDVLEVLEFCKSRGFVVRFIEFMENFHAKDGAKGLNSDEIKAIIAQKYPNFKTVLR
FT                   DTSSPAQYYELEDGYQFGIIEPHKDDFCASCNRIRLTAEGFLIPCLYFEDAMSIKNAVQ
FT                   SNKIDEAVEILKKVLKNKPEKNKWSQKDDNEVSTRAFYQTGG"
FT   gene            372988..373260
FT                   /gene="rpsO"
FT                   /locus_tag="Abu_0370"
FT   CDS_pept        372988..373260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="Abu_0370"
FT                   /product="30S ribosomal protein S15"
FT                   /note="Pfam match to PF00312 Ribosomal_S15, score 118.9,
FT                   E-value 9.5E-034"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66645"
FT                   /db_xref="GOA:A8ERS1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERS1"
FT                   /protein_id="ABV66645.1"
FT                   /translation="MALDQEVKAAIIAKYGKKDGDTGSSEVQIALLSEQIKILTEHLKV
FT                   FKKDHSSRLGLLKMVGKRKRLLAYLKRTDYARFTDIVNSLGIRAK"
FT   gene            373389..373787
FT                   /locus_tag="Abu_0371"
FT                   /note="AB0369"
FT   CDS_pept        373389..373787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0371"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="Pfam match to PF02082 Rrf2, score 113.1, E-value
FT                   4.4E-034"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66646"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS2"
FT                   /protein_id="ABV66646.1"
FT                   /translation="MLLTRKSEYALLSLISIAKNKEPKNVDVLSKELDISKSFLAKIMQ
FT                   NLAKHELVISHRGVNGGFVLKKPLDEITILEIVEAAEERVPMVFECAPSLQSCPNNKAK
FT                   SCIIWPLLNNLQFKVNDFLSKLTLKDIA"
FT   gene            373787..374824
FT                   /locus_tag="Abu_0372"
FT                   /note="AB0370"
FT   CDS_pept        373787..374824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66647"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS3"
FT                   /protein_id="ABV66647.1"
FT                   /translation="MKLFHISHTDLDGYGCQLVTNEFFKDAIFYNANYGLEVKLSIKKV
FT                   LDDIKNYKEEKILFIISDLNLTLQESEELDNEINILINDGFNIKLQLLDHHITGKKGAE
FT                   KFSWYFLDDKRCATQIVYDYLIEEFNAPITYLSPLVKAINAVDIWLENETKNFEFGKVL
FT                   MSMITKVKEINNILFANLNREFKFYLLKNAIKFLDEENGHIKLDNEVHFMKKEFLKLNN
FT                   TDDTLDNLSAVYLVKCLADIKDELTIFYKGQKGLLTYCLGSISIPANTFLRANSDYDFF
FT                   IDINKKGNASFRADGKLDVSLLASKLANGGGHINASGCKFEDFKETIDILEVKKYIQEK
FT                   LDNLS"
FT   gene            374835..375266
FT                   /locus_tag="Abu_0373"
FT                   /note="AB0371"
FT   CDS_pept        374835..375266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0373"
FT                   /product="CoA-binding domain protein"
FT                   /note="Pfam match to PF02629 CoA_binding, score 45.6,
FT                   E-value 1.6E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66648"
FT                   /db_xref="GOA:A8ERS4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS4"
FT                   /protein_id="ABV66648.1"
FT                   /translation="MECEFPTINSKSEEILEIFKNTKTIAIAGLSPDPTKASNIVAAYL
FT                   QNAGFKIVPIYPKEETILGEKVYRSLSEIPFSIDMVDIFRKPDAIALIVDEAIKRGDIK
FT                   TVWFQLGLANNEAAKKAKEAGLNVVQNKCTKIEHNALFN"
FT   gene            complement(375263..376540)
FT                   /locus_tag="Abu_0374"
FT                   /note="AB0372"
FT   CDS_pept        complement(375263..376540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0374"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 75.7,
FT                   E-value 1.3E-019, and to PF00512 HisKA, score 46.2, E-value
FT                   1E-010, and to PF00672 HAMP, score 37.1, E-value 5.7E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66649"
FT                   /db_xref="GOA:A8ERS5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS5"
FT                   /protein_id="ABV66649.1"
FT                   /translation="MENKSIYKQFYNKLIIATSIFIIVLSFIFYEYAKNSFYNDIQDNL
FT                   LRQAQQIEKNYISPDKFTPVKTDIQTINLVKNYKLKDINFSNFNTNNKYYLELLYPFDL
FT                   KEGDFLQITRNITLERDLIYSIIFKNLFILAIPGFILMLLYSFVVSRTLLKPIIQINKK
FT                   LANMDENSLSKIDKKDLPVEFHSLANSINSLTHRIGTYVKFKKELFIGIAHELKTPLAV
FT                   MKLKNEVLLKKKREIQQYEEALKLTIKEIDDMNIMISSILDIGRTEGAQFEQATDLDLV
FT                   EYIKNKTNDYKMLSAQKNIDISFFSNVNKLDTSIQITLFNQILQNFIQNAIKFTPNNKS
FT                   ISIKLRKKGDEIILTVTDEGIGIDGNTDLFAPFKKIGNQSGVGLGLYLAKIAAEALKAR
FT                   ISINNRKDDKSGCVAKLILNNTSKND"
FT   gene            complement(376565..377245)
FT                   /locus_tag="Abu_0375"
FT                   /note="AB0373"
FT   CDS_pept        complement(376565..377245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0375"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 116.6,
FT                   E-value 2.8E-035, and to PF00486 Trans_reg_C, score 78,
FT                   E-value 2.7E-020"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66650"
FT                   /db_xref="GOA:A8ERS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS6"
FT                   /protein_id="ABV66650.1"
FT                   /translation="MRILIIEDEITLNRTLQEGLTDFGYQVDTAENYKDAEYFIDIRNY
FT                   DLVLTDWMLPDGDGIELCKIVKNRSSRTAVVIISARDDKESEIEALKSGADDFIKKPFD
FT                   FDILLARIEARLRFGGTNVIEIDDLVINPDEEKIEYAGEEIELKGKPFEVLTHLARHRD
FT                   QIVSKEQLLDAIWEEPELVTPNVIEVAINQIRQKMDKPLNISTIETIRRRGYRFCYPNV
FT                   AEDK"
FT   gene            377442..378251
FT                   /gene="ppiC"
FT                   /locus_tag="Abu_0376"
FT   CDS_pept        377442..378251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="Abu_0376"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="Pfam match to PF00639 Rotamase, score 91, E-value
FT                   3.4E-024"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66651"
FT                   /db_xref="GOA:A8ERS7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS7"
FT                   /protein_id="ABV66651.1"
FT                   /translation="MKKIVSSLVASIALATALNAADVSYATVNGENITKQDIAMALQDP
FT                   RVDFDKLPQEAKTQILEQIVNMKLIAQHAIDDGVEKDAKYVEAMKKIKSNLALEVWQKN
FT                   EIDKIKVTEADKKDFYEKNKEKFVEPETFEASHILVKTEAEAKDIISQLDKAPNKVEKF
FT                   KELSKKSLDTASAKNGGALGRFAVEQMVPEFGSAVKALAKGTYSKTPVKTQFGYHVIYL
FT                   KDKFPSKTFAYTEVEKNINQVLIGNALNKKIKELVEDLRKDAKIVIK"
FT   gene            378262..379329
FT                   /gene="fba"
FT                   /locus_tag="Abu_0377"
FT   CDS_pept        378262..379329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="Abu_0377"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="Pfam match to PF01116 F_bP_aldolase, score 641.9,
FT                   E-value 4.8E-190"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66652"
FT                   /db_xref="GOA:A8ERS8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS8"
FT                   /protein_id="ABV66652.1"
FT                   /translation="MGVLDIVKAGVLTGSEAKKLFAFAKENNFAIPAVNVVGTDSVNAV
FT                   LEAALKVNSPVIIQFSNGGAGFYAGKGLKSSDAAVLGAISGANHVHTMAKAYGIPVILH
FT                   TDHAAKKLLPWIDGLIEAGAEHFSKTGRPLFTSHMLDLSEESLEENIETCVEYFKKMSK
FT                   LDMMLEIELGITGGEEDGVDNSDVDNAKLYTQPEEVCYAYEKLKEVSDNFTIAASFGNV
FT                   HGVYKPGNVILSPKILDNSQKYIQDKLKTSSKPVDFVFHGGSGSLLEEIREAISYGVIK
FT                   MNIDTDTQWATWDGVRAYEAKYHGYLQGQIGNPEGEDKPNKNYYDPRKWLRAGQETMIA
FT                   RLETAFSDLCSLNKN"
FT   gene            379481..380977
FT                   /gene="ald"
FT                   /locus_tag="Abu_0378"
FT   CDS_pept        379481..380977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="Abu_0378"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="Pfam match to PF00171 Aldedh, score 701.9, E-value
FT                   4.1E-208"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66653"
FT                   /db_xref="GOA:A8ERS9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERS9"
FT                   /protein_id="ABV66653.1"
FT                   /translation="MIYARPTYKTQYENFIGGEWIAPVSGEYFDNISPVDGKLLTKIPR
FT                   SNEKDVELAIQAAKKAFESYKHTSVVQRSTMLNKVADLIEKNLEMLAIAETLDNGKAVR
FT                   ETLNADIPLVVDHFRYFASVIRAESGTVSDLDENTISQEIYEPYGVVAQIIPWNFPLLM
FT                   AAWKLAPALAAGNCVVLKPASATPMSILLLMEIIQEALPKGVINIINGAGGKIGKYLAT
FT                   HPDIKKVAFTGETTTGQLIMQYATENIIPSTLELGGKSPNVFFESIMDEDDEFFDKAIE
FT                   GLVLFAFNSGEVCTCPSRALIQESIYEPFMKRVLERVKAIKLGNPLDTECMMGAQCSLN
FT                   QKEKILSYLKVGKEEGAELLVGGDAYNSSVNPDGFYIQPTLFKGHNKMRIFQEEIFGPV
FT                   LAVTTFKDEKEALEIANDTIYGLGSGVWSRDAHQLHRMSRGIQAGRVWVNCYHMYPSHA
FT                   SFGGYKKSGIGRETHMMMLNNYRHTKNILTSYSPNALGFF"
FT   gene            381031..381420
FT                   /locus_tag="Abu_0379"
FT                   /note="AB0377"
FT   CDS_pept        381031..381420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0379"
FT                   /product="conserved hypothetical protein (DUF779 domain
FT                   protein)"
FT                   /note="Pfam match to PF05610 DUF779, score 128.1, E-value
FT                   2.2E-035"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66654"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT0"
FT                   /protein_id="ABV66654.1"
FT                   /translation="MALKRLDVTPKAAQVIEKLKELHGELVFNQSGGCCDGTAPMCYEK
FT                   ADFIVPSRNIKLGEICGCEFFIDHEQYEYFKQTFITIDVKEEKSAFGNSFSLEIDLGYQ
FT                   FITQSRIFTDDEYRQLLEEEKKASN"
FT   gene            complement(381421..381810)
FT                   /gene="exbD1"
FT                   /locus_tag="Abu_0380"
FT   CDS_pept        complement(381421..381810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="Abu_0380"
FT                   /product="biopolymer transport protein ExbD"
FT                   /note="Pfam match to PF02472 ExbD, score 87.4, E-value
FT                   4.1E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66655"
FT                   /db_xref="GOA:A8ERT1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT1"
FT                   /protein_id="ABV66655.1"
FT                   /translation="MKRREALGLDLTPVIDVVFILLIFFIVTSVFKKEELALLLDLPAS
FT                   NAKEMEVKEGQIFIELGKDKLAIKGIEVSFDSLEDNLKAIKNRNNPVIVRIDKKVEYER
FT                   VVKVLDLLQKYSLVNLALVTNEEKK"
FT   gene            complement(381810..382283)
FT                   /gene="exbB1"
FT                   /locus_tag="Abu_0381"
FT   CDS_pept        complement(381810..382283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="Abu_0381"
FT                   /product="biopolymer transport protein ExbB"
FT                   /note="Pfam match to PF01618 MotA_ExbB, score 59.5, E-value
FT                   1E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66656"
FT                   /db_xref="GOA:A8ERT2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT2"
FT                   /protein_id="ABV66656.1"
FT                   /translation="MNFFEYVDKGGVIVYILIFLNIVGFTIIIWKFLVLFKKNLLILQI
FT                   KENLDRTKPLEAQIEYETKKLESGLTVIKNIAIISPLLGLLGTVVGIYILFDQITLKGL
FT                   GDPTIFSGGIAIALITTVAGIIVSIPHQIAYNHFISAIDTIEVKAKKELVGHI"
FT   gene            382302..383210
FT                   /locus_tag="Abu_0382"
FT                   /note="AB0380"
FT   CDS_pept        382302..383210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66657"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT3"
FT                   /protein_id="ABV66657.1"
FT                   /translation="MVYCTEILLINGTIFAMNYTNSPIEEISFNNQKYFIKRDDLLHVD
FT                   FSGNKARKLYYFLKNDLKGINKIISYGSAQSNAMYSLSVLCKIKNLKFDYYVSHISSFL
FT                   KENPNGNYKEAVKNGMNLIVGDLPKSFNDDELLICEGGAVKEASLGIELLANEIKDWVK
FT                   KENIENLKIFLPSGTGTTALFLQKYIPFDVLTCSCVGDDEYLKQQFFELEKENFPKILE
FT                   KEKKYHFGKLYKEFYEIHKEILKQTNIEFDLLYDSLGWIVFENYVKNLKNKDKYTFLYI
FT                   HQGGVLGNKSMIERYKFKYKI"
FT   gene            383297..383773
FT                   /gene="aroK"
FT                   /locus_tag="Abu_0383"
FT   CDS_pept        383297..383773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="Abu_0383"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Pfam match to PF01202 SKI, score 115.2, E-value
FT                   1.7E-031"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66658"
FT                   /db_xref="GOA:A8ERT4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT4"
FT                   /protein_id="ABV66658.1"
FT                   /translation="MGVGKGTVARALVKKTDMFAIDTDDLIESMENRKIKKIFEDEGEP
FT                   YFRNLEKKTALWLEKNVSNTIISTGGGFYKQENLNKIGKVVYLKSSFQGILDRINEAPN
FT                   AQNKLKKRPLLQNIEEAIKLYDSRVKEYEKVAKIVVDVEKKDIKDIIKEILGKI"
FT   gene            383775..385067
FT                   /gene="hisD"
FT                   /locus_tag="Abu_0384"
FT   CDS_pept        383775..385067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="Abu_0384"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="Pfam match to PF00815 Histidinol_dh, score 671.5,
FT                   E-value 5.9E-199"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66659"
FT                   /db_xref="GOA:A8ERT5"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT5"
FT                   /protein_id="ABV66659.1"
FT                   /translation="MKIINTKDANFKAEFESILARAKSDIKGVSSIVSNIIDEIVNEGN
FT                   VALKRHIEKFDKWEVKSDEELLISQDDMEKAYLNIDEKLRLALHTAFNRIKAYHEKQLP
FT                   KSWIDFESNGTILGQKVTPVDRAGLYIPGGKAAYPSSLLMNAIPALVAGVKEIVVCTPT
FT                   PNNEVNELLLAACHLCKVSKVYKVGGASAIAAMAYGTQTISKVDVITGPGNIFVATAKK
FT                   LVFGEVNIDMIAGPSEIGILADETAKPHYLAIDLLSQAEHDEMASSIMITTCDEVANLT
FT                   SNEVEEYLKTLSRETIARKSIDERGAIIVASNMEEAIELMNEIAPEHLEVMTKNPFELL
FT                   PFIKHAGAIFLGENTPEPIGDYIAGPNHTLPTGSTAKFYSPLNVENFMKKSSIINFSKN
FT                   AINELGEACAILADTEGLTAHAKSVRVRLEK"
FT   gene            385077..385379
FT                   /locus_tag="Abu_0385"
FT                   /note="AB0383"
FT   CDS_pept        385077..385379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66660"
FT                   /db_xref="InterPro:IPR018563"
FT                   /db_xref="InterPro:IPR023126"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT6"
FT                   /protein_id="ABV66660.1"
FT                   /translation="MSIFKDWFTEDEDDIFMGSPKSKFFDVVNEASKDIVEEEIDKIIE
FT                   KLAVLEMMMSEDKGEEFNINNHIKEYILENEDKVKAMKKGLYVEFTGEIICRLDS"
FT   gene            385390..386289
FT                   /gene="ispB"
FT                   /locus_tag="Abu_0386"
FT   CDS_pept        385390..386289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="Abu_0386"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Pfam match to PF00348 polyprenyl_synt, score 136.9,
FT                   E-value 5.1E-038"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66661"
FT                   /db_xref="GOA:A8ERT7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERT7"
FT                   /protein_id="ABV66661.1"
FT                   /translation="MEELELVKNQIKKFVEVCNYEKSLELLDKLATGKMLRSKLILKIA
FT                   GINEESIKLCAIVEMIHAASLLHDDVIDEADTRRGQPSVNALYDNKTSIMFGDILYSRA
FT                   FTELSQMDKRVAYHISNAVTLLSIGEMMDVDLTQSFNTSYTKYLDMIYKKTASLIEASA
FT                   RSAAILVNLDEEKYATYGKNLGLAFQMIDDILDITQDSKTLGKPAMLDFVEGKVTIPYL
FT                   YLYERVEDKTKLESLYKKELSEDESLWIKEQLKITKALEDSILEAKSIGNSAIEAVKDE
FT                   ENSQTLVQIMKAMIEREF"
FT   gene            386289..387587
FT                   /gene="hemA"
FT                   /locus_tag="Abu_0387"
FT   CDS_pept        386289..387587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="Abu_0387"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /note="Pfam matches to PF05201 GlutR_N, score 151.7,
FT                   E-value 1.8E-042, and to PF01488 Shikimate_DH, score 123.3,
FT                   E-value 6.3E-034, and to PF00745 GlutR_dimer, score 51.2,
FT                   E-value 3.3E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66662"
FT                   /db_xref="GOA:A8ERT8"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERT8"
FT                   /protein_id="ABV66662.1"
FT                   /translation="MSYLVISFSHKNTDIKLREKLAFNSDEDKDRFLKLILENDITKEA
FT                   ILLSTCNRVEIITRSLNIKQSSKDIIEKLATYSKVDFDVLYDRADIYDADGAVHHLFSV
FT                   ASALDSLVIGETQIVGQLKDAFRFSQAKGYCSLNITRVMHYAFKCAAQVRTATSLGTGS
FT                   VSVASTAVSKAKDIIGNTKDVKALVVGAGEMSELTVKHLIASGFDVTIISRDTKKAQNL
FT                   ASTFEVHVNVEPYDKLTQLLITTPIMITATSAPYPIITKENAPSSNINRYWFDIAVPRD
FT                   IDENISMSNLEIFSVDDLQDIVNENMSLRAEQAKTAYGIVSRMSLEFFEWLKSLEIEPI
FT                   VKNLYLKGNEIIDKKVKNAIKKGFIDSKDEENIRKLCLTVITEYLHNPAKQLKDISKNM
FT                   ECDLVVGTVQNMFSLNENSTSKNRYKCDHLSKN"
FT   gene            387604..389310
FT                   /gene="proS"
FT                   /locus_tag="Abu_0388"
FT   CDS_pept        387604..389310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="Abu_0388"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="Pfam matches to PF00587 tRNA-synt_2b, score 191.1,
FT                   E-value 4.4E-055, and to PF03129 HGTP_anticodon, score
FT                   85.9, E-value 1.1E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66663"
FT                   /db_xref="GOA:A8ERT9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERT9"
FT                   /protein_id="ABV66663.1"
FT                   /translation="MKFSKMFIPTTKETPNDATLPSHQYLVRGGFIAQTGAGIYDFMPL
FT                   GKIVLEKIRAIVKEEMDEAGANEVQFGFVTPLTLWQESGRATTMGAEMLRFKDRKNGEF
FT                   VLSPTNEEAVVNMVKNRITSYKDLPLHLYQINTKFRDEARPRFGLMRGREFLMKDGYSF
FT                   HSSEEDLVREFNLMETTYKKIYTKLGLDFRVVAADSGAIGGSGSKEFHVIADSGEDTLV
FT                   VCDSCDYGANIEAAIRKPKTYSFERKSDSKKIHTPNTKTIEEVANFLNISKEQTIKAVI
FT                   KKAIYEEKTQIVIFFVRGSDELEETKACNAVNALELIDASEDDIKEAGLVAGYCGLFNL
FT                   PSNINFIIDLELKDEIGLACGANEEDYHLVNTDLSTLKDVKYYDLIAVQEGDICACCGG
FT                   KLSYTKGIEAGHIFQLGTKYSSAMNANFLDENGKAKPFIMGCYGIGVSRLVAAVIEQNH
FT                   DDKGCIWTKATAPFMVDIIVSNSKKEEEAKVGEELYSKLKQAGISTILDDRINARFGFK
FT                   MSDFELLGFPYAVVIGKKLEDGLVEIVDRKTLEKIDVKVDEVISKILELVK"
FT   gene            389322..390212
FT                   /gene="mscS"
FT                   /locus_tag="Abu_0389"
FT   CDS_pept        389322..390212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /locus_tag="Abu_0389"
FT                   /product="mechanosensitive ion channel"
FT                   /note="Pfam match to PF00924 MS_channel, score 234.2,
FT                   E-value 2.6E-067"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66664"
FT                   /db_xref="GOA:A8ERU0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU0"
FT                   /protein_id="ABV66664.1"
FT                   /translation="MEIEKEISKTIEKSIEKNVDVITRDLKSYIPNNIVEVIASHVFSF
FT                   IVALLIFFIGKWIVNKIVTILGKVLRKINGIDETLVKFLENIVYYALLTVVIIAALNKL
FT                   GIATTSFLAILGAAGLAIGLALKDSLGNFASGVMIVIFKPFKVGDSVVAGGVTGIVTEV
FT                   TIFNTVFLTADNQKIIVPNSSITGGSITNVNANDTRRVDIIVGISYEDNIKHAKEVLAN
FT                   IINENSKVLKDKAVGINVTELADSSVNLTINVWVKSSDFASTKAELLESIKTTFDEVGI
FT                   TIPYPKQEVYQYNKN"
FT   gene            390424..391398
FT                   /locus_tag="Abu_0390"
FT                   /note="AB0388"
FT   CDS_pept        390424..391398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0390"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number="2.7.7.72"
FT                   /note="Pfam match to PF01743 PolyA_pol, score 120.4,
FT                   E-value 4.8E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66665"
FT                   /db_xref="GOA:A8ERU1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU1"
FT                   /protein_id="ABV66665.1"
FT                   /translation="MTLKIDEYDFDFSLPRIEKKVGSSHTDFEVSTNANLSFKEAAIRR
FT                   DFTINAIGYDYFKNEILDPFDGMNDLKNKIIKHIDDKTFVEDSLRVYRSVQFASRFEFK
FT                   IDENTKILCKKIVSSGELKFLPKERVFEELKKLFLKSKKPSIGLSLLKEFNIMNIEQNL
FT                   EEIDNLAFILKDKNYDDFRKLYLFFSCLCKGMNENETFSFIKNLTDDKKFIKNILILNE
FT                   TNLTNDIKILKRLSLKLKLEDLIVLNQALGNTISLEVFEILKSLDILNTPIKSLILGKD
FT                   LIKLGFVPSEKFKEILDFAFDLQIEDDLSKSNIIEKIRQQYKF"
FT   gene            391455..391895
FT                   /locus_tag="Abu_0391"
FT                   /note="AB0389"
FT   CDS_pept        391455..391895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66666"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU2"
FT                   /protein_id="ABV66666.1"
FT                   /translation="MKKLVTLVAAVGLTTSLYANNTNTGCGLGSIVIKNQNTTILQALA
FT                   ATTNGTSGNQTFGISSGTSNCNKPNNFVSNDKLNQFVNENMDELAMDISAGKGETLSTV
FT                   AKLMNVEDTNAFSAKLQANFSEIYSSENVTSANVIDSIAKYI"
FT   gene            391879..393678
FT                   /locus_tag="Abu_0392"
FT                   /note="AB0390"
FT   CDS_pept        391879..393678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66667"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU3"
FT                   /protein_id="ABV66667.1"
FT                   /translation="MQNTSNFIERGIKYFILISLFFSASNSLELKNYIEEHKLYENSYW
FT                   AKLLHYRDGISEIDSTNFFISNNGKENLKEELFETINSLETGTNNVLCRFPLRVEWLKE
FT                   NIPTLEEKIVPYSCEELDKFLELTNAKYVTMVFPTAHINSPASMYGHTFLKVGSDKETP
FT                   LISNAINYAAKTDEKNGLIFAYNGLFGGYEGRYSIMPYYEKIKEYNNLEQRDVWEYDLN
FT                   LSQEEINKLVLHTWELKDSYANYYFFKENCSYNVLWLLEIARPSLDLVSYFDFKAIPLD
FT                   TIKILTKYDGLIVDSRYRYSNLKKMKHILNEEIENKEFLKAYINDEIELPDSLSQSDKI
FT                   SYLDFKIAYTQYQRSEDGTEKKEYIKNYLKLLKERSAYKQTRTYNIKSPLDPLISHDSA
FT                   RIGLFYDSNDSFEASIKPAYNDMYDIVDGYLQGAYIDFFELNFKKQKDKDAKLDRFTLI
FT                   KIKSYSSQDMIFKPISWGIDAGYEHFKDKDDYFKIKPEVGVSFGNDKDFIYSMLGSNIY
FT                   YKGNDQLYSAGVNIGFITNRIENFNIGVNYTYDKYNKSLENNQFEAFTTYKIDRNLALN
FT                   LKYINDDLYEKQDRVKVGVMFYF"
FT   gene            complement(393688..394920)
FT                   /gene="lnt"
FT                   /locus_tag="Abu_0393"
FT   CDS_pept        complement(393688..394920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="Abu_0393"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66668"
FT                   /db_xref="GOA:A8ERU4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU4"
FT                   /protein_id="ABV66668.1"
FT                   /translation="MFLLKREYFIQNFIIKGLLTAILLSLFIYLSYFDIEIKIINTLIG
FT                   LLGIYFLLTIPKKALFIAGFFTGILWCNWMSVSLQYYDLKYLTPVLILGIGLVYGIIFY
FT                   LFAFIDKLTIRILMVFGFTFFAPFGFNWMKFELLFIDSYISTSKIAFALILISFYFIIK
FT                   LKKHKLLGIIPLLFIFDFGKGTYIDTPKAKIYMPQMYINQDLKWQKEYQKELNAKNIEE
FT                   IHKAIDLKKDLVILPETAFSTALNRNVILLNELKNLSFSIDIITGALYVENNQIFNATY
FT                   HISNGEVKIAQKVVLVPFGEKIPLPKYFVDLINKTFYNGAQDYTEASEPTDFVVLGEKY
FT                   RNAICYEGTTDTIYENLGDTRYIIMTSNNAWFTPSIEPTLQNLLLKYYSKKYQVTVFHV
FT                   VNGSPNKIYRP"
FT   gene            394949..395212
FT                   /gene="yajC"
FT                   /locus_tag="Abu_0394"
FT   CDS_pept        394949..395212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="Abu_0394"
FT                   /product="preprotein translocase subunit"
FT                   /note="Pfam match to PF02699 YajC, score 131, E-value
FT                   3E-036"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66669"
FT                   /db_xref="GOA:A8ERU5"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU5"
FT                   /protein_id="ABV66669.1"
FT                   /translation="MNDLVSSLLPLVALFAIFYFLIIRPQQKQAKAHRDMVANLKKGDK
FT                   IVTNGGLMVEVVKVEETYFLVKNNDGSEMKLVKEFVAKLLED"
FT   gene            395279..396844
FT                   /gene="secD"
FT                   /locus_tag="Abu_0395"
FT   CDS_pept        395279..396844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="Abu_0395"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="Pfam match to PF02355 SecD_SecF, score -26.1,
FT                   E-value 6.5E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66670"
FT                   /db_xref="GOA:A8ERU6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU6"
FT                   /protein_id="ABV66670.1"
FT                   /translation="MKNFNYKLVIFLISIIFGIALSIPSLFQTEHGKKISLGLDLQGGL
FT                   HLLLGVNTHEAVTSKIKSVATSIKYFSDDEELLIDGLTISNDTITFSVLDKDEIPKMDT
FT                   MLKEIKGLDISITDLEYRIKLTKEDEIKTKDFAVSQAVETIRNRLDQFGLSEPTVLRQG
FT                   ETDIVVQLPGIKTAEEEKSARELISKPANLELMAVDEDRASQVNSMTSSQAAAYGDLIL
FT                   EDTNDSNKKYLVKEIPILNGSQIVDAHVSFSQQNQPVIGFTLNSAGARIFGDFTAKNVG
FT                   KRLAIVLDGKVYSAPNINERIGGGNGQISGGFTVAEAGNVAIALKSGALPATVTLLEKR
FT                   SVGPSLGADSIKASMLALVSGTVLIFLFMIAYYRRAGLIANVALVANIFIIIGVIALFG
FT                   ATLTLPGMAGIILTIGMAIDANVIINERIREVLRMGATIPKAIEDGYSNAMRAIVDANI
FT                   TTLLVAVVLYAYGTGPIKGFAVTIAIGILTSMLTSILGTQGIYQAILPKIVKDKDHKKW
FT                   FGVK"
FT   gene            396844..397812
FT                   /gene="secF"
FT                   /locus_tag="Abu_0396"
FT   CDS_pept        396844..397812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="Abu_0396"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="Pfam matches to PF02355 SecD_SecF, score 244.6,
FT                   E-value 1.9E-070, and to PF07549 Sec_GG, score 32.1,
FT                   E-value 1.8E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66671"
FT                   /db_xref="GOA:A8ERU7"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU7"
FT                   /protein_id="ABV66671.1"
FT                   /translation="MEIFNQKKIYDFMGKKWPFLIFSTILMIISLVLVFTRGFNFGIDF
FT                   VGGTIVQVKYDQTAPIEKIREVLKDTKYASAVVTEFGSTEEVTIRITGSSSDLTHDISD
FT                   EMNKILVPTGNFEIRKIDMVGSKVGAELREKGVISLILALAAILIYIGWRFEWRFAIAS
FT                   ILGLIHDIIITLGLLSLFKVDINLDMIAAILTLVGYTINDTIIVNDRIREQVQITKEKD
FT                   LDKIINESVSRTLSRTVLTSLSTLFVVTTMLIFGGEIIYSFSFTLFVGIIIGTYSSIYF
FT                   VSSFLKFFGFSVDDYRDKEAEKIKRKKDKEKLRSMYEQGTI"
FT   gene            397881..398060
FT                   /locus_tag="Abu_0397"
FT                   /note="AB0395"
FT   CDS_pept        397881..398060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66672"
FT                   /db_xref="GOA:A8ERU8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU8"
FT                   /protein_id="ABV66672.1"
FT                   /translation="MKSSKVLLGIVILLLAILTTIIFKIIDSNKKVEEEIVENKEPQQS
FT                   SIQDRRNALKEVFK"
FT   gene            complement(398053..398457)
FT                   /locus_tag="Abu_0398"
FT                   /note="AB0396"
FT   CDS_pept        complement(398053..398457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66673"
FT                   /db_xref="GOA:A8ERU9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERU9"
FT                   /protein_id="ABV66673.1"
FT                   /translation="MKEKRRILWPKSKCCLKKFLDLEFLARYGSIAIIIGSIAIQSLNI
FT                   VENKNFELSFFSIIINLFFLVVVLTKLEIIKIDSLEKYLDSLLKIMIFIFLLNFVAYLF
FT                   ANDLIQNYVYAPLSFLGAYFFFLLLYKKSI"
FT   gene            complement(398463..399218)
FT                   /gene="motB"
FT                   /locus_tag="Abu_0399"
FT   CDS_pept        complement(398463..399218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="Abu_0399"
FT                   /product="flagellar motor component MotB"
FT                   /note="Pfam match to PF00691 OmpA, score 23.8, E-value
FT                   3.2E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66674"
FT                   /db_xref="GOA:A8ERV0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV0"
FT                   /protein_id="ABV66674.1"
FT                   /translation="MAKKKCKCECPAGEKWAVPYADFLSLLLALFIALYALASINVEKQ
FT                   KALKEEFMKIYNFAASDTIKEQEETEKSMTTDPTNEPDEGRKPVVQPLTKQNELENKNA
FT                   KGGNLLELSDGTFMSVPAHLIFESGKAELSGADSADFLKKLAQLISAMPSDTEINVKGY
FT                   AEDSEVNKSRYKDALDLSTARANNVIRELLKYNIPSNRLYSSGYGSNKSGNLKDKRVVV
FT                   FELQTMQKVEEGDVDLETIFNNMKDNGQQ"
FT   gene            complement(399222..399980)
FT                   /gene="motA"
FT                   /locus_tag="Abu_0400"
FT   CDS_pept        complement(399222..399980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Abu_0400"
FT                   /product="flagellar motor component MotA"
FT                   /note="Pfam match to PF01618 MotA_ExbB, score 29.7, E-value
FT                   1.4E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66675"
FT                   /db_xref="GOA:A8ERV1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV1"
FT                   /protein_id="ABV66675.1"
FT                   /translation="MDLSVLIGMIGAVASISIGDLMEGGNPLHVLHFSSFLIVIPTAML
FT                   SAVTATESHAISAAFKEFKMIFKKLPINFEARIDELVEYAITVKKQGVLALEKDVQNIN
FT                   HEFLKEALSMVIDGSKEEQIEESLEPVIEETEHYYHSASHYWLLAGETCPTMGLVGAVL
FT                   GLILALQKLDNPAEMAAGIAGAFTATVTGIAGSYMFLGPWGLKMKSKGHVIVKEQQLIL
FT                   AAAKGMARGDAPGELKLKLTKMVTAMPLKV"
FT   gene            400128..400472
FT                   /locus_tag="Abu_0401"
FT                   /note="AB0399"
FT   CDS_pept        400128..400472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66676"
FT                   /db_xref="GOA:A8ERV2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV2"
FT                   /protein_id="ABV66676.1"
FT                   /translation="MDWGKVIYIFFSLMSLTTTAGFLYEPNAIALFIAAGVNVISTILK
FT                   LGVKNLLAAELLASSLVADLHLIPSFLVLTFTNNLPLAISLAIGAIVANAFSIALALIE
FT                   SAKSQDKEDF"
FT   gene            400472..402937
FT                   /gene="leuS"
FT                   /locus_tag="Abu_0402"
FT   CDS_pept        400472..402937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="Abu_0402"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="Pfam match to PF00133 tRNA-synt_1, score 62.3,
FT                   E-value 3.5E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66677"
FT                   /db_xref="GOA:A8ERV3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERV3"
FT                   /protein_id="ABV66677.1"
FT                   /translation="MEYISKDIEKKWQNFWSENQSFEPSSSKTKEKKYILSMFPYPSGR
FT                   IHMGHVRNYCIGDAFARHFRKSDFNVLHPIGWDSFGMPAENAAIKHKLHPKKWTYENID
FT                   YMRDELKSLGLSFSKNREFATSDELYTKWEQEFIIKMYEAGIIYRKSATVNWCPHDQTV
FT                   LANEQLEEGCCWRCGTEVVQKEMPGYYIGITKYAQELLDDLEKLKEDWPSQVLTMQENW
FT                   IGRSEGLEFKFDLSKESRAKLERAFTKYFVFTTRPDTIYGVSYSALAPEHPIVKYIVEK
FT                   NLLPEKKIKAIKAMQKIPERDRATQEKEGIDLEIEVMHPLTGKTIPVWVANFVLSSYGG
FT                   GAVMAVPAHDQRDFEFAKKYNLPIKQVIVGPDGIIENQTEAYTAEGRLIESENFTGVTN
FT                   IEAKKAIIYHFEQNSFGIKKVNYKLRDWGVSRQRYWGAPIPFIHCEKCGLVPEKIENLP
FT                   VALPEDVEITGEGNPLDTHPTWKHCTCPKCGEKATRETDTLDTFVQSSWYFLRYATDNK
FT                   KWNEVGISKEDSDYWMDVDQYIGGIEHAILHLLYARFFTKVLRDLGYTNSSEPFKKLLT
FT                   QGMVLKDGAKMSKSKGNVVDPDLIIDKYGADTARLFILFAAPPTKELEWNDSAVEGAFR
FT                   FIKKFFERAENVNQNGLDNFKSIDHSALSKEEKEARKKVYEALLKSNEVFTKTYTFNTL
FT                   IASCMEALNALQTQKNDSIWAEGYYILTNILEPIIPHACWELSKKLFDLKNFDGKIELK
FT                   EEVFALESIILAVTVNGKKRCEIEVAPDTSKDEILVKAKIASAKWLENSEILKEIVVPN
FT                   KLVNFVIKG"
FT   gene            402940..403464
FT                   /locus_tag="Abu_0403"
FT                   /note="AB0401"
FT   CDS_pept        402940..403464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66678"
FT                   /db_xref="GOA:A8ERV4"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV4"
FT                   /protein_id="ABV66678.1"
FT                   /translation="MFHTKKVLLTIFSVSLAFLFVACGYKPSTYYAKKEMEGNVYVKLD
FT                   VSLVDPRNSVLVKDAVTKILIQKLDSNLVDKEKDADVVMNLGISSVNLSALQYDAKGYN
FT                   KLYKAQVFIRVDYYRKENGIKKSFTVDGEYDFAVDIGGTITDANRYDAITKASDQAVSE
FT                   VVSRIAVQSFK"
FT   gene            403467..404639
FT                   /gene="folC"
FT                   /locus_tag="Abu_0404"
FT   CDS_pept        403467..404639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="Abu_0404"
FT                   /product="bifunctional folylpolyglutamate
FT                   synthase/dihydrofolate synthase"
FT                   /EC_number="6.3.2.12"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66679"
FT                   /db_xref="GOA:A8ERV5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV5"
FT                   /protein_id="ABV66679.1"
FT                   /translation="MKLDLKKVNLEEFLKYKTLYYDKIDFTIVRSSWNKLSAKIKLPFV
FT                   IHIVGTNGKGSTGRFLAHYLHKKEFKVLHYSSPHILKFNERIWINGSDVSDENLEIAHK
FT                   FLQELFEIELLEKLTYFEYTTLLAFYLSKDFDYLVLEAGLGGEFDATNVVENNISLITT
FT                   IGLDHQSFLGNTVEEIASTKMRSADNKMLIGYQVFPEVLETAYKVKEQIKQQRNKDIKI
FT                   IEVKEFDKYELNPKFATFLKRNLHLVIACLNELKIPLDLKLFDDTPLFGRCQKVLKNVT
FT                   IDVGHNPLAALVLANEFKNKKVNLIYNSYKDKDYETVLKILKPIIKAITIIEVEDKRIV
FT                   EKEELEKLIKQLELANNKTIKIEENEEYLVFGSFLVVEKFLTLIGYDANS"
FT   gene            404626..406746
FT                   /locus_tag="Abu_0405"
FT                   /note="AB0403"
FT   CDS_pept        404626..406746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0405"
FT                   /product="probable helicase"
FT                   /note="Pfam matches to PF04851 ResIII, score 99, E-value
FT                   1.3E-026, and to PF00271 Helicase_C, score 45.4, E-value
FT                   9.9E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66680"
FT                   /db_xref="GOA:A8ERV6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV6"
FT                   /protein_id="ABV66680.1"
FT                   /translation="MQTLEKRLEELYIQKTKIEEEIVFLTNQIKEKATLNQKKSFSKNE
FT                   KIELFKSLFVARFDIYAKKWVSRDGSKQGFFPVTKTFQGEDYTPLTNYEIEEHLRGNLF
FT                   LASYCINQKNMSKFVVFEIADEDKFKLQIALNSLNIKAYYELSSYNSLFVWVFFEEEIS
FT                   SKIAFNFALYLLKKANISAKTYPNKEFATKENLGNSIELPLHLKHRDKNRTVFIDMNTN
FT                   KIYEDQWSVLANVSKVSKQTISNFADVPNSTNVQKDLKKIEFPLQKIEIILEDYIYIPT
FT                   LNLSKSLISKLKSFATFENPQIKVLLSLRKPLFNTPKYIRSFEENENFLMLPRGLKETL
FT                   IDFFNVNAVSYSFVDKRVLNKIQTKTVTFNLRPEQNEAIKEIKKSDYSICVAPPGFGKT
FT                   LLGAKIFEIRACTTLIVVNKNMLLNQWVERFVDYFGYNKKDIGYLGKGFNKLNGQIDVA
FT                   TMQSLKNDPKIIENYSFVIVDECHHIPALTFEQIIKSFKGKYILGLSATPNRKDELQPI
FT                   LFQQLGEISYEYKKKKTHTNKLQIIRTQFVSNADNYATIINELCIDEDRNNLIVDIIKK
FT                   NIDRKILLLTDRIEHINVLENLLQKENIDYISVHGSLNKKEQVENMNLVKTKSLILATT
FT                   SYFGEGIDFPHLNTILFATPISYYGRLIQYLGRIGRGNQECLAIDFLDSKNAMLNSAYK
FT                   KRLEGYKQMHYR"
FT   gene            complement(406747..408450)
FT                   /locus_tag="Abu_0406"
FT                   /note="AB0404"
FT   CDS_pept        complement(406747..408450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0406"
FT                   /product="phospholipid/glycerol acyltransferase, possible
FT                   hemolysin"
FT                   /note="Pfam match to PF01553 Acyltransferase, score 32.2,
FT                   E-value 1.3E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66681"
FT                   /db_xref="GOA:A8ERV7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV7"
FT                   /protein_id="ABV66681.1"
FT                   /translation="MIDIQKEIEKKFPKIKEKENVLKKSLLKIAKKIVHEDSINQFLSQ
FT                   NSHLKGFDFVDAVLDYFDFDYTVSSNDLQNIPSTGKVIIIANHPLGGLDALCLLKLVGQ
FT                   IRKDVKILANDFLVGFEALHSLMIPLDNFKDRQSKESIKKIYEALKNEEAIIIFPAGEV
FT                   SRATPKGVKDPAWNKGFLNFAKNSNSAILPIFLDAKNSKTFYTISLINKTFSTLLLSNE
FT                   MFNKKSKNINIKIGQIIPSENITPKGLNKDFLVNLYKKHLYALKKGKKSFFQTQSAIAH
FT                   PVSKIDLYNELKKSPLLGQTNDGKKIYLYDYVEDSIVLKELGRLREISFRKVGEGVNKK
FT                   RDIDKYDVYYQHIILYDKNELEIVGAYRIGNSDMIFKEFGTKGFYSNTLFQFNDEFMFY
FT                   LQNSIELGRSFVQPKYWGTRALDYLWYGIGAYVKANPNIKYMFGPVSISGAFPAIAKDM
FT                   LVFYYNYYYSSEKNLVEARTPFSYSSHIHDIKEFFTLEDKKRDFKSLKIALSNIGVNVP
FT                   TLYKQYSELTLDDGVKFLDFNVDKNFGDCIDSFILVEIDKIKDSMKQRYM"
FT   gene            408556..409263
FT                   /locus_tag="Abu_0407"
FT                   /note="AB0405"
FT   CDS_pept        408556..409263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66682"
FT                   /db_xref="GOA:A8ERV8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV8"
FT                   /protein_id="ABV66682.1"
FT                   /translation="MNKGDIANLISVLIMAYGYSNANELVFMVGLFALSGAVTNSLAIY
FT                   MLFEKIPFLYGSGVIESKFTAFKISIHDLIMNQFFTKENLAKFFEEEVQNSKNSIDFEK
FT                   ILNQVDFTPAFYSLKESVVESPFGGMLAMFGGASALEPLKEPFINKLQTSLIDISNSPS
FT                   FLTIVNEVIKSKNFNDEIYEKISKIVNARLEELTPKMVKEIVQNMIKEHLSWLVLWGAV
FT                   FGGLFGLIGMLIS"
FT   gene            complement(409281..409658)
FT                   /locus_tag="Abu_0408"
FT                   /note="AB0406"
FT   CDS_pept        complement(409281..409658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66683"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERV9"
FT                   /protein_id="ABV66683.1"
FT                   /translation="MNYELLSKIAMKESDALKKEVAILQKRDELLNLEITNLKSMIEII
FT                   EKEKTELREERNHLKNEKNTLNAEKLLLIEERNSLEKEIISLKRDLDFLRKTTNMEDIK
FT                   EIQKGKKEEIQQKQTSFEFYS"
FT   gene            409789..410094
FT                   /locus_tag="Abu_0409"
FT                   /note="AB0407"
FT   CDS_pept        409789..410094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66684"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW0"
FT                   /protein_id="ABV66684.1"
FT                   /translation="MNGIEVLILLDVVELEDKEKFEKHLKKEGFKNVEGEEFVYTGHST
FT                   TTTFSTKAYILEVFKKGLQKTNFKSANLIFLLNETPYPAYYYDKNTNEFELVEVEK"
FT   gene            410094..413081
FT                   /gene="mfd"
FT                   /locus_tag="Abu_0410"
FT   CDS_pept        410094..413081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="Abu_0410"
FT                   /product="transcription-repair coupling factor"
FT                   /note="Pfam matches to PF00270 DEAD, score 126.4, E-value
FT                   7.5E-035, and to PF02559 CarD_TRCF, score 120.6, E-value
FT                   4.1E-033, and to PF03461 TRCF, score 99.5, E-value 9E-027,
FT                   and to PF00271 Helicase_C, score 71.7, E-value 1.5E-023"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66685"
FT                   /db_xref="GOA:A8ERW1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW1"
FT                   /protein_id="ABV66685.1"
FT                   /translation="MKNIYEFLKNLKDEKRLKECQLLIVNDDRQAQIASDIVSYLGFKP
FT                   FLLADFRANFGDDLLSFSEELHEITKTLGDFYSYKKQDKILISPIRTISYPLPKEKCFE
FT                   SFTINFADRLNLEELKSKLYNWGYYFVDIVTSEGEVSLRGDILDICPLGSDFGYRVSLF
FT                   DDEVESIRKFDIEDQKSSKEEIESFSINPAFLALDEATFEEINEQIQTISSDAFIKDIH
FT                   SLGFWYLGELGEYLPQKMSSFITQDALDELEEVYVFEEKRVNKDKFLLTPQIYNSKNYQ
FT                   EINPANVKEFISFHNDKKITIISGSEAKVKGYDLDLSDKNINYVFENYILNLVSDDEVI
FT                   ISLNKEVKKRRKKKVKLVLDELQYNDFVVHEKYGIGQYKGIEPVTVMGAKRDFVIIQYQ
FT                   GEDKLLVPVENLDLIDRYVADGNSYAVVDKLGKGSFAKLKEKVKDKLFAIANDIIKLAA
FT                   ARELVNGIKINTDKKVLEDFQKSAGFEYTKDQKRSIKEILDDLSSGRVMDRLLSGDVGF
FT                   GKTEVAMNALLAVILDGYQTIFVCPTTLLATQHYHSIQKRLESFGIRVAKLDGKTTAKE
FT                   KTSIKKGLENADIKLVIGTHSLLDIKTSNLALVIIDEEHKFGVKQKEKLKQLREDVHIF
FT                   SMSATPIPRTLNLALSKLKGMSSLLTPPSERLGVRTYVKEYSEKLIKEIILREKRRGGQ
FT                   LFYVHNNIASIEAKKKDIEAIVPNIKIDIIHSQIKPEQAEKIIEAFENKEFDILLATSI
FT                   VESGIHLPNANSIIIDGADRFGIADLHQLRGRVGRSNKEGYCYYVVEDKKSITDDAVKR
FT                   LVALESNSYLGSGTALAHQDLEIRGGGNIIGEAQSGHIKQIGYGLYLKMLEDTLATLSG
FT                   DEKNEKKTVDIKLAISAYISDEYISEDRVRLELYRRLSKASDIQEVYSIEEEMEDRFGK
FT                   PDIVTKQFIELIIIKILALKLGIQTISSYEMNITFTKADDTKESIKSPSKDDDDIINTT
FT                   LRYLRK"
FT   gene            413093..413611
FT                   /locus_tag="Abu_0411"
FT                   /note="AB0409"
FT   CDS_pept        413093..413611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0411"
FT                   /product="putative acetyltransferase"
FT                   /note="Pfam match to PF00583 Acetyltransf_1, score 39.4,
FT                   E-value 1.1E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66686"
FT                   /db_xref="GOA:A8ERW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW2"
FT                   /protein_id="ABV66686.1"
FT                   /translation="MNLQFKELQKEDIKEVILLINEAYRGEKKDKAWTTESHILDGIRV
FT                   NEDMMKEILEEKETKTYIAKVDNKIVGTIQVKLQGESIHVGLFAVDTKSQASGIGKKLL
FT                   EFAENSSSKLWQKSTFLIEVISTRTELMQYYIRRGYQNTNSFIEFPKSEHWTPNTNEEL
FT                   KLLVLKKTI"
FT   gene            complement(413608..414549)
FT                   /locus_tag="Abu_0412"
FT                   /note="AB0410"
FT   CDS_pept        complement(413608..414549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF03372 Exo_endo_phos, score 36.3,
FT                   E-value 4.6E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66687"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW3"
FT                   /protein_id="ABV66687.1"
FT                   /translation="MKLRVGTFNLFQFCSPPFSFYTKKEKFTPEEWNEKIAWCKNQLNL
FT                   MNCDIVGFQEVFSNDELKNLCLEVGFKYFEVVDFAKVDKKNEKVYISTTVAIASKFPII
FT                   NIEKIDTKSFKFARIPIKAIISLPNEKNITVYITHLKSNRENEFEYIFTKNDTLEDKLK
FT                   KVEVALKDNYSLSLKQRINEAKILFYDIKSNKTPTILMCDLNDKEFSITIDALTNKRFY
FT                   NKNLKKDDYLLFDAYYLHKPKIYNPHPEFKGIKRTPTSYFAGKGNILDYIFVSKELQKI
FT                   SSYEVFDKHLQKNHNGSLKQSDHAQVVCEIEI"
FT   gene            414654..415100
FT                   /locus_tag="Abu_0413"
FT                   /note="AB0411"
FT   CDS_pept        414654..415100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0413"
FT                   /product="hypothetical periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66688"
FT                   /db_xref="GOA:A8ERW4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW4"
FT                   /protein_id="ABV66688.1"
FT                   /translation="MKKIVSSLVITSLVAGALFAANGEMKKDDKRFDAPNCMYQKDFKG
FT                   HMPFFGNDGILGLIHELNLTSKQKEDIRKIIDESRKAQKSPLDAFSKDGFDKEKFIQIE
FT                   NEKRDSMIKSKAEVIEKTYAILDAKQKEQLKVLIDLRKEKRDKK"
FT   gene            415134..415814
FT                   /gene="ompR"
FT                   /locus_tag="Abu_0414"
FT   CDS_pept        415134..415814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="Abu_0414"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 118.1,
FT                   E-value 9.6E-036, and to PF00486 Trans_reg_C, score 52.4,
FT                   E-value 1.4E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66689"
FT                   /db_xref="GOA:A8ERW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW5"
FT                   /protein_id="ABV66689.1"
FT                   /translation="MIKIAMIEDDLELAEVLCQYLKQFNIEVTNYEEPYLALSALKMNK
FT                   YDLIILDLTLPGMDGLDVCKEIVKSFNIPIIISSARSDITDKVTALKLGADDYLPKPYD
FT                   PRELEVRIKTILRRFNNSQSSEEDTKSKIFVLNEEKREITKNGKFIKLTAAEFEVLSLL
FT                   IKREGFVISREDIFENSDLLNQDYESSGSLAVIINRIRHKIEDNSKESKYLHTIRGMGY
FT                   KFIQ"
FT   gene            415811..417046
FT                   /locus_tag="Abu_0415"
FT                   /note="AB0413"
FT   CDS_pept        415811..417046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0415"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam match to PF02518 HATPase_c, score 24.6, E-value
FT                   1.5E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66690"
FT                   /db_xref="GOA:A8ERW6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW6"
FT                   /protein_id="ABV66690.1"
FT                   /translation="MINRQSIFFTILISFLISILLVIISFIIILANSYKAQEEQIYDRY
FT                   IPISKMINRIEFDFSEEIIKNFEEMNYKLYIEKKEINKITNDKNMKIFSERIHPKHGDI
FT                   FRILKNNTDYYLYMKVRDNEVLVKDQNGFSNSRQIYIILVFSILLITITILYFMSLKKL
FT                   MPLKVLKDKVKSLGDENFDFEYKNIEAKDEVSSLAMEFKKTSLKLKNLKEARNVFIRNI
FT                   MHELKTPITKGKFLTQLEQNEENNEKLKSVFDRLESLINEFATIEELISSTKNIEKKVY
FT                   FLDDIIDNAKDILMIEDEKVIQNYENKKIEVNFKLFSIAIKNLIDNAVKYSPNKEVTIK
FT                   VENENIIFENMGKKLEAPFEKYFEPFFSSEDKSKNSFGLGLYIVYNIFKANGYILEYEH
FT                   INGLNRFICKKG"
FT   gene            417092..418198
FT                   /locus_tag="Abu_0416"
FT                   /note="AB0414"
FT   CDS_pept        417092..418198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF03486 HI0933_like, score 248.6,
FT                   E-value 1.2E-071"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66691"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW7"
FT                   /protein_id="ABV66691.1"
FT                   /translation="MLASNLDKKKYKNICLIESSKTLAPKVKVSGGAKCNITNDFVTYK
FT                   NYLGDENFIKTILERFSKDDLLTFLNKNQLFPKINPKIVKGTYFCNSSQDVIDMFSKLT
FT                   THVKKYLETKVLDVSFDEYYKIKTDSKTIEAKKLVVASGGLSFPLLGASSIAFDIAQKF
FT                   GHTIKKLEPALVGFTVQKEQFWFKNLSGVSLPAKAFVEDKTFEGSLLFAHKGCSGPLIL
FT                   TTSLYWKKGKIVLDFLPNKKIEKFLTGNKNISSSLPLAKRFIQEFLVSQDLEDKAVSKL
FT                   TQEELEKLKLLKNYEFSPAGNFGFTKAEVTKGGINTDEINHLSFESLKQKNLFFIGECL
FT                   DITGELGGFNFQIVFSQAYICSLYLNNI"
FT   gene            418249..419661
FT                   /locus_tag="Abu_0417"
FT                   /note="AB0415"
FT   CDS_pept        418249..419661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0417"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam match to PF00015 MCPsignal, score 137, E-value
FT                   4.8E-038"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66692"
FT                   /db_xref="GOA:A8ERW8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW8"
FT                   /protein_id="ABV66692.1"
FT                   /translation="MFFGNKNLEEKVSYLEREIEDLKNQLVQKDKKIEEIEKDYSFKLE
FT                   NVLEKNSKDIELYKEIASFSQEEGLVVFDENNQLFFANSLSKSNIKDFSTVLDAVLNEK
FT                   PSLVLEDCEAHIEVKNYENKKIVSLRKTSIHDNKDGGLLSRHNINMTNSLNGTQQTYLT
FT                   LLDELQDMSKESKETANGSTQGLNLINEIVYDTDNLHKEIELENEVVASLVSKSKDIAQ
FT                   VINIIQEIAFQTNILSLNAAVEAATAGEAGKGFSVVAQEVRNLATRSADAAKQIKDVVN
FT                   LIQNETEKIKQSSETVSSVVNETKSRIGVLSKLMNTFQKNSNRGVYEVESISNRIFINL
FT                   AKLDHVIYKNNLYQLIFGGEHNFKPVDHHNCRLGKWYDTGLGREQFSIVPSYKSLEKHH
FT                   HIVHHEANLLANECSGSKVSCSKQLIEDKIELVEKASEQVFIYLDKILDEKSDLIMKEA
FT                   AKKLFDGEKVDG"
FT   gene            419654..420031
FT                   /locus_tag="Abu_0418"
FT                   /note="AB0416"
FT   CDS_pept        419654..420031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0418"
FT                   /product="two-component response regulator"
FT                   /note="Pfam match to PF00072 Response_reg, score 108.6,
FT                   E-value 8.3E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66693"
FT                   /db_xref="GOA:A8ERW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERW9"
FT                   /protein_id="ABV66693.1"
FT                   /translation="MDKKYSIAIIDDEVEILNLLSRFLSRNPKFSVANYANPLAALESL
FT                   NMSSYDIILLDIMMPQMNGLEVLEKIKEKNENQKVIMMTAYSTLDKVLKSHKEGATNYV
FT                   MKPFDSLQHLEKKIIDILEKH"
FT   gene            420032..422074
FT                   /locus_tag="Abu_0419"
FT                   /note="AB0417"
FT   CDS_pept        420032..422074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0419"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="Pfam match to PF08447 PAS_3, score 63.8, E-value
FT                   5.9E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66694"
FT                   /db_xref="GOA:A8ERX0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX0"
FT                   /protein_id="ABV66694.1"
FT                   /translation="MSHKNLFFRYFFYFLISFFLIILFLDFFKEKEFETSLKNYKQNTY
FT                   KEYSNYYNIYSNNSELIYFNEFIKNKQIIKILKSSVNLPLLKKELYDELELSLSFYSTL
FT                   NLDEMTIYSPKKDLLFSFKESSKDNFTSKIVEQVISNKKEEVNFRIVEKNIYILFSKPI
FT                   FDEKLNFLGVVNLEFKLENLIKNMKKDNSIEYKEIISNNFDFGNAFKISEQQKKELINN
FT                   FGNKKEVSFVSQDRYLNIPVVFIPIFYSEFYKNSIYLMSYDLSKKNEIQMIDSFYNKLL
FT                   LVLNLISFFIIFLIYKMVNIKSQRDLINKKYENIFNEIDNYIIKVDLDLQGNIVFATKS
FT                   FYKISGYSQEEIIGKNINLLRHPDMSNIFFKNLWQTIKTEGSWQGEIKNRDKFGNTYWI
FT                   KSIIFPRYNFKNQIEGYSSIRTDITDTKQFEKINKLLKEDLSNKLNDIKVKDKNLVESA
FT                   KVALMSKILDSLGHQWKVPISRIFFEILRLKNLKKDDISERNLREIEKNIELELKNLSD
FT                   ILNEIKNIFNPRKSENSNLLTVVIEAITYLESELKKYNIEVKFDIDKEIYINILSAELK
FT                   TIIINILKNCIEQVELNRIESTKIYITAIYENMNNDILIKIEDDIKSKNKKIILDEILT
FT                   SSEEKYFDTSIYLSKLLIEKNSGLFWCKNSEDETKYYIKLTKEIK"
FT   gene            422071..424494
FT                   /locus_tag="Abu_0420"
FT                   /note="AB0418"
FT   CDS_pept        422071..424494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0420"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 69.6,
FT                   E-value 8.8E-018, and to PF00989 PAS, score 43.6, E-value
FT                   1.1E-012, and to PF00512 HisKA, score 36.7, E-value
FT                   7.1E-008, and to PF00989 PAS, score 22.5, E-value 2.5E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66695"
FT                   /db_xref="GOA:A8ERX1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX1"
FT                   /protein_id="ABV66695.1"
FT                   /translation="MKVSFYVKLFLAFIIFSILILGFVSYLFDNFYTFYDDKQDKQLSE
FT                   NVLKQQEDKFLSYLKKYDEKLLLIQSIIPEFKNENEIINFIENTLFEDKNILVFKIVSL
FT                   DSKEILKLYNEKNTKLSRDYRLKNLFSKVYFKEMRTLKYKEVLYHCDEDNSKTINFIIR
FT                   NKDDFYILKIDLENLIQGLSSDFSKKVLILDPKGIFLNDSNLTSFDEEEFLSKKVYINE
FT                   NKYFTFFIKKKDKLKKDFIEEYHKSIIISGFLIAFFIAIIFSVIISRLNKSIEEDNKKL
FT                   DLNIKEKYLKLSENQEIMDNHIMFIRIDKNGFITKVSRAFCYFLGFSEAELIGHHYKIL
FT                   IHKDIKNLGRMVRKRLNEKIFHLNEIKGAKKDGEVFWLDLLIEVIIENEQIDCYNIICT
FT                   DRTNKKKIENLYNNLNNQIDEYDAIFENVHSGIALIDLDGKFVKLNSKMSELLGFRSDE
FT                   LLTMTCLDVIADDSKTILNKILKEIDEIGNISKLEKIFIKKDKTPIHLELSLSLLGDKQ
FT                   RVVFVINSLEDKRKLQELNLDLAEKIKQEVEKNIQKDKFHQQEQLKNAKLTYIGSLAAG
FT                   ITHEINTPLTYIKGNLEMMSYDISDLPDGDIKDRMLFDSEKMKEGINRIANIVESMREM
FT                   AQSSKEVKEKTNIYSTLITSLTMVHNRSKQISRIYLNNEQFDINNIDKNQFSFFSKVQK
FT                   QRIEQVWVIVINNALDELIKIENYENRILNILLYEEENEIIVKFKDNAGGIKEDIINDI
FT                   FEPFVSSKDHSGMGVGLNIAKKIIEEQNGDILAYNQDAGAVFEIKLKKYIDESR"
FT   gene            424495..425307
FT                   /locus_tag="Abu_0421"
FT                   /note="AB0419"
FT   CDS_pept        424495..425307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF00149 Metallophos, score 41.3,
FT                   E-value 3E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66696"
FT                   /db_xref="GOA:A8ERX2"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX2"
FT                   /protein_id="ABV66696.1"
FT                   /translation="MRIGFIGDIVGRPGRKIIKENLIKIKAEFNIDFIIANGENASHGF
FT                   GLTVESSKELFKSGIDLITGGNHSFDKKKDMLALLETSNVLRPDNYPQGLVGSGVKICE
FT                   IKDEKLAVINLMGQYGMPIVENPFNWAKNLILKLQEENIKNIFVDFHAEATSEKRVLLM
FT                   LLKNQVSAICGTHTHVGTDDLQIFENTAYLTDIGLTGCYDNVIGMDAKIPIQKATTGIS
FT                   GHFEVPNSCKSILQMMVVDIEDGIAKDSFKIKKYCNNANLIITQAIII"
FT   gene            425354..426148
FT                   /locus_tag="Abu_0422"
FT                   /note="AB0420"
FT   CDS_pept        425354..426148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66697"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX3"
FT                   /protein_id="ABV66697.1"
FT                   /translation="MMIIIPQTKGGVGKSTVAMQVIAPYLYKKHGKKITYIEIDDENND
FT                   SRSFTRTEIVDKRMLGTNKITDLDELILMDDKHEVIVDVGGNKTSSLVLDEIKKVGSFG
FT                   NVKWIIPLGDGELDGKNAIATMKKIKKIEKNPEDNLIFALTRAISMDEDYYNEQFINFF
FT                   GHKYLDSNSVICDFVKEPKYFPVKNDKIITMSRYLGSTVWEMAYNNTDFAAKAMSAKEM
FT                   GDIESARKYLFFRRIQTEAKDYVLNTLNRIFCDLDKWIEIKK"
FT   gene            426145..426393
FT                   /locus_tag="Abu_0423"
FT                   /note="AB0421"
FT   CDS_pept        426145..426393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66698"
FT                   /db_xref="GOA:A8ERX4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX4"
FT                   /protein_id="ABV66698.1"
FT                   /translation="MSDMSFKQAKELVERMEFSEIAINKAMENLEKSSQNFEETLKHQE
FT                   DIINRLPYADKKLSIMAILVAGNIGLIIGLLIGKFLL"
FT   gene            426531..427241
FT                   /gene="ubiE"
FT                   /locus_tag="Abu_0424"
FT   CDS_pept        426531..427241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="Abu_0424"
FT                   /product="bifunctional ubiquinone/menaquinone biosynthesis
FT                   methlytransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Pfam match to PF01209 Ubie_methyltran, score 75.5,
FT                   E-value 5.7E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66699"
FT                   /db_xref="GOA:A8ERX5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX5"
FT                   /protein_id="ABV66699.1"
FT                   /translation="MEKQEKIVSMFNNIAGTYDIANRVLSMGIDKSWRNKACNKTFELY
FT                   GKKDIEKIVDVACGTGDMILFWQQVANENSVNLKNIIGVDPSIGMMEVGKKKLPDVEFI
FT                   EAYATQMPLIDKSADIISISYGIRNVVQRQEAFDEFARVLKKDGLVVINEFTKNKKENL
FT                   LDHLTDFYLNKVLPVLGGLISKNKEAYRYLPDSIDEFLTTENLCKELKQSGLEPVYVKA
FT                   FSMNISTLIIAKKI"
FT   gene            427266..428453
FT                   /gene="xseA"
FT                   /locus_tag="Abu_0425"
FT   CDS_pept        427266..428453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="Abu_0425"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="Pfam matches to PF02601 Exonuc_VII_L, score 140,
FT                   E-value 4E-034, and to PF01336 tRNA_anti, score 44.4,
FT                   E-value 3E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66700"
FT                   /db_xref="GOA:A8ERX6"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX6"
FT                   /protein_id="ABV66700.1"
FT                   /translation="MNSPISVSTLNLQIKSLLETTFIQVYVEGEISNLTYHNSGHIYFS
FT                   IKDENSTLSCVMFKGNTKYLKFQLENGLKIVITGSLTVYAPRGNYQLLCNKIEPSGIGS
FT                   LSLAFEQLKTKLEAKGYFERSRKKTLPRYPKKIAIVTSPTGAAIEDMKKVATHRWSLVE
FT                   FILIPTLVQGEGASLDIANSIKYADKLNCDIMIVGRGGGSIEDLWAFNEEIVANAIYEA
FT                   KTPIISAVGHEVDYLISDFVADIRAATPSNAIEIALPDINEHRIYLDSLENEITNRFKN
FT                   ILFNKEQELKNMKKLFEQNSIETKFNFIQTQINFIKSSLKINLNQKFLSYQNQIDLLKS
FT                   NYLSNHPDKKEKNGFVQISKSNKVINLADLKIGDEIELQTPKYIASCTLNKLVKQ"
FT   gene            428527..429006
FT                   /gene="cheW"
FT                   /locus_tag="Abu_0426"
FT   CDS_pept        428527..429006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="Abu_0426"
FT                   /product="chemotaxis protein CheW"
FT                   /note="Pfam match to PF01584 CheW, score 85.3, E-value
FT                   1.8E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66701"
FT                   /db_xref="GOA:A8ERX7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX7"
FT                   /protein_id="ABV66701.1"
FT                   /translation="MENNRDKAVSSSKITEFMTFELGAMKYAIELPKIKEILTYPDNIT
FT                   TLPNTSKWVKGLINSRGEVVPILDIRIKFNTGPAVYDENTSIITVITEDKRMIGIVVDL
FT                   VDDVQKLDTSMLAQVAEMGSAIPPKYLKGYVRLDNNQMLVIMDIERVVDKEELQD"
FT   gene            complement(429034..429567)
FT                   /locus_tag="Abu_0427"
FT                   /note="AB0426"
FT   CDS_pept        complement(429034..429567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0427"
FT                   /product="peptidyl-prolyl cis-trans isomerase-like protein"
FT                   /EC_number="5.2.1.8"
FT                   /note="Pfam match to PF00160 Pro_isomerase, score 206.1,
FT                   E-value 7.3E-059"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66702"
FT                   /db_xref="GOA:A8ERX8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERX8"
FT                   /protein_id="ABV66702.1"
FT                   /translation="MKRILFILCCFTLFLNAANPVATFKTSKGDIEVELRPDLAPKAVE
FT                   NFVTHAKNGYYNGQIFHRVIKNFMIQGGDPTGTGAGGESIWKEDFADEFAKNAVFDKPG
FT                   ILAMANKGPNTNNSQFFITTVPTYWLNGYHTIFGYVINGFDVVKAIENVRTNGKYNGDK
FT                   PLEDVKIISISIKE"
FT   gene            429721..430104
FT                   /gene="panD"
FT                   /locus_tag="Abu_0428"
FT   CDS_pept        429721..430104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="Abu_0428"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="Pfam match to PF02261 Asp_decarbox, score 268.7,
FT                   E-value 1.1E-077"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66703"
FT                   /db_xref="GOA:A8ERX9"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERX9"
FT                   /protein_id="ABV66703.1"
FT                   /translation="MTFEMLYSKIHRATVSDANLNYVGSITIDEDLMKAANLRVGQKVD
FT                   IVNINNGERFQTYIIKGKAGSKDMCLNGAAARKVEIGDKIIVIAYATFSEAELENYKPT
FT                   VVLVDDKNNIELITHELEGGKYV"
FT   gene            430097..430417
FT                   /locus_tag="Abu_0429"
FT                   /note="AB0428"
FT   CDS_pept        430097..430417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0429"
FT                   /product="conserved hypothetical protein (DUF149 domain
FT                   protein)"
FT                   /note="Pfam match to PF02575 DUF149, score 99.8, E-value
FT                   7.7E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66704"
FT                   /db_xref="GOA:A8ERY0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERY0"
FT                   /protein_id="ABV66704.1"
FT                   /translation="MFDGLDLKNLNLGDMLNQFQDMAKNAQNENASRIFTSKAGGGMVE
FT                   ISINGNSEVVDLKIDDSLLEDKDSLQILLISCMNDVIKQSDENKKMMAMNLMGGLGSFG
FT                   QK"
FT   gene            430422..431282
FT                   /gene="ispA"
FT                   /locus_tag="Abu_0430"
FT   CDS_pept        430422..431282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="Abu_0430"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="Pfam match to PF00348 polyprenyl_synt, score 251,
FT                   E-value 2.3E-072"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66705"
FT                   /db_xref="GOA:A8ERY1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY1"
FT                   /protein_id="ABV66705.1"
FT                   /translation="MKDLLNSFEDYLLKNLPISKTFHPHFEDALADMLKAGGKRFRPML
FT                   LLSVVKSNKSLLVPNAMSVALGVEFLHTYSLIHDDLPAMDNSDLRRGFQTLHKKYDEVT
FT                   AILVGDALNTEAFNLIANASLHNDIKVELIKCLAHNGGINGMIIGQAIDCHFEKQKIQL
FT                   NQLEFLHIHKTARLIAASLKMGAIISEYDLQTQEKLYNFGIDLGLLFQIQDDIIDETCT
FT                   EEEAGKTTQNDGFKNSFVNLLGLDGAKKSADDLALKCIDSLNTFEENLKKSLEELLLKY
FT                   INRHK"
FT   gene            431419..431676
FT                   /gene="groES"
FT                   /locus_tag="Abu_0431"
FT   CDS_pept        431419..431676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="Abu_0431"
FT                   /product="10 kDa chaperonin"
FT                   /note="Pfam match to PF00166 Cpn10, score 135.9, E-value
FT                   1E-037"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66706"
FT                   /db_xref="GOA:A8ERY2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY2"
FT                   /protein_id="ABV66706.1"
FT                   /translation="MNFKPLGERVLVKRTEVENKTASGIYIPDNAKEKPQTAKVVAIGN
FT                   KVEDVKVGDTIVFEQYRGTEFKLEGEEYLILNIENVIGVM"
FT   gene            431676..433310
FT                   /gene="groEL"
FT                   /locus_tag="Abu_0432"
FT   CDS_pept        431676..433310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="Abu_0432"
FT                   /product="60 kDa chaperonin"
FT                   /note="Pfam match to PF00118 Cpn60_TCP1, score 673.1,
FT                   E-value 2E-199"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66707"
FT                   /db_xref="GOA:A8ERY3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERY3"
FT                   /protein_id="ABV66707.1"
FT                   /translation="MAKEILFSDNARNRLYSGVEKLADAVKVTMGPRGRNVLLQKSFGA
FT                   PTITKDGVSVAREIELKDTLENMGAQLVKEVASKTNDEAGDGTTTATVLAHSIFKEGLR
FT                   NVTAGANPISLKRGMDKACEAILAELKKSSKVVANKTEIEQVATISANSDSAIGKMIAE
FT                   AMDKVGKDGVITVEEAKGISDELDVVEGMQFDRGYLSPYFVTNPEKMIAEFNNPFILLY
FT                   DKKISSLKEMLPILESVNQSGRPLVIIAEDVDGEALATLVVNRLRGSLHIAAVKAPGFG
FT                   DRRKAMLEDIAVLTGGTVISEEMGMKLETAEFSCLGTASKIVIDKDNTTIVDGNGDNER
FT                   VVARVNQIKAEISNTTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDAL
FT                   SATRAAVEEGIVIGGGAALIKASKKVNLDLTGDERIGADIVLRAISAPLKQIAINAGFD
FT                   AGVVANEVEKSSNENLGFNAATGEYVDMFEAGIVDPAKVERVAMQNAVSVASLLLTTEA
FT                   TVSDIKEDKPAMPSMPDMGGMGMPGMM"
FT   gene            complement(433660..435036)
FT                   /locus_tag="Abu_0433"
FT                   /note="AB0432"
FT   CDS_pept        complement(433660..435036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0433"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 122.1,
FT                   E-value 1.4E-033, and to PF00512 HisKA, score 65.1, E-value
FT                   2.1E-016, and to PF00672 HAMP, score 36.1, E-value
FT                   1.1E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66708"
FT                   /db_xref="GOA:A8ERY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY4"
FT                   /protein_id="ABV66708.1"
FT                   /translation="MKINLSIKKKLLFYSFFIQTIILVIFSFSLYKALEISTIDKLEAT
FT                   LKVIVLDITDDILEKNKITDNILDEEKEYNFEPLYIRILDTKTHKEIIKTDNFPNNIDH
FT                   NDDYLDKLKENVITFEEQYSYFVSRIKIDFHGEQSIIIEAVTTKDILTSTLENLLYILG
FT                   FILPIILIFAVIGGNFVIYKSFLPIENILVELKQINANDLSARLKTTKSKDEINQLINE
FT                   INSLLSRLENSFERMSQFSSDASHELKTPLTIIKGEMEVTLRKDRTINEYKEALKTSLE
FT                   EISGIEQTINDLLFLAKNEQELIVDKQEEFYLDELADEAINELKNFAKLHKIKISLIIE
FT                   DSLEMKGFASLLKIAIKNILKNAIQFSYENKEVIVKIFKENDLLNISIEDFGIGIPTNE
FT                   QEKIYEKFYRTDKSRNKNSGGTGLGMSIMKKIVDIHKGKISLISQENIGTKITLSFSIK
FT                   "
FT   gene            complement(435026..435703)
FT                   /locus_tag="Abu_0434"
FT                   /note="AB0433"
FT   CDS_pept        complement(435026..435703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0434"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 131.1,
FT                   E-value 1.1E-039, and to PF00486 Trans_reg_C, score 66.7,
FT                   E-value 6.7E-017"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66709"
FT                   /db_xref="GOA:A8ERY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY5"
FT                   /protein_id="ABV66709.1"
FT                   /translation="MISMKILIIEDDLKIINFLKKGLEEECYIVDFSTNGDEGLYLASI
FT                   NTYDLILLDIMLPVKNGIEVCKSLRSSNIQTPIIMLTAKDSIEDKIKGLDIGANDYLAK
FT                   PFSFAELLARIRVQLRITTTTQTKLSIADLELDLLNKTASRSNQNIVLTAKEFSLLEYL
FT                   IKNKNRVLSETTINEALSSFEDSNISNIVNVYIYRLRNKIDKNFENKLIKTVRGIGFKI
FT                   SED"
FT   gene            complement(435700..436431)
FT                   /locus_tag="Abu_0435"
FT                   /note="AB0434"
FT   CDS_pept        complement(435700..436431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0435"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="Pfam match to PF00149 Metallophos, score 59.2,
FT                   E-value 1.2E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66710"
FT                   /db_xref="GOA:A8ERY6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY6"
FT                   /protein_id="ABV66710.1"
FT                   /translation="MNLTKHFQIINIEVEDKKLDDLKILHLSDLHINKKTSIEKILELV
FT                   NFCNNLEFDFCIITGDIIDTKVKFIKKQLEILNLLKKEVFYISGNHDLFYGLEDLKKEL
FT                   TNFIFMDNETLKINYKNEIIHLAGLPDRFSKFFKIKREEKVVEDFLQNSPSIFISHQPK
FT                   DYKIALNSNSNLFLCGHTHGGQIYPFHYLVKLVQPFLAGLFYKNKTAIYVNKGLGTWGV
FT                   DFRFKADAEVTILKLITKSVK"
FT   gene            complement(436428..436883)
FT                   /locus_tag="Abu_0436"
FT                   /note="AB0435"
FT   CDS_pept        complement(436428..436883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66711"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY7"
FT                   /protein_id="ABV66711.1"
FT                   /translation="MIKQLILSIIFVNSLFAVNLKIEDKISNFSLIDQFDKIHTITNDI
FT                   KIIIVTFEKETLSMVNNFLSSKSPLFLENHQAIVINNISSTPSIITKMFTLPKLRDYKY
FT                   SILLIYDENNTKFTKQTGKITTYSLENGVIKDIRFLSSTYELEEFLK"
FT   gene            complement(436887..437411)
FT                   /locus_tag="Abu_0437"
FT                   /note="AB0436"
FT   CDS_pept        complement(436887..437411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0437"
FT                   /product="hypothetical periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66712"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY8"
FT                   /protein_id="ABV66712.1"
FT                   /translation="MFKKIVLLIVLSFSLYANNLSVVTGEIKGHTEVFGDSEINPTTKE
FT                   VKANLIVENSLESIKGQIFFDTLSLVSEKKDRDAHMYELLNEPKFKTISIDIKNIVKNG
FT                   INYDINGVLVLNGVSKDITVKSNITEQNNQILFDGGFSFNLTDFNLEPPTMFFLTVRNQ
FT                   IDVTYKIQFKR"
FT   gene            complement(437404..438369)
FT                   /locus_tag="Abu_0438"
FT                   /note="AB0437"
FT   CDS_pept        complement(437404..438369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66713"
FT                   /db_xref="GOA:A8ERY9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERY9"
FT                   /protein_id="ABV66713.1"
FT                   /translation="MQRLILIFFIASELCYYLLIAQTGIVEYFSSNLFLIAPLPIGGVI
FT                   GSLLVSYIKIKNKISLFLVAQLILSFMYPHYNLLTLFILGFVVGSMAPLIINEVKKTTF
FT                   LELGLALSLSYVTGTMLFNYEVSQREIIAVTLTMITLFCSLFLNYMKEGEKLNTTSHSL
FT                   LMMILWVFLDSALFESLSRDLAVSIWRGGFTFEIALFHVIGVFSALFFKIEKNQKELLI
FT                   LTLFALSYLFYFLREGFILSLIYPFVISYYNVVILQSIKKLDFRTISFYMIFIGWMASG
FT                   AGLSIALANLIFFVPITLLFAIFRVMSKEYLPNSKEIKYV"
FT   gene            complement(438357..439928)
FT                   /locus_tag="Abu_0439"
FT                   /note="AB0438"
FT   CDS_pept        complement(438357..439928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66714"
FT                   /db_xref="GOA:A8ERZ0"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ0"
FT                   /protein_id="ABV66714.1"
FT                   /translation="MEKSVNFEQFINRHFKISIAFFAIGLFFGIVYSLNLLGFIIDSET
FT                   LNPVNMRAIHISLMLYGFVPLMLSYLPFLLINKEAGISNEGLKFLNLYTLIWYIFLVFM
FT                   VMSLLLGKNRGLAFYDFAYELNFLLAFAGLFYILALYKFIKLYKVLPLWIKVCLRVVTI
FT                   APFTLLILMNPTIGQVESTISGPHGDNTLGMSLALIPIYYLIIKLLNEGEFKARWNILW
FT                   IIPTIFYFSSVLYRIFIGHLSYNQEWFLQYLTLLYVPLLYRWYKDSNISDVAKKALLVS
FT                   ILAFLFVDVEGNILFIPEIRWVFHRNDLIVAHAHVAMGIGVFFMVISMFINHIKELHKN
FT                   IFLEIYLIGILGIFTALSISGFTQAGFNLLETHTLWIFRSLFGVVAFSFIFAFIKINTS
FT                   YSKLRLYNLIGILSDGIGGVILILLASFLYPILGFSFSGVYEYVVFTFVSTTGIIHYLA
FT                   LKNESYEQLLTNLSVIIRVFASSMFFALYSSGKLGIEGLAICLFDLTFVFIYLIFIQKK
FT                   EFLCKD"
FT   gene            complement(439912..440535)
FT                   /locus_tag="Abu_0440"
FT                   /note="AB0439"
FT   CDS_pept        complement(439912..440535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0440"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Pfam match to PF00005 ABC_tran, score 213.2, E-value
FT                   5.5E-061"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66715"
FT                   /db_xref="GOA:A8ERZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ1"
FT                   /protein_id="ABV66715.1"
FT                   /translation="MIKAVHLTHYYNKDLALENINLQINKGEFICLVGESGSGKSTLLS
FT                   LLSTLLKQTSGQLFFEGKNYKDIEDIDSFRRTNIGFIFQFHYLINYLTVKENIKLAKEK
FT                   ATHEEIYNLLKILKIENLIDKYPNEISGGQKQRVAIARALINRPKVIIADEPTGNLDSK
FT                   NSLNVFEIFKKLSESGTTIIVATHDKDLAKFANKIYEVKDGKIS"
FT   gene            complement(440532..441614)
FT                   /locus_tag="Abu_0441"
FT                   /note="AB0440"
FT   CDS_pept        complement(440532..441614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0441"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Pfam match to PF02687 FtsX, score 120.8, E-value
FT                   3.4E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66716"
FT                   /db_xref="GOA:A8ERZ2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ2"
FT                   /protein_id="ABV66716.1"
FT                   /translation="MVSYAFKALFANKLKTFLIVLSLIFSIVSIFLISSISNGVISMYS
FT                   TLLKSDGDIIVTQAKISDTFFSNVNINLIEQINNLKDIKDTSAMIVGASPVEKLPIIAV
FT                   YGVTQNRFKNYTLTQGKYPSQNEVIIGKSIFEQLVNKNEIQIANKSFKISGVFKSEIGF
FT                   ENGGVVLNIDDAGNIFNKSASMILVNTTLNADVENIIKEIKNLSEDIDVKSTQNFVDNY
FT                   NQFKIIKTSSNVISFIAFSMGLLGIVSLMSITINQRKAEFGIKRALGIKTSKIVYSIMV
FT                   ESFLLGVFSFVCAFIISNVTLYFVKNAKTLQGYVNGEISIELGFYIFVTSILMAIIGSI
FT                   IPALNAAKTDPVELIQGNKI"
FT   gene            complement(441706..442293)
FT                   /locus_tag="Abu_0442"
FT                   /note="AB0442"
FT   CDS_pept        complement(441706..442293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0442"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF03692 UPF0153, score 45.6, E-value
FT                   1.6E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66717"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ3"
FT                   /protein_id="ABV66717.1"
FT                   /translation="MKQNICKIPFMKDFIPTLNQNFTFGNCKNCQAHCCSGLHGSIYSQ
FT                   ILKEEFEATYKNFPILFIFGSLKFIKPVILLSNGFDFCPHLKNFKCTIYENRPIVCKTY
FT                   PLSPNLDNQIYIDSSCPEINKGKEPLKFEESYFKNYQEKYIETHFEFENLKKEDFIKIF
FT                   TIRNIDFFKYIGNTNSKYLTFHKLSLSNLNKY"
FT   gene            442328..443101
FT                   /gene="suhB"
FT                   /locus_tag="Abu_0443"
FT   CDS_pept        442328..443101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="Abu_0443"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="Pfam match to PF00459 Inositol_P, score 240, E-value
FT                   4.6E-069"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66718"
FT                   /db_xref="GOA:A8ERZ4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020552"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ4"
FT                   /protein_id="ABV66718.1"
FT                   /translation="MKKKLIKIIKKAGKILKNGYYSDKEVSFKAKKDLVTKYDVAVENY
FT                   LKKHFSKHFEEFNIIAEESDNSKVEFNNSIIIDPIDGTTNFVNGVPHTAISVGVYKNKK
FT                   PFLAVVYNPILDELYFARAGKGAFLNGKKLKVSIEEDLQKSLIATGFPYTSGSNESDLK
FT                   DVLKKIKDVLPFCQDLRRLGSASIDLCFVARGTFEGYYEMNLKPWDVSAGVLILSEAGG
FT                   KITNINGEEYNLFEDKYIVATNGKIHDKLIEKLNI"
FT   gene            443151..444953
FT                   /gene="glmS"
FT                   /locus_tag="Abu_0444"
FT   CDS_pept        443151..444953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="Abu_0444"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="Pfam matches to PF01380 SIS, score 124.2, E-value
FT                   3.4E-034, and to PF00310 GATase_2, score 107.2, E-value
FT                   4.5E-029, and to PF01380 SIS, score 31.7, E-value 3.8E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66719"
FT                   /db_xref="GOA:A8ERZ5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ5"
FT                   /protein_id="ABV66719.1"
FT                   /translation="MCGIVGYIGKKDTTKLLLDGLKELEYRGYDSAGIAVLKDDNIDVF
FT                   KALGKLVNLEEKVNSVPSKDYDLGIGHTRWATHGKPTELNAHPHLGEYSYVVHNGIIEN
FT                   YKELKDELTQKGHKFVSQTDTEVIVHLFENYNNQLNDATKAFQNTVSRLEGAFSILLIS
FT                   KAEPKKIFFYKLGSPLIVARGIEEDEVLFASSDAPLIGLANDVVYLEDKVGGVATAFGI
FT                   EFFSDNHKWSTLPTSKQFAQKDGYRFFMEKEIYEQSSVVSDCMLGRIKDNEILFDEIDK
FT                   SIIDGINEIKICACGTSYHAGLTSSYLFERISKIKCSVEVASEFRYKEPLLTKDTLFIV
FT                   ISQSGETADTLEALKMAKNAGLKTLVICNVDNSSMTRTADFTILTRAGIEKGVASTKAF
FT                   STQTVVLWMLSLYFAKAKNVISNEKLEVELHTLREVPKSLCISDKIHEKTRRLSKRYLH
FT                   GHGFFFIGRDVFYPLALEGALKLKEISYLHAEGYPAGEMKHGPIALADPELFTIALMPQ
FT                   NLLYDKIKSNVEELSARDSTICAISALDFDLADDFIKINKSEHYMLEFFEMLVVLQLLS
FT                   MEISIRLGNDVDMPRNLAKSVTVE"
FT   gene            445082..446341
FT                   /gene="metK"
FT                   /locus_tag="Abu_0445"
FT   CDS_pept        445082..446341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="Abu_0445"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="Pfam matches to PF02773 S-AdoMet_synt_C, score
FT                   179.1, E-value 1E-050, and to PF02772 S-AdoMet_synt_M,
FT                   score 97.5, E-value 3.5E-026, and to PF00438
FT                   S-AdoMet_synt_N, score 90.3, E-value 8.2E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66720"
FT                   /db_xref="GOA:A8ERZ6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ6"
FT                   /protein_id="ABV66720.1"
FT                   /translation="MENNSSKACGKQRMENKMEKKSQYLFTSEVVSPGHPDKCADIIAD
FT                   SIVDRLIIEDSNSRVASEVFVAGKHIVIGGEVKSNAKLSQNDYEKIVKDALAKIGYDGK
FT                   SAFTKEQALHPDDVKVQVLLNQQSPDISQGVDQTTGEIGAGDQGIMFGFASNEAAEFMP
FT                   AAIVYARRLCDTVYNYALKNNQKLGVDIKTQVTVDYGTKENFENCKPQKIHTIVVSAPS
FT                   VEGMPIEEVRTLIQGLIDNSGLPDKLYDKNSTIIHINPTGRYVNHSSLHDSGLTGRKLI
FT                   VDSFGGYAPIGGGAQSSKDYTKVDRSGLYAARWIAKHIVASGLAKKAIVQISYAIGVAR
FT                   PTSVAVDTMGTYTKHNDDVLSAFVMENFPLTPRWITQKFALDKPSADTFLYADVAARGQ
FT                   VGQSDYPWEKLDELEKFKNL"
FT   gene            446443..447306
FT                   /gene="accD"
FT                   /locus_tag="Abu_0446"
FT   CDS_pept        446443..447306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="Abu_0446"
FT                   /product="acetyl-CoA carboxylase, carboxyltransferase, beta
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="Pfam match to PF01039 Carboxyl_trans, score 29.3,
FT                   E-value 3.9E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66721"
FT                   /db_xref="GOA:A8ERZ7"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ7"
FT                   /protein_id="ABV66721.1"
FT                   /translation="MDLKNLFSKISFDSKKEQPTKKDAPTHWIKCPNCSALMFFKEVEN
FT                   QDNVCPKCSFHMRIGAKRRIEILSDENSFVEFDADLKPNDPLKFVDKTSYKKRVEEAFD
FT                   KTGRTSSVVSGECTINSIPVQMVVFDFSFMGGSLGSVEGEKIVRAVNRAIEKEQGLIIV
FT                   SASGGARMQESTFALMQMAKTSAALKKLDHAKLPYISILTDPTMGGVSASFAFLGDIIM
FT                   AEPGALIGFAGQRVIKQTIGADLPEGFQRAEFLLEKGSIDMVVNRSKMKQTLTDLLTMF
FT                   QREKIS"
FT   gene            447310..447921
FT                   /gene="thiE"
FT                   /locus_tag="Abu_0447"
FT   CDS_pept        447310..447921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="Abu_0447"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Pfam match to PF02581 TMP-TENI, score 60.4, E-value
FT                   4.3E-020"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66722"
FT                   /db_xref="GOA:A8ERZ8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A8ERZ8"
FT                   /protein_id="ABV66722.1"
FT                   /translation="MISNLEKALGFKLEAFNYLYVLCDYETLLKKNISLETFVDLCRKK
FT                   DVKIIQYRDKISSFEEQKINLLYLKSQLNIPIIVNDKIELIDFADGLHLGQEDLEKIHK
FT                   DKKLAIKLVRTKIKDKLLGLSTHNEIEILEANELNLDMIGLGAYKQTNTKDVSTILGEK
FT                   ISYLAKISKHPVCAIGGVKIEDKILNVKFNVVGSGFFDEN"
FT   gene            447887..448366
FT                   /locus_tag="Abu_0448"
FT                   /note="AB0448"
FT   CDS_pept        447887..448366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0448"
FT                   /product="conserved hypothetical protein (DUF163 domain
FT                   protein)"
FT                   /note="Pfam match to PF02590 DUF163, score 133.8, E-value
FT                   9.7E-055"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66723"
FT                   /db_xref="GOA:A8ERZ9"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ERZ9"
FT                   /protein_id="ABV66723.1"
FT                   /translation="MLLEVDFLMKINIYAILKPTADNFDQIIKEFIKMSSKYAKVEVHY
FT                   IFNKNIAKAQTIGEKESQLAYSQTYEPLLKGYNIALDVLGKRVDTYAFSSLIDNKNEVN
FT                   FFIGGAYGFQREFLNKCDSVISLSDLTMAHKVANVVLTEQIFRSLCIQNNHPYHK"
FT   gene            448426..449433
FT                   /locus_tag="Abu_0449"
FT                   /note="AB0449"
FT   CDS_pept        448426..449433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66724"
FT                   /db_xref="GOA:A8ES00"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES00"
FT                   /protein_id="ABV66724.1"
FT                   /translation="MGLKRYIVSTVILAILLFGFLYSLELGDYEISLFGYSQILPVSVW
FT                   IILPFLFLAIATYLHLFFYAACDFFKKWAVSKDHETMIEFINAQLLGKDSATKFRTKKF
FT                   RELYAILSQLNISVKSETFTSLNEDLNKTVAAVQDINKGKFVKSVKLNENSDLAKQNLL
FT                   NKIEEQVDFAVDVIKKPENYSLDVVKKAFLKVLSEKTMTTIKKLYKNIKLDKELAQKLF
FT                   EKDALNNEFGFTQEEILALVKELNFDKKDYLNLAKTYEKILNPDEIISIFEKLSSENDE
FT                   ATTAYLHVLCEFEMIDKLREVLANTQENEFLPFKALLDLKDAGKKYNVETLSYK"
FT   gene            449434..450363
FT                   /locus_tag="Abu_0450"
FT                   /note="AB0450"
FT   CDS_pept        449434..450363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0450"
FT                   /product="probable tRNA-dihydrouridine synthase"
FT                   /note="Pfam match to PF01207 Dus, score 290.2, E-value
FT                   3.7E-084"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66725"
FT                   /db_xref="GOA:A8ES01"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES01"
FT                   /protein_id="ABV66725.1"
FT                   /translation="MNKLDFTRPLVVLAPLAGYTDLPFRSVVKKFGADLTISEMISSNA
FT                   LVYKSARTLKMVEKSPTEDPYFVQIAGNSVDLVKAAVEILNDVEGIDGIDLNCGCPAPK
FT                   VFNHGSGSNLLGDLKKLEEILSTVKKYSKKQYTSAKVRLGVNEKIPVEIGKAVEACGVD
FT                   FVSVHGRTRAGKYKAPVDYDAIKQMKEAISIPVIANGDIKDYAKAKEVLEYTKANGVMI
FT                   GRGAIGKPWVFYQLKHGIEDISNEMKKEIILEHFDSMINFHGNHGAIMFRKLLHSYSKG
FT                   YTGANEFRDIVNKVSEVDVMRDMIENFF"
FT   gene            450445..451263
FT                   /gene="prmA"
FT                   /locus_tag="Abu_0451"
FT   CDS_pept        450445..451263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="Abu_0451"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Pfam match to PF06325 PrmA, score 132.2, E-value
FT                   1.3E-036"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66726"
FT                   /db_xref="GOA:A8ES02"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES02"
FT                   /protein_id="ABV66726.1"
FT                   /translation="MSKYYFELVLKPKKNYELFLELLESLTEDAFEENDGCIIIRSEDE
FT                   LDDLKFGIERFSEALDVKCEIIYEKKENIDWIKEYQKSVKSVEVGNFFIRPSWEEKKDN
FT                   KIDIIIDPALSFGSGHHETTSSCIEAIDEFVKEKQTVLDVGTGSGILAIAAAKKGCVVD
FT                   ICDTDEVCIVDTKSNFELNNAKFNDSWVGSINKSTKTYDVVIANIVADVLVMIANDLKK
FT                   SLNPDGLLIISGILDKHENRVLNKFKDLEVIKVIHKNEWVTAIFKKNKES"
FT   gene            451268..453253
FT                   /gene="ftsH1"
FT                   /locus_tag="Abu_0452"
FT   CDS_pept        451268..453253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH1"
FT                   /locus_tag="Abu_0452"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="Pfam matches to PF00004 AAA, score 318.8, E-value
FT                   4.1E-096, and to PF01434 Peptidase_M41, score 326.4,
FT                   E-value 4.6E-095, and to PF06480 FtsH_ext, score 129.7,
FT                   E-value 7.2E-036"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66727"
FT                   /db_xref="GOA:A8ES03"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES03"
FT                   /protein_id="ABV66727.1"
FT                   /translation="MSKKQQQNDNNNINNNDNNNNFFNNNPILIFVIFAIVTIFAFKTI
FT                   FSDETMGVSNSNVQAFGQSSNKTIAYSDLKKLISAGKIEYVGIGNTQIRAISKSEGGQV
FT                   ITYTARRVIPDETLITELEKNNIGYGGINEENILADILFGWVLPIFIFFAIWMFIAKRM
FT                   QKSMGGGSGGILGIGSSKKMINSEKPNVKFDDMAGNKEAKEEVQEVVDFLKSPDRYVRL
FT                   GAQIPKGVLLVGPPGTGKTLLAKAVAGEANVEFLSVSGSAFIEMFVGVGASRVRDLFEQ
FT                   AKKVAPAIIFIDEIDAIGKSRASGGPMGGNDEREQTLNQLLAEMDGFSTEHAPVIVLAA
FT                   TNRPEVLDPALLRPGRFDRQVLVDKPDYEGRIEILNVHIKDVKLGKNVDLKEVAKMTAG
FT                   LAGADLANIVNEAALLAGRASKNEVGPEDFKEAVERQIAGLEKKSRRISPKERKIVAYH
FT                   ESGHALIAEITKGANKVNKVSIVPRGLAALGYTLNTPEENKYLMQKHELLAEVDVLLGG
FT                   RAAEQVFIGEISTGAGNDLERATGIIKSMATIYGMSDIAGLMVLEKRTNQFLGGQTQKD
FT                   YSDAMAKELDNHVKTILNERYEIVLQALKDNSAAIEQMTAELLDIEVITGERVREIIKE
FT                   NGGTVFEDEDLHSDAITEEKTTSTDE"
FT   gene            453372..455198
FT                   /locus_tag="Abu_0453"
FT                   /note="AB0453"
FT   CDS_pept        453372..455198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0453"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 108.1,
FT                   E-value 1.1E-032, and to PF01966 HD, score 105.3, E-value
FT                   1.6E-028, and to PF08447 PAS_3, score 52.1, E-value
FT                   9.9E-014, and to PF00989 PAS, score 39.4, E-value 2.1E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66728"
FT                   /db_xref="GOA:A8ES04"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES04"
FT                   /protein_id="ABV66728.1"
FT                   /translation="MENKQDYFFYLKKMTLLYVEDDDNTREELEYFLEKKALKLIVAKN
FT                   GQEGLELFKKHNPDLVITDIQMPVMDGIQMIKAIKEMNPQVQTVIVTTFSDIEYLFEAI
FT                   KLNISNYLTKPLNLYALSETLFSVSKNIFLEKENKEIFNTLKQYKDVVDERSIVSKATK
FT                   EGIITYINEPFEKISGYKKDELLGKSHNIISHPNIDKNIFKDMWKKIKVEKKSWHGRIK
FT                   NISKEGKEYFVDLIVKPILDTNGDILEFISLANDITDLELSREYFENLTQKNSLDLNET
FT                   IKLVNTYKEAIDESNIILRVDTNKNITYANDAFYNISGYSKDELLGKPYSILKHYNLSE
FT                   EESNQKIEEIFSEKIWKGKVSNYKKNGEVFHCHVTLFPLRNEKDEIIEFMSVRHDITQI
FT                   ENLHDELEDTQREIIYKLGEIGETRSSETGNHVKRVAEYSRLLAQKVNLSQQDVNRLFI
FT                   ASPMHDIGKIGIPDAILNKPGKLNEDEWKIMKTHTQIGYDILKDSKRETLRAAGIVSYT
FT                   HHEKWDGTGYPLGLKGEDIHIFGRITAVADVFDALGSDRCYKKAWPLENILDLFKNEKG
FT                   KHFDPKLIDIFIENLDEFLAIRDSYKDNNEKD"
FT   gene            455185..455592
FT                   /locus_tag="Abu_0454"
FT                   /note="AB0454"
FT   CDS_pept        455185..455592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0454"
FT                   /product="two-component response regulator"
FT                   /note="Pfam match to PF00072 Response_reg, score 108.5,
FT                   E-value 8.6E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66729"
FT                   /db_xref="GOA:A8ES05"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES05"
FT                   /protein_id="ABV66729.1"
FT                   /translation="MKKINLHLFKHIKLLYVEDDLMTQEEVSFFLQKYLGELYLAKNGE
FT                   EAINIFLKNKIDMIITDIQMPKMNGLEMSKRILEINPKIPIIITTAYNDCEYLNQAMEL
FT                   GIDKYISKPFNLEALLTMIEKSLSLEHELKK"
FT   gene            455594..458167
FT                   /locus_tag="Abu_0455"
FT                   /note="AB0455"
FT   CDS_pept        455594..458167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0455"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 99.3,
FT                   E-value 1E-026, and to PF00672 HAMP, score 58.6, E-value
FT                   1.8E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66730"
FT                   /db_xref="GOA:A8ES06"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES06"
FT                   /protein_id="ABV66730.1"
FT                   /translation="MKNLSIKIKLIIIFILIKIIPLLFVSYIAYEGILKLEQYLNKSTN
FT                   FLYNQSKEVISNTANASIEDSIKNLDKKSQESLERLSNEIALNIANFLYERDRDLILLS
FT                   KLELNQKVLDSFFEAKTKEITIHDEYYYDNETNSYKTKEEIKKVERDKKTANLKDNEKE
FT                   FNYIDPIDFKTKNIPIYKEISFFDLQGNEKYKVSTINNQKVNVSDSKNTFIKAEKYFDE
FT                   IQKLNKNEIYVSDVIGEYIGTKVIGLFTKEKAQKSGIEFEPEKYGYAGIENPLGKRFEG
FT                   IIRFITPVYKNDEKIGYISLALDHRHLQEFTDTVNPTNSNLKQNITDASLGNYAFIWDY
FT                   EGKSIVHPRHYSILGYDKDTGEKVMPWLSLDVAEKFYSSNQNINDFLKNYPKFEEQSLQ
FT                   KKPNLKQLKEDGNVGLDCRYLNFAPQCEGWMQLTQNGGYGSFIINWSNVWKLTTAATIP
FT                   YYTGKYGNSKRGFGFVSIGASVDDFHAAANETKEEVTKILDSQTQIISKIMDENKFEIK
FT                   DSIRALINELSTVTFAMIVLVIIIALFMSSYLSKKIDDILIGTKKFANNELDYRIKVTS
FT                   TDEIGQLENSFNEMAGKIEKLISQEKKLNTELEEKVIVETSKQKEQEQLLIQQTRLAAM
FT                   GEMIGNIAHQWRQPLNALGLILQNLKFSYEIGELDEKMIDKSVKKATMLTENMSKTIDD
FT                   FRNFFRPNKAKENFKINEGITKAVELIESTFEHNNIKLEKDFVSSEIEFFGFANEFSQV
FT                   ILNLLTNAKDAVLENKIENPLIIIQTKIDDEYIYISIKDNGLGIKDEIINKIFEPYFTT
FT                   KDEGKGTGIGLYMSKIIIENNMNGKIEVKNEQNGANVIIKLPIKN"
FT   gene            458444..459997
FT                   /gene="leuA1"
FT                   /locus_tag="Abu_0456"
FT   CDS_pept        458444..459997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA1"
FT                   /locus_tag="Abu_0456"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Pfam matches to PF00682 HMGL-like, score 387.4,
FT                   E-value 2E-113, and to PF08502 LeuA_dimer, score 124.4,
FT                   E-value 2.8E-034"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66731"
FT                   /db_xref="GOA:A8ES07"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES07"
FT                   /protein_id="ABV66731.1"
FT                   /translation="MDKNKIIVFDTTLRDGEQSPGCSMNTEEKIKVALQLEKLGVDVIE
FT                   AGFAAASPGDFDAVSRIAQIIKNSSICSLARAVDNDIKQAGLAVQSAAKSRIHTFIATS
FT                   PIHMQYKLKMSGDEVIKRAIRAVEYAKTFVDDVEFSLEDAGRSEIPFMKEVMDAVIGAG
FT                   AKTINLPDTVGYRLPTELGAMVKELSAYAGDRAIISVHNHNDLGLATANTLAAVLNGAR
FT                   QIEVTINGLGERAGNSALEEAVMAIKTRKDAFGDLYTTINTPEIYATSRLVATITGVEP
FT                   QQNKAIVGKNAFAHESGIHQDGVLKHQETYEIMKPEDVGVIKDSTLILGKHSGRAAFRD
FT                   KIVQLGFDKVSDDELNAAFERFKVLADNKKEISDEDVRMLITDEALNHDKTYDLIGLQI
FT                   SDCTNGVPTAAVAIKYKDEIIKDAAIGDGTMDAIFKTIDRITGFSGELKDYKVISVTEG
FT                   KDALAKVTTRVSFDETSPAFVGHGLSIDTMLATAKAYIGALNSYLSQKKRLSKSSEHQV
FT                   "
FT   gene            460037..460369
FT                   /locus_tag="Abu_0457"
FT                   /note="AB0457"
FT   CDS_pept        460037..460369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0457"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66732"
FT                   /db_xref="GOA:A8ES08"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES08"
FT                   /protein_id="ABV66732.1"
FT                   /translation="MIQIENEKELKKAISENQAIILYFSGDNCSVCKVLKPKIETEVSK
FT                   NFPKMKLFEIKTDISKELSSHFSVFSIPTIVVLFDKKEFKRYGRNISLSLFIEEIRRIY
FT                   NLMDGI"
FT   gene            460366..460785
FT                   /locus_tag="Abu_0458"
FT                   /note="AB0458"
FT   CDS_pept        460366..460785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66733"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES09"
FT                   /protein_id="ABV66733.1"
FT                   /translation="MKRFLLILLGLFLVIQLIPTSKKNEVVDKSLEITAEEGIMDILRT
FT                   ACYDCHSNETVYPWYSYIAPFSWTISKHVNEGKKALNFSIWETYSEKEKEGHLKDIYRT
FT                   IYAAMPLQPYLLIHTKANISSEDRKVIRDWTGVRR"
FT   gene            460764..463742
FT                   /gene="mutS1"
FT                   /locus_tag="Abu_0459"
FT   CDS_pept        460764..463742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS1"
FT                   /locus_tag="Abu_0459"
FT                   /product="mismatch repair ATPase"
FT                   /note="Pfam matches to PF00488 MutS_V, score 106.8, E-value
FT                   5.8E-029, and to PF05192 MutS_III, score 62.8, E-value
FT                   1.1E-015, and to PF01624 MutS_I, score 32.7, E-value
FT                   8.4E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66734"
FT                   /db_xref="GOA:A8ES10"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES10"
FT                   /protein_id="ABV66734.1"
FT                   /translation="MDRSAKIVREEVAELLENRGELLTITYFKLQKLFEKKYGSNALVL
FT                   MEIGTFFEVYEVNNDEEKIGKAKEIAELLNIQLTRKNKSILENSKENPIMAGVPAIAFE
FT                   KHLARIISEQKYTIAIIRQKGLPPNVSRYLDTVVSPGTNFDFVIDQDENNITSLLIDQI
FT                   RGIYLVGYSAIDVTTGKCYYNEVHGTSEDKFFALDEVFNYMNMHKTNEVVITFADKNIN
FT                   QKEVIDYLELNLKTFHIGNFRPKISYQNELFKNVFNIESLLTSIEHLDMERVPLSTESL
FT                   AVLIDFVIGHDSNIIQKLSTPQKLDISRYIYLGNNALEQLNIIETTHNPSLIKLINNTS
FT                   TAMGKRLLKERLTHPVKDSKELLRRYALSKELYDYHSPIENELANIYDIERLTRRIKLN
FT                   RLHPFELNYLYDSLLSIKEVVAFMENYKFITPPCSSADLTLFIQSIDSTFDLNVSGKFM
FT                   LKDVDSNMISFGINTQIDELNAQNEILYSKLELLRTHIFSFMKSDDSNFVSINRLDKEG
FT                   FFITLTKNRFNLVKKELLNSHLIVDDELYLFKDFNIKVQTNSVKIFCKLTEDISDKYVH
FT                   NLRKIVELNKLVFKEKIHEFEKKFATLLQELVQFIAEVDLTVSNIKTAKKYNYTCPKIV
FT                   KTKENENFLELIDLRHPIIEANEEQGIYVPNDIILGELSLASQEYKDNIIIKNSNPVNM
FT                   YNNKMHGVLLYGINSSGKSSLMKSIGIAVVLAQAGFYVPCKSMRFSIFDAVYTRISGAD
FT                   NIAKGLSSFAVEMLELKNIFNRASKNSLILGDEISHSTETMSGLSIVASAILKLAKLEA
FT                   LFVFATHLHQLPEIEEIQKLKNIISLHLSVFYKDDEDKLIFDRKLAYGSGSSMYGLEYA
FT                   KSLHMDKEFLNIANEIRKKLTDDYNPLERLSQKKTSKYNNSVFASNCVICGRACDDVHH
FT                   IKEQARANKDGFIGHINANHKYNLIPLCKEHHKMVHDGTININGFVATSKGLELHYTMV
FT                   EQK"
FT   gene            complement(463782..466808)
FT                   /locus_tag="Abu_0460"
FT                   /note="AB0460"
FT   CDS_pept        complement(463782..466808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0460"
FT                   /product="outer membrane component of efflux system"
FT                   /note="Pfam match to PF00873 ACR_tran, score 866.5, E-value
FT                   1.2E-257"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66735"
FT                   /db_xref="GOA:A8ES11"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES11"
FT                   /protein_id="ABV66735.1"
FT                   /translation="MYKIAISRPITTLMFVFALVFFGYTQIQKMPIAFLPNVDYPVVSV
FT                   ITTYDQGSTEIIESKITDKIEEAISGISGIDIIRSDTSKNQSIVIAQFELSKPVEEAAN
FT                   DVRDKVSTVDLPKEADKPIIEKFSSSSAPIITLFLSTKLDNLDKLMLHANEVVKPILQS
FT                   IEGVGKVEIAGFRDKIIKIYPNTTLLSKYNLDLNELALKIDEENIKKDGGRVVQEKEEL
FT                   NISIDSDAINVEQLENIKIKDGVRLKDVATVQETIKDERTFANYNQQKGVLLQVKKISG
FT                   ANEVNIANVVKEKIPYIKSLSNDFDINLLFDTTTFIESTYKSVQFDLILGCFLASLIVF
FT                   VFLRNFTFTIIAAISLPISILGVLAIMGWSNQTLNILTLTALTLSIGIIIDDAIVVIEN
FT                   IYKKLELGKSRYEAALEGVKEISFSVLAISAMLLAIFIPIANMSGIVGKFFKSFGITIV
FT                   ASVIISYIIAITVIPMISSLLVNSKHSKFYLMTESIFLSMDKIYKNLLIKAINFKLTTL
FT                   IVAFTIFVISIILSSNLGMVFMPKEDRSQFTISIKANADISMDEMKKTTMNIQEDLLSI
FT                   NEVDYSSLTIGLDGNIYESSIYVRLVPIDKRTKNQDEIMEEIREKSKKFRNLEINVNQT
FT                   DDMNSGAEIMTPFQLILKANDSKLAEESANKLIDYLKSIEGTTNIQNNIQPKKTEISIE
FT                   ILKQNSSKFGVKSSDIAKVIAMAYSGEIAISNFNKNGKEYDIVMRISDDLRMNKDVINQ
FT                   LNVKNDKEELIALSSLININSKELASVIKRYDRQKQVTIGSDITNGLALDVLVNLVVEN
FT                   QEKWLLDGVTYTFEGDAKDMQDTANAFGVAIVAALIMIYLILASLYESPLQPVIIMSAM
FT                   PLSFTGAFLGLYLANMNMSLFSMMGLFLLLGLVGKNSTLIVDAANRNRENSINLDEAII
FT                   QAGISRLRPILMTTISMCLGMLPLALSVGEGSSIKAPMAISVISGLIISTMLSLFVVPA
FT                   LYKLIAPLDDKIRKLYTHK"
FT   gene            complement(466810..467502)
FT                   /locus_tag="Abu_0461"
FT                   /note="AB0461"
FT   CDS_pept        complement(466810..467502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0461"
FT                   /product="putative membrane fusion component of efflux
FT                   system"
FT                   /note="Pfam match to PF00529 HlyD, score 23, E-value
FT                   7.8E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66736"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES12"
FT                   /protein_id="ABV66736.1"
FT                   /translation="MKKIQLMIILLTNILFADVYATYEVKALNEASLNVSTSGIVSKIN
FT                   TDIGNQVKKGEVLLSLNDSEEKANLEISKNEYKFLLTQYERYKKSAEVFDKNSLDKLES
FT                   ELKSAKDLITLNEAKLSKMKIIAPFSGVISEKNIEVGDMSNNNEKALLKLVSNEKKLLL
FT                   AFDSKFAQDVKAGDIFCLNSNKEENKTCVEIYKVYPALNNEKKLNAEAYGVDLKIGNFG
FT                   DGLIIKGN"
FT   gene            complement(467504..468724)
FT                   /locus_tag="Abu_0462"
FT                   /note="AB0462"
FT   CDS_pept        complement(467504..468724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0462"
FT                   /product="outer membrane component of efflux system"
FT                   /note="Pfam match to PF02321 OEP, score 47.4, E-value
FT                   4.3E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66737"
FT                   /db_xref="GOA:A8ES13"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES13"
FT                   /protein_id="ABV66737.1"
FT                   /translation="MFKNIFIFFLISTSLYAISLKELLNSVEVTNENYQAQQALQEMSK
FT                   KQYESATKDNYPTFNLIGAYENNSKVLKTEPEDIAYAELKASYILYDGERIRNNELSKK
FT                   SLHESQQLKTQYLKQEIMLEVIKQYFSYQNTKSAIDVINYKINELNGQIKKFEILVKND
FT                   LETKDKLQALIASKKEALYDIETLKIDLENSILQLSLLTGFDILPQDNDKLIEPTYDEK
FT                   DRFDIEAKKLEAKSVKYTSEGFNYLPTISINNSLKKQEYYHYDETYNNKFNNQIMLQIN
FT                   FPIFDFGKISKDKEASQLEALALNKEIAYKEKSIQIERKLALKSLESSKVKLDSAISGL
FT                   EATNTTYEFSKKRFDANLISYTEYLTELTKKQDANYRVILAKNDIELKKANLAFALGID
FT                   LLTLIKE"
FT   gene            complement(468735..469331)
FT                   /locus_tag="Abu_0463"
FT                   /note="AB0463"
FT   CDS_pept        complement(468735..469331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF00440 TetR_N, score 31.1, E-value
FT                   2.9E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66738"
FT                   /db_xref="GOA:A8ES14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES14"
FT                   /protein_id="ABV66738.1"
FT                   /translation="MPKIINAEEKRLEICALAYERLVEEGIVEFSLNKFIEELNMSKGQ
FT                   FYYYFKSKEKLIFETLKIKDIEFVEIIKENIAKKSNFLEKLVEYFALILNEEEKIFIDA
FT                   RKIMFESIHLYLHPKYKEEMKSCENTYINMYEIIENIFDEEIEKGFLKKDSKKTIKVIL
FT                   ATIDGMYYHSLIIDDYNLKETIMDYLIETTNQLKR"
FT   gene            complement(469422..470234)
FT                   /locus_tag="Abu_0464"
FT                   /note="AB0464"
FT   CDS_pept        complement(469422..470234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66739"
FT                   /db_xref="GOA:A8ES15"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES15"
FT                   /protein_id="ABV66739.1"
FT                   /translation="MFQFKTFKPNIKLQKWIKSYWFVDYNETLDVIEKEKIILPYDNVC
FT                   LLMIIDIQKNISYSDVTLKKGIYVCPPTLNRHNLNLESNIYYVDISLYPGVFYKLFGIP
FT                   VCELEDRIYEIKELSLNFDVSIIDLLFELKGSTLSSLNTLDEYLFKIFENMQEDSLLSN
FT                   LYELTKNPNLENFYNQNRLSIRQIQRKVKDFTGLAPKSIERVNRFYNTLKLIKSNENNI
FT                   NFKNIIFENNFYDQSSFIKEFKFFSGTTPSLFILNCENFLQYKCTIFC"
FT   gene            470416..472023
FT                   /locus_tag="Abu_0465"
FT                   /note="AB0465"
FT   CDS_pept        470416..472023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0465"
FT                   /product="quinohemoprotein amine dehydrogenase, 60 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66740"
FT                   /db_xref="GOA:A8ES16"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR009111"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015182"
FT                   /db_xref="InterPro:IPR015183"
FT                   /db_xref="InterPro:IPR015184"
FT                   /db_xref="InterPro:IPR023887"
FT                   /db_xref="InterPro:IPR036718"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES16"
FT                   /protein_id="ABV66740.1"
FT                   /translation="MNYKRLSKFGMKSLVLLAALPLFAVDAQKGKEVIESKCIACHTGD
FT                   LKDGLSRISDQRKTPEGWYMTVKRMQREHGLSITKAEETDVIKYLADYQGLTPDEIKPY
FT                   SYVLDKKPNVQEEGKDELLTQMCVRCHSEARIGLQRRTANEWNSLVNYHVAQFPSFEVQ
FT                   AQARDRDWFGVAQNEVVPYLEENFGKDKEKFEKYKKSLKNYELPKKWIMSGHTPIIGDF
FT                   TANLTLMKSADESYGMLIDYKYANGKEYKTTGVAIVYGKTELRASFEVDGVKYRQILHI
FT                   DPKTNTLEGRMFEVLHSENGSTLVGKEKDSKETTLVAVYPKAVKAGEKSTISIVGTNLV
FT                   GDVKLPSSLKVLKTIKHTNNEIVLDVIAHKNVKTFDRNISIGAKTFKNSLVVYDKVDYI
FT                   KVTPDYAISRIGGEEGKDKILKEYATFEAIGYLNGKDGKKETADDIELGVLPATWSLEA
FT                   YDEQAQEDKDLEYVGQIDANTGKFTPSVAGPNEQRKLMTNNAGNISVVATYKDGKKELS
FT                   EKSHMIVTVPKFVNPPIN"
FT   gene            472033..473406
FT                   /locus_tag="Abu_0466"
FT                   /note="AB0466"
FT   CDS_pept        472033..473406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0466"
FT                   /product="quinohemoprotein amine dehydrogenase, putative
FT                   SAM-radical dependent activating subunit"
FT                   /note="Pfam match to PF04055 Radical_SAM, score 70.4,
FT                   E-value 5.3E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66741"
FT                   /db_xref="GOA:A8ES17"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR023886"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES17"
FT                   /protein_id="ABV66741.1"
FT                   /translation="MSINNYNLIKTNYHILEIDSKEFLFHIPTSSVFELSTESANLLRK
FT                   MENKEEITKDEEEIVEEFKELNIVGSRFFVKEEETKIEHFPAKALVLNVTSGCNLSCTY
FT                   CYKADLTSLKNSGQMTFEIAKDAIDMFYKESPYLKEYSITFFGGEPLSNLPLIKQIIAY
FT                   ANDFFESKGLKIGYSMTSNATLLTDEVIRYLHESKVDLTISIDGPESLHNKTRVYENGK
FT                   GSYEKVAKNVAKLLDIYKNRTVGARVTLTRGVTDVKTIWNHLRYDLKFKEVGFAPATSG
FT                   DNDFFNLSDSDLKKVFAGFKELGEDYINEAIKGNFNGFSNLHRTVIDIHEGRKKKLPCG
FT                   AGVGLLSVSYKGDIDLCHRFTGSDYPSFGNIEKGLDKKALGSFLEKRANEKDTSCQTCR
FT                   IRNLCAGGCYHESYIKYGTPEKSVLHYCDDMRNWIDFAVEAYIRIKAKNPEFFTKYFK"
FT   gene            473417..473737
FT                   /locus_tag="Abu_0467"
FT                   /note="AB0467"
FT   CDS_pept        473417..473737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0467"
FT                   /product="quinohemoprotein amine dehydrogenase, 9 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66742"
FT                   /db_xref="GOA:A8ES18"
FT                   /db_xref="InterPro:IPR015084"
FT                   /db_xref="InterPro:IPR036487"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES18"
FT                   /protein_id="ABV66742.1"
FT                   /translation="MKHLKPITPKAKLLEEALKEGNANEVVAMSSVVGCVTTFDPGWEV
FT                   DSDGGVASLCQPMEADLYGCSDPCWWPTQVPDTSSSYKKWSEKAPATKDDWRELENVYP
FT                   KM"
FT   gene            473755..474888
FT                   /locus_tag="Abu_0468"
FT                   /note="AB0468"
FT   CDS_pept        473755..474888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0468"
FT                   /product="quinohemoprotein amine dehydrogenase, 40 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66743"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023879"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES19"
FT                   /protein_id="ABV66743.1"
FT                   /translation="MLNKKFIKSGLGLLSFSLILSSSLSTNLNAANVKLKSNHDYLVTV
FT                   TRPNNIALVDLEKNEMINECKIDEAFSPGAIVLSPNNKVAFILGEYGEEVAGYEIETCK
FT                   KVFHTSLTQGNIRAKSLFGLSVNEDGTKVYAIYNRTEMLNDRYKVLPPYFSVYNVADGL
FT                   NAKPVKSFEMPRQTTVVSTGKDGTVYVVGSDLYKVNPKSAEINVAKKIVKWGKEGFSDL
FT                   DSAANYIIGQQTGDLTALYATVKYDDPKNPSEEEGTTYWGITSVDLNTGEIIQQEISEY
FT                   ETLMFTAIRSPKDQNILYGVLNDLTKFDIKEQKVLKRVITDHTYYSVVPSVDGEKLYLG
FT                   GCLNDIAIYDANSLEKLGNIKLSGDMGSAALQVFKTK"
FT   gene            474903..476540
FT                   /locus_tag="Abu_0469"
FT                   /note="AB0469"
FT   CDS_pept        474903..476540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0469"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Pfam matches to PF00005 ABC_tran, score 140.3,
FT                   E-value 4.9E-039, and to PF00664 ABC_membrane, score 115.2,
FT                   E-value 1.7E-031"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66744"
FT                   /db_xref="GOA:A8ES20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES20"
FT                   /protein_id="ABV66744.1"
FT                   /translation="MFKNIIYPLLKKNKRGFFVIFFFSILVSLGGAVQPYIMQHIIDNA
FT                   ILASNINQLIFLVSISFFLTIFVMIISYINEIYYTKNSMNILFEFRKIVFNKLFLHDKT
FT                   FLNKYHSADLMSRVQGDISELQRFYTDSVFSLFSTIISLVFICFIVYSYNIKLMILILI
FT                   FLPIEFFCLKPLYPHIQNSTKTMRESTSNIGKFFIENFRYMLTIKNLGAKEQTLEKLDF
FT                   IQDDYKNVVIKNKKINLLFSQIPAFISLLGKTIIVSYGGYLTIKGELKIGELFAFLTYF
FT                   TMILAPVHTILGVINNFPKVKVSLNRVLEILPKEKDNIELKTTNFDLVIKNLEFSYSNN
FT                   KIFENLNLFIKEKSKIAIIGKNGTGKTTFADLLCGFLKANNGDIFIENEKIGENDYINF
FT                   SSYLVKLEQTPIIFDDTLKNNLLLAKNSAKEEELIDCLKKTGMCKWFRNLQKGLNTNLL
FT                   ESGGNLSGGQKQRLALSRLILLNPKIIILDEFTSSIDEKDTIWFYENISTIFPNSTIIA
FT                   ITHNLNMLSHFDKVYLLENKTLKEYKNV"
FT   gene            476533..477162
FT                   /locus_tag="Abu_0470"
FT                   /note="AB0470"
FT   CDS_pept        476533..477162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66745"
FT                   /db_xref="GOA:A8ES21"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES21"
FT                   /protein_id="ABV66745.1"
FT                   /translation="MSKEVFVALIDSGCNFETYEKIAIHIENNRIKIKNQNNINFEHGN
FT                   VIGNIIKDENINIYDIQVFNENLSTTPHHIFGALNYLKDKKVDVISMSLGLKTNYKEIE
FT                   ELCREFIKKGVVIISSYPKSGQEFVYPASYENVIKVTSEGKCMDDKVVVLDKEKLFFGA
FT                   NPFSTVKNVAGSSVAVAKFTKEFCSYIKKGFSKIEIIEEFSKRIIK"
FT   gene            477159..478484
FT                   /locus_tag="Abu_0471"
FT                   /note="AB0471"
FT   CDS_pept        477159..478484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF01266 DAO, score 31, E-value
FT                   1.3E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66746"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES22"
FT                   /protein_id="ABV66746.1"
FT                   /translation="MNSNKKIVVLGAGIAGSSTAIGLKKLGFDVTVIYKKRPFTAYEGF
FT                   SQKTKEGLISLGCIKASKLLVEQSLRNSNWASKTHKVNYEFVVNRSIFDKSLLEDLKEY
FT                   QIKIIEAKVIGSVDYLDEKPKIVYKIDEKKYDLIADFVVDARGRFTPFKDEYICGPKSF
FT                   SLLQELELEDINENQTSIDSVKDGWIWQAYVGNKRGYIQFSCDEELANKVNCFEDMLKI
FT                   LQEQNIELWSLNNYKVVGKLVKRDSFCKIHKKIINNKMMLVGDSASSIDPLSGNGAFQA
FT                   MSMSSIAPFVINTILNKSEIEQKVAIDFYKSRVEFIFDKFTKVGKEFYILEKRFNTLFW
FT                   QNRQTWPQDKNELEKKVPRIEKKAVVKDGFVNESEVVITKDNPFGACYFGNIEIIDLAK
FT                   YCLENSFEKSLDYFDIFCKERNVPLQVGNSLKNWCIKEEILG"
FT   gene            complement(478493..480352)
FT                   /locus_tag="Abu_0472"
FT                   /note="AB0472"
FT   CDS_pept        complement(478493..480352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0472"
FT                   /product="GGDEF domain protein"
FT                   /note="Pfam match to PF00990 GGDEF, score 192, E-value
FT                   1.3E-054"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66747"
FT                   /db_xref="GOA:A8ES23"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES23"
FT                   /protein_id="ABV66747.1"
FT                   /translation="MSSNKKITLIIFTMISILAVIIIILVALGSRHSGYDGAKKRAYLT
FT                   AQLVKNSLTSHMINGTMHQRDTFLSSLNNLQGIKELWVVRSKSVSEQFGNSLLATEKAR
FT                   DNIDLDVLKNGKEKVIVNETFKDATLRITIPYTASSLDKPNCMSCHNAQEGQVLGAISL
FT                   TFDIQEDRISNIVILINVVATISVFLILILIYLRKKITPFTNSFDSITETLKQVHEGDY
FT                   SVRVKEGVLKEDKEASIWLNELIEKLETVLTGIEKNLTSFVHNRATIFSNDKLLTAKEI
FT                   IEDITEIYNYKKTIETDLTKEDIFYRLIQVLKNKLNIESFYIFETDLIKDERKTIYPLI
FT                   EVEKPCCVISKGIKSGCRAERTNTIVSSENFPEICRIAKCSGETNHICIPFLINEQKNI
FT                   VIHIVCKDKDSLQNTKYQIGIIKKYLEETKPILESKLLMDALREKNLVDGLTGLYNRRY
FT                   LDEFIEKKLPHESQDGSKFAIMFLDIDYFKMINDTYGHDAGDAILQKLSDTMKASISEN
FT                   EFIVRFGGEEFLIIMKNPTESSARELATKINQEFAKLVFNYNGQAFSKTVSIGYSFFPD
FT                   DADQIWKCIKYADISLYEAKETGRNKIVRFQKEFLKSADKKSY"
FT   gene            complement(480423..481130)
FT                   /gene="hisA"
FT                   /locus_tag="Abu_0473"
FT   CDS_pept        complement(480423..481130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="Abu_0473"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="Pfam match to PF00977 His_biosynth, score 351.6,
FT                   E-value 1.2E-102"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66748"
FT                   /db_xref="GOA:A8ES24"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES24"
FT                   /protein_id="ABV66748.1"
FT                   /translation="MDILPAIDLKDGKAVRLSKGLMDSAKIYSDEPWQVALRFEELGSK
FT                   WVHIVDLNGAFAGKPANLEQIKKIRENCNLKIELGGGIRDEETIKMYLELGVDRLILGS
FT                   IAVKDPIFVKKMASKYPIAVGIDAMNGMVAVEGWAEVSTMKATDLAREFANAGVQAIIC
FT                   TDISKDGMLCGVNVEFTESIALASSVDTIASGGVKDIQDIINCKANGNISGVIVGKAFY
FT                   EGTLDLEEAFKIL"
FT   gene            complement(481142..481993)
FT                   /locus_tag="Abu_0474"
FT                   /note="AB0474"
FT   CDS_pept        complement(481142..481993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0474"
FT                   /product="conserved hypothetical protein (DUF1731 domain
FT                   protein)"
FT                   /note="Pfam matches to PF08338 DUF1731, score 71.9, E-value
FT                   1.8E-018, and to PF01370 Epimerase, score 18.5, E-value
FT                   1.8E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66749"
FT                   /db_xref="GOA:A8ES25"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES25"
FT                   /protein_id="ABV66749.1"
FT                   /translation="MKTIAISGANGFVGTSLTNFFSSFGYKIVPLSRDILNNKSKLEEV
FT                   LNSTDIVINLAGANIINRWSETYKKLLYSSRIDTTSKIVNAISSISNKPKLLISTSAVG
FT                   IYDNKSIYDENGSFSNDFLSNLCQDWEKGALKAKSEATKVAIFRFGIVMGKDGGALQKM
FT                   ITPFKFGLGGTIGSGKQAFSFIHINDLLNAYKFVIENDYHGVFNLTAPTPTTNKGLTLA
FT                   LGKTLKRPTILPVPEFVLKLIFSEGARVLTDGQSAIPKKLLDLGFEFKFKTIEETIENL
FT                   CS"
FT   gene            complement(482014..482622)
FT                   /gene="hisH1"
FT                   /locus_tag="Abu_0475"
FT   CDS_pept        complement(482014..482622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH1"
FT                   /locus_tag="Abu_0475"
FT                   /product="glutamine amidotransferase HisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="Pfam match to PF00117 GATase, score 131.9, E-value
FT                   1.6E-036"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66750"
FT                   /db_xref="GOA:A8ES26"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES26"
FT                   /protein_id="ABV66750.1"
FT                   /translation="MIGIIDYNMGNLASVYNACHLLDAKATIVKKPEDLKNFNRVILPG
FT                   VGAYKDAMEHLIKTGMNEAILEFAKSGKPMIGICLGMQLLFESSQEFGHTDGLGLIDGV
FT                   VVKFDKSKMNEDFKIPHMGWNTIVNKEHLLFEGLHNPYLYFVHSYHAVTNEKNIIGKTT
FT                   YGYEFASAVNKDNIYGFQPHPEKSHDNGLKILKNFMSLN"
FT   gene            complement(482665..483237)
FT                   /gene="ctsW"
FT                   /locus_tag="Abu_0476"
FT   CDS_pept        complement(482665..483237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsW"
FT                   /locus_tag="Abu_0476"
FT                   /product="transformation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66751"
FT                   /db_xref="GOA:A8ES27"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES27"
FT                   /protein_id="ABV66751.1"
FT                   /translation="MICLTCKNLSFEIICKDCQKNLLVPSFHKREIEDGFFNYSFYSLS
FT                   ELEDLINSKYYFYGDRVFNILAKLSFAKFALNFDFPSEVLAIPIDDHTRHDFSHCAILA
FT                   KHLKSKIIKPKYNSLKATNIVKYAGKNLEFRQKNSRKFQINNLSDKFVILCDDLITTGT
FT                   TIIQAKKALEKKNNQILFSLTLADAKL"
FT   gene            483387..483794
FT                   /locus_tag="Abu_0477"
FT                   /note="AB0477"
FT   CDS_pept        483387..483794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66752"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES28"
FT                   /protein_id="ABV66752.1"
FT                   /translation="MDLTIIGTAFSHLKTSMDIAKLISDSASSLGEAETKLKLAELISS
FT                   LADLKMELADIKVDLIDKDEAIRELNERLKEKESLSFDGKFYLKEGDNIPFCPICWESS
FT                   KKSIHLILRNHYGYGKYQECEVCKTKYYIEE"
FT   gene            complement(483936..485723)
FT                   /gene="lepA"
FT                   /locus_tag="Abu_0478"
FT   CDS_pept        complement(483936..485723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="Abu_0478"
FT                   /product="GTP-binding protein LepA"
FT                   /note="Pfam matches to PF06421 LepA_C, score 244.8, E-value
FT                   1.7E-070, and to PF00009 GTP_EFTU, score 231, E-value
FT                   2.3E-066, and to PF00679 EFG_C, score 135.8, E-value
FT                   1.1E-037, and to PF03144 GTP_EFTU_D2, score 43, E-value
FT                   9.2E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66753"
FT                   /db_xref="GOA:A8ES29"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES29"
FT                   /protein_id="ABV66753.1"
FT                   /translation="MQKNIRNFSIIAHIDHGKSTLADRIIQECGAIADREMTSQVMDTM
FT                   DIEKERGITIKAQSVRLDYIKDGQKYVLNLIDTPGHVDFSYEVSRSLASSEGALLIVDS
FT                   TQGVEAQTIANVYIAMDNDLELLPVVNKIDLPSADPIRVLEEVEEAIGLDCTLHNLISA
FT                   KTGLGVKDLIDSIVDRVPAPTGDEDAPTKALIYDSWFDNYLGALALVRVYDGSIKKGQK
FT                   IKLMNTKVEHQVLSLMYPHPIRRQDANEIKTGEIGIVVLGLKTLDGIAVGDTMTDAKTP
FT                   TQEPIDGFEPAKPFVFAGIYPIETDKFEDLREALNKLKLNDSSISFEPESSAALGSGFR
FT                   TGFLGMLHMEVIKERLEREFDLDLIATAPTVIYQVEKSNGETIEIQNPSELPEPNYIKT
FT                   IFEPYVKATILVPDEFLGNVIKLLNDKRGIQIKMDYIGKRVLLEYDLPMNEIVMDFYDK
FT                   LKSTTKGYASFDYEPVGFRPGNLKKLDVRVAGDVVDALSIIVPEDKAVSKGREFVKALK
FT                   ELIPRQLFEVAIQASIGSTIIARETVKSMGKNVTAKCYGGDITRKRKLLEKQKAGKKRM
FT                   KAIGKVNVPQEAFMAVLKI"
FT   gene            485898..486164
FT                   /locus_tag="Abu_0479"
FT                   /note="AB0480"
FT   CDS_pept        485898..486164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0479"
FT                   /product="conserved hypothetical protein (DUF156 domain
FT                   protein)"
FT                   /note="Pfam match to PF02583 DUF156, score 70, E-value
FT                   7.2E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66754"
FT                   /db_xref="GOA:A8ES30"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES30"
FT                   /protein_id="ABV66754.1"
FT                   /translation="MNEEKQKAVQALKTAKGQIEGIIKMLEDGRYCIDVSNQIFAVSSL
FT                   VKKANLLILKQHMNHCVLEAVNSGDANNKIDEITQVLSKILDK"
FT   gene            486176..488695
FT                   /locus_tag="Abu_0480"
FT                   /note="AB0481"
FT   CDS_pept        486176..488695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0480"
FT                   /product="heavy-metal transporting P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="Pfam matches to PF00122 E1-E2_ATPase, score 352.3,
FT                   E-value 1.4E-106, and to PF00702 Hydrolase, score 125.1,
FT                   E-value 2.5E-035, and to PF00403 HMA"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66755"
FT                   /db_xref="GOA:A8ES31"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES31"
FT                   /protein_id="ABV66755.1"
FT                   /translation="MKSQKFDIKGMTCSACSTAVDRNVKKLEGINEVNVNLLNNSMIVK
FT                   YDENILNNETIIKKVQDAGYEAFLVENGKKTQKNSTEDNLGKIETNELKNRLIISFIFA
FT                   IPLFYISMGHMLNWYLPHLFHGYSNAIIFAFTQFLLALPIVFINIKYYKVGFKTLYKGS
FT                   PNMDSLIAIGTSAAMIYGVFSIYKIGYGLGNNDIDMVIQYSHDLYFESAAIVLTLITLG
FT                   KFLEARAKENTSEAINKLINLTPKTALVLRNNQEIEIPVDELVLKDIVIVKPGNIVPTD
FT                   GVIIFGNSSIDESMLTGESLPVSKKVGDKVIGASINKSGSFKFEVTKLGEDTVLSQIIK
FT                   LIEEASSSKAPISKLADRISAIFVPTVIVISILATVTWLFLGYSFEFALSIGIAILVIS
FT                   CPCALGLATPTAIMVGTGKGAQNGILIKSAESLEIAHTINTVVIDKTGTITEGKTQITD
FT                   IFTSEKITQDKLLQLCATIEKNSEHPLADAILKKAQEKAIELLNATDFEALNGLGIKAK
FT                   VEDRVFYIGNKKLLDSKNISLDLFYEKSEKLANEAKTPIFIADENEVLGLIAISDVVKL
FT                   TSKDAILEFEKMGLEVIMLTGDNYKTANAIAKQININNVIAEVLPQDKEKEIQKLQSLG
FT                   KKVAMIGDGINDAPALVRADVGIAIGAGTDIAIESANIVLVKSDLLDAVKAIQLSNAVI
FT                   KNIKQNLFWAFFYNIIGIPLAAGVFYTIFGWKLSPMFAGAAMSLSSVTVVLNALRLKLF
FT                   EPRISKNLLEKNNISKGDKMEKILKVDGMTCGHCKARVEKVVSAIDGVDSVEVDLASKN
FT                   VTVKMSKDISEQTLSDVIVDAGYEVIK"
FT   gene            complement(488761..489777)
FT                   /gene="cadF"
FT                   /locus_tag="Abu_0481"
FT   CDS_pept        complement(488761..489777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadF"
FT                   /locus_tag="Abu_0481"
FT                   /product="outer membrane fibronectin-binding protein"
FT                   /note="Pfam match to PF00691 OmpA, score 131.5, E-value
FT                   2.1E-036"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66756"
FT                   /db_xref="GOA:A8ES32"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES32"
FT                   /protein_id="ABV66756.1"
FT                   /translation="MKKVLLSTIACASLALAANSDYKYEITPLIGGVLTEGNTGLEKNY
FT                   ANAGLSFGFNQFDSFIDQVELGFLRTLEDVDGKGNFSNRDTGVTRVFANLVKDYDLTSD
FT                   LSLYTLVGAGVEFFDNEFEDNKNGLFGNYGVGVKYNLAERLALKFDVRHLIEVDHGDNT
FT                   LLYTVGLSVPFGEVSKPAPVAEKPAPVATPVAAPKDSDGDGVIDNLDECPNTMKGAKVD
FT                   NIGCMTLVNLNINFDTDKSVIKDSYNSRINEFAKVMKADPKLKANIEAHTDSVGTDAYN
FT                   QKLSERRATSAVNALVAAGVEKDRIKAVGYGESRPIASNDTVEGRAENRRVEAVMVK"
FT   gene            complement(489857..490789)
FT                   /gene="prsA"
FT                   /locus_tag="Abu_0482"
FT   CDS_pept        complement(489857..490789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="Abu_0482"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="Pfam match to PF00156 Pribosyltran, score 127.4,
FT                   E-value 3.6E-035"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66757"
FT                   /db_xref="GOA:A8ES33"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES33"
FT                   /protein_id="ABV66757.1"
FT                   /translation="MSNFKLFSGSANPEFAKKVGEYLGMPVSDATLNKFSDGEISVQIT
FT                   ESVRGQDVFIIQPTCAPTNDNLMELLIMVDALKRSSAKSISAVVPYYGYARQDRKAAPR
FT                   VPISAKLVADLLEAAGITRVVTIDLHAAQIQGFFNIPADNLFGSILFVNYIRSKNLKNP
FT                   IIASPDIGGVARARLYADKLGYDLVIVDKKREKANVAEVMNIIGEVKGKDVILVDDMVD
FT                   TAGTLVKAAEVLKKRGATSVMACCTHGVLSGPAYDRIEKGELDELVISDTIPAKKEIKK
FT                   ITVLTASAIIGEAIRRIHNNESVNSIFNN"
FT   gene            491053..492234
FT                   /locus_tag="Abu_0483"
FT                   /note="AB0485"
FT   CDS_pept        491053..492234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66758"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES34"
FT                   /protein_id="ABV66758.1"
FT                   /translation="MKRLSLITCGLVLSSSFVFANEVKTFDDAFKSGKASGSLGLYGKH
FT                   IDYSGTQPSYDPTKQVGKAGYLNGNATIGYETASLYGFSAKAEFKGNLDLGEINNDDRK
FT                   SGIAPFENNALMTEGYLKYANDAFFVSAGRQAIDLEWLSDYHEAVVAGITAVPDTTIVL
FT                   GWTKRKAESTSELSEDFWKINENKGAYVADIKYTGFTGVELNPYYYSAPDLVDWYGLKT
FT                   TFSTDYFGLIAHYAQTNADSKFLIDTDDDNITDTQMEDGSIAHIELNTEIDGFTAAVGY
FT                   IKTDKDAGAGGMDLAGDNISPFEDGNHNYDPDAKTVYGSLGYTISDVTFGALYGQTKYD
FT                   TNRIKENELNLSASYAFSESLATSLLYVNVDTETSLNDEPDYDKWIATIEYTF"
FT   gene            complement(492280..493317)
FT                   /gene="trmU1"
FT                   /locus_tag="Abu_0484"
FT   CDS_pept        complement(492280..493317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU1"
FT                   /locus_tag="Abu_0484"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="Pfam match to PF03054 tRNA_Me_trans, score 416.3,
FT                   E-value 4.5E-126"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66759"
FT                   /db_xref="GOA:A8ES35"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES35"
FT                   /protein_id="ABV66759.1"
FT                   /translation="MSKKKVMVGMSGGIDSSVTAYMLQNEGYEVEGIYLKLHNRTDGYH
FT                   EKNLGYIEDVAKFLNIKYYILDLADKFSKEVYDYFVDSYLTGTTPNPCVKCNRQIKFGA
FT                   MLDFAKQHGASYLATGHYAKTDGKFFYEADDKTKDQSYFLSQVDKDALKYMMFPLSTYK
FT                   KEDIVKFGAKLDVAYKKITEKSESQEICFVETVYTDVVKKHANIDQEGDVLDENGKVVG
FT                   KHKGFAHYTIGKRRGFTVKGAQEPHFVTKLNPKDNTIVVGKKEALEVNEVVGNNLNMFI
FT                   DDTKFSCNVKLRYRSVSTPCEVQIKDEKAYITLKEPVYGVAKGQLAVFYHEEKVIGSAW
FT                   IESTK"
FT   gene            complement(493329..494432)
FT                   /gene="trmU2"
FT                   /locus_tag="Abu_0485"
FT   CDS_pept        complement(493329..494432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU2"
FT                   /locus_tag="Abu_0485"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="Pfam match to PF03054 tRNA_Me_trans, score 568.7,
FT                   E-value 3.6E-172"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66760"
FT                   /db_xref="GOA:A8ES36"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES36"
FT                   /protein_id="ABV66760.1"
FT                   /translation="MNKNKKIVVGMSGGVDSSVTALLLKQQGYDVVGLFMRNWEYGIKG
FT                   SQCPNRIEFEDAKKVGALIGIEVRGKDFVKEYRDRVFDVFLEGLKQGLTPNPDILCNKE
FT                   IKFNVFLNEAKSMGADMIATGHYAKIAKYKDHFVLDTPKDNTKDQSYFLHALSSEQLSH
FT                   AMFPLGDLTKKEVREIARAHNLPVSDKKDSTGICFIGNQKFDEFITQHLQAIPGDILDE
FT                   NGKVIGKHKGLVCYTLGQRKGIGLGGIKGNESENNTHKPWFVASKDVVNNTLTIVQDTN
FT                   HPLLMSKTVEASHMHWVLEEAPKVGDKLMAQVRYRQQKQACTVVEANEEKVVVEFDNPQ
FT                   RAVTLGQSLVLYSGDYCLGGGFISFYK"
FT   gene            complement(494480..494965)
FT                   /gene="folK"
FT                   /locus_tag="Abu_0486"
FT   CDS_pept        complement(494480..494965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="Abu_0486"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="Pfam match to PF01288 HPPK, score 123.9, E-value
FT                   4.1E-034"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66761"
FT                   /db_xref="GOA:A8ES37"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES37"
FT                   /protein_id="ABV66761.1"
FT                   /translation="MKKKLSPTLTLFYYSNFPKKFNNSSKKKYCVTIGIGGNIGNTKKI
FT                   FDKLILCLKKDVRFTLLMTSPLLKNPPFGFLEQSDFLNGIIRLKTNLCPNAFLKAMQRY
FT                   EKKFGRKRSFQDAPRTLDIDIIFFDNKKIDTKNLIIPHKNWANRESVIIPLKHMQNN"
FT   gene            complement(494996..496021)
FT                   /gene="pepQ"
FT                   /locus_tag="Abu_0487"
FT   CDS_pept        complement(494996..496021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="Abu_0487"
FT                   /product="prolidase (Xaa-Pro dipeptidase) (pepQ)"
FT                   /EC_number="3.4.-.-"
FT                   /note="Pfam match to PF00557 Peptidase_M24, score 149.1,
FT                   E-value 1.1E-041"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66762"
FT                   /db_xref="GOA:A8ES38"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES38"
FT                   /protein_id="ABV66762.1"
FT                   /translation="MKNFILKNENAIYFECKFSCDNVIFINLEKDKYFITDARYTTEAK
FT                   EYAKKCEVIESSNPIETAKEILKKNKVKKIVFDPNDFSFASYTKLTENLKTQFIQKENF
FT                   SKLKRIIKSDKEITLLKKAAVAGREGFKELAKYIRKNGFNQTEQFLYFKAFEKMSQTGK
FT                   LDISFEPIVAINENAAKPHALPTSKKLKLHDLLLVDAGIKYKRYCSDRTCTSHVDFENF
FT                   NFKREQKFKNAKHQKVYDIVLKAQLNAITNARSGMKASEIDKLTRDVIEKAGFGKYFIH
FT                   STGHGVGLDIHEFPNINSKSDVIIEDNMVFTIEPGIYLPNEFGVRIEDTVVMQNGKAVI
FT                   L"
FT   gene            496099..496593
FT                   /gene="aroQ"
FT                   /locus_tag="Abu_0488"
FT   CDS_pept        496099..496593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="Abu_0488"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="Pfam match to PF01220 DHquinase_II, score 258.2,
FT                   E-value 1.6E-074"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66763"
FT                   /db_xref="GOA:A8ES39"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES39"
FT                   /protein_id="ABV66763.1"
FT                   /translation="MKIAVIQGPNLNMLGIREQHIYGNMSLEQIHQQLQTAAEQNGVEL
FT                   EFFQSNFEGEIVDRVQECLGTVDGIMINPAAYSHTSIAIKDALSAVNMPVVEVHISNIY
FT                   KREEFRQKSITAAASTGVISGFGAFGYHMGLIALMQMINELKAIAQARNAQIQAQTEEN
FT                   K"
FT   gene            496541..497821
FT                   /locus_tag="Abu_0489"
FT                   /note="AB0491"
FT   CDS_pept        496541..497821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0489"
FT                   /product="amidohydrolase family protein"
FT                   /EC_number="3.5.4.3"
FT                   /note="Pfam match to PF01979 Amidohydro_1, score 106.8,
FT                   E-value 5.6E-029"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66764"
FT                   /db_xref="GOA:A8ES40"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES40"
FT                   /protein_id="ABV66764.1"
FT                   /translation="MHKLEMHKFKLKQKKTNNFMKAISASYVVTCDENNRIIKDGAVVF
FT                   DDKLIEIDTLFEIKNKYPNLEIKELEENSILMPGLVNSHIHLEFSANTTTLKYGNFYSW
FT                   LNSVIKHREDLINKATNELISTKLNKIKKTGTTTIGAISSYSFDMEACIKSPINTVFFC
FT                   EVIGSKADMVDTLFADFRSRLNNAKKFASKNFIPAIAIHSPYSVHPFLVREALNVARDE
FT                   NLAVSSHFLESQEEFEWLHKDEGSFLEFFKNFLNQEKATSKPMEFLGLFSKVKNLSFTH
FT                   CVEASDDDLEKIKDLGASINHCVTSNRLLNNTKLDLDRLKDIPFTIGTDGLSSNNSLSM
FT                   FDELRNALMAHYDKNVVEFSKILLKAATFNGSRALGLNKGVLKESFDADMISFKLPNKI
FT                   EDINDICMQIILHTKFVDDVIIGGEYV"
FT   gene            497814..498698
FT                   /gene="pspA"
FT                   /locus_tag="Abu_0490"
FT   CDS_pept        497814..498698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="Abu_0490"
FT                   /product="protease IV (PspA)"
FT                   /EC_number="3.4.21.-"
FT                   /note="Pfam match to PF01343 Peptidase_S49, score 204.8,
FT                   E-value 1.8E-058"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66765"
FT                   /db_xref="GOA:A8ES41"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES41"
FT                   /protein_id="ABV66765.1"
FT                   /translation="MFEFFRKLFSPVIAILDFITKYFKTIVFLTIIYVVFFNSDEERIS
FT                   TKSTANLQKIELVGPIIDVSKTLENIEKAKTDTNIKGVLFVVDSPGGAVAPSVEVAYAI
FT                   KELKQIKPVVVYASGVIASGSYYASIWADKIIANHGSMVGSIGVIMQGVNTKELMDKIG
FT                   IQTQTVKAGKYKESGTPTRKWTEFEEKQLQSVIDDTYNMFITDVATARNLDIKNYTSFA
FT                   DAKIFTSKQAKDVGLVDEVANITVAQKTLAELSKVENPVWKKEDKFEKFMDKLVSEAVS
FT                   QISMNFVTGLKAY"
FT   gene            complement(498781..499443)
FT                   /locus_tag="Abu_0491"
FT                   /note="AB0493"
FT   CDS_pept        complement(498781..499443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66766"
FT                   /db_xref="GOA:A8ES42"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES42"
FT                   /protein_id="ABV66766.1"
FT                   /translation="MDDKNLELLPDKDGFLFEIDDHSLIIEQIVIIIIGILFLIMMWGF
FT                   GIGEGLKSSDGHMFNRITGTVICVLSIIYGLVKILILKKQVKKIIFYTNKITKTINDKN
FT                   VSIYFFNEIYKCNTIGVGMQKLRRYSKLKKYFTMIFMPIGILIIYFILILNYIVVIAYY
FT                   RKIIFPIYSIILIENSDLEMIVIPFLEKQQNIKNYFSKYHNIDIKKLKITWFIPEKN"
FT   gene            complement(499680..500894)
FT                   /gene="ackA1"
FT                   /locus_tag="Abu_0492"
FT   CDS_pept        complement(499680..500894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA1"
FT                   /locus_tag="Abu_0492"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Pfam match to PF00871 Acetate_kinase, score 692,
FT                   E-value 4.9E-211"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66767"
FT                   /db_xref="GOA:A8ES43"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES43"
FT                   /protein_id="ABV66767.1"
FT                   /translation="MLVFVLNAGSSSLKYQLMNPVIKKVLASGLCERIGIDGVLKHEYG
FT                   ENGQKLTLNVPMPTHKEAIEAVLTTLTAGEGKVINSINDIDAIGHRTVHGGEEFSGSVM
FT                   ITPEVIDTMKKLSPLAPLHNPANILGIEICQQLMPGKPNVGVFDTAFHQTMPDYAYMYA
FT                   LPYEMYTKHGIRKYGFHGTSHFFVSNEARGMLDKKHNTRIIVCHLGNGSSVSAVLNGRC
FT                   IDTSMGLTPIQGLMMGTRSGDVGAGALQYMMSQENLTIDQAIDIMNKKSGILGISGKSS
FT                   DLREVLQGMQDGDERCRLAVDMVAYNIKKYVGSYVAALDGIDALCFTGGIGENAALIRE
FT                   KVCAGLDSMGLVIDPVKNNKRSNVARDIATNGSASRIFVIPTNEEYVIANDTYKIVSGQ
FT                   ASTCQ"
FT   gene            complement(500921..501916)
FT                   /gene="pta"
FT                   /locus_tag="Abu_0493"
FT   CDS_pept        complement(500921..501916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="Abu_0493"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="Pfam match to PF01515 PTA_PTB, score 517.1, E-value
FT                   1.8E-152"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66768"
FT                   /db_xref="GOA:A8ES44"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES44"
FT                   /protein_id="ABV66768.1"
FT                   /translation="MGLIETIKEKAKLKLRTIVLPEPEDERVLKATEQVLKDKTANVVL
FT                   IGNADTIKADAAKHGANIDGATIIDPKKFDNINKYIDELVELRKNKNLSRDEATEIMLN
FT                   EPRFFGCMMVRLGDADGLVAGSNSPTADVLKAAIQVIKTAPGINTVSSTFIMETADGKF
FT                   GDNGLILFADCAVIPEPNAEQLADIACATAATAASVVGLNPRVAMLSFSTKGSAAHPLV
FT                   DKVQSACKILGERNVNFSFDGELQADAAIVESIGAKKAPGSKVAGHANILVFPDLQSGN
FT                   IGYKLVQRFAGAEAHGPIVQGLNKPVNDLSRGCSVEDIANLVAITATQIK"
FT   gene            complement(502160..503350)
FT                   /gene="ackA2"
FT                   /locus_tag="Abu_0494"
FT   CDS_pept        complement(502160..503350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA2"
FT                   /locus_tag="Abu_0494"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Pfam match to PF00871 Acetate_kinase, score 697.6,
FT                   E-value 9.2E-213"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66769"
FT                   /db_xref="GOA:A8ES45"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES45"
FT                   /protein_id="ABV66769.1"
FT                   /translation="MLVFVLNAGSSSLKYQLINAKTHELKASGLVERIGIDGILKHEIG
FT                   ENKKLTFETPIPTHKEAIELVLRILTNDETKVINSIDEIQAIGHRVVHGGEHFKGSVIV
FT                   NDDVLKKIEELIPLAPLHNPANILGIKICMQILPKVPNVTTFDTAFHQTMPIENFLYAV
FT                   PYSDYTEHHLRKYGFHGTSHYYVSNEAVKILNKKDSKIIVCHLGNGSSVCAVRDGKSIS
FT                   TSMGLTPLEGLVMGTRSGDIDAGVIPYLMEKKGLSHTQIIDYLNKKSGILGVSGISSDL
FT                   REVIKAANDGDKRSKIAIIMLCDRIKKYLCSYAGLMHGVDAICFTAGIGENSDLIREKV
FT                   CEGLQFMGIEIDTEKNKVREKGIREINTKASKTKIFVIPTNEELVIAQDTFNLVKK"
FT   gene            complement(503454..504392)
FT                   /locus_tag="Abu_0495"
FT                   /note="AB0497"
FT   CDS_pept        complement(503454..504392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0495"
FT                   /product="cation efflux protein"
FT                   /note="Pfam match to PF01545 Cation_efflux, score 8.6,
FT                   E-value 2.6E-009"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66770"
FT                   /db_xref="GOA:A8ES46"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES46"
FT                   /protein_id="ABV66770.1"
FT                   /translation="MNLYLKNEQNLLRISIFSTILLAGIGIIFGLLASSSTIIFDSIYA
FT                   MIDAVMTTLALIVARLITSSTSKDFIHNKLEKHFTMGFWHLEPIVLGVNGILLIGAATY
FT                   AFINAIDSLLLGGREILFGYAIVITLISIVVELSLGIFIKKANKSINSEFLTLDSISWL
FT                   ISASMSLGYLFAFSFGYIAKNTSLDWITPYIDPSVLIFVCIFIIPMPFKTVKKALADIL
FT                   LVTPLELKQQVDKIAENIVKKYGFDSFRAYVARVGRGRQIELYFIVPKSWPAKKLEEWD
FT                   LLRDEIEKELGKEDPDLWLTIVFTTDCEWAE"
FT   gene            complement(504450..505640)
FT                   /gene="ackA3"
FT                   /locus_tag="Abu_0496"
FT   CDS_pept        complement(504450..505640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA3"
FT                   /locus_tag="Abu_0496"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Pfam match to PF00871 Acetate_kinase, score 680.8,
FT                   E-value 1.2E-207"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66771"
FT                   /db_xref="GOA:A8ES47"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES47"
FT                   /protein_id="ABV66771.1"
FT                   /translation="MLVFVLNAGSSSLKYQLIDAKTQELKASGLVERIGIDGILKQVID
FT                   ENRKLTMEAPIPTHKEAIELILETLTKGDTKVINSIDEIQAIGHRVAHGGEYFKESTLV
FT                   TEKVIKKIEEAIPLAPLHNPANILGMKICMQLLPKVPNVAVFDTAFHQTMPEIHFLFPV
FT                   PHEDYTEHHLRKYGFHGTSHFFVSQQAIKLLGNKKDSKIIVCHLGNGSSVCAIKDGKSV
FT                   NTTMGLTPLGGLMMGTRSGDIDPGIIPYLMDKKDMNTHQIIDYLNKKSGILGVSGISSD
FT                   LREIISAANDGDQRAQVTIDMMCNRVKKYVCSYAGLLGGVDAICFTAGIGENSDIVREK
FT                   VCHNLEFMGVEIDKDKNQIKNHQIREINKESSKTKIFVIPTNEELVIAQDTFNLVK"
FT   gene            complement(505661..506269)
FT                   /gene="dnaQ1"
FT                   /locus_tag="Abu_0497"
FT   CDS_pept        complement(505661..506269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ1"
FT                   /locus_tag="Abu_0497"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Pfam match to PF00929 Exonuc_X-T, score 100.8,
FT                   E-value 3.7E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66772"
FT                   /db_xref="GOA:A8ES48"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES48"
FT                   /protein_id="ABV66772.1"
FT                   /translation="MFRNIKNYFNKKNLKDKKYLYLFEDSQIKDEYVCFDCETTGLNPK
FT                   KDDIISIGAVIIKDNTIISSKKFVKFIKPKTKLQAEAIKVHHIRECDLNNANDIDLVIE
FT                   EFLEFIGNRTLVGYFLEFDISMINKYLKPKLGITLPNKTLEVSEIYHDYKIEIIPQGHI
FT                   DLRFNSIMEELEIPSLGKHDAFNDALMTAMIFIKLKNIA"
FT   gene            complement(506262..508103)
FT                   /locus_tag="Abu_0498"
FT                   /note="AB0500"
FT   CDS_pept        complement(506262..508103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0498"
FT                   /product="conserved hypothetical protein (DUF294 domain
FT                   protein)"
FT                   /note="Pfam matches to PF03445 DUF294, score 204, E-value
FT                   3.2E-058, and to PF00571 CBS, score 57.2, E-value 4.7E-015,
FT                   and to PF00027 cNMP_binding, score 49.8, E-value 8.5E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66773"
FT                   /db_xref="GOA:A8ES49"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES49"
FT                   /protein_id="ABV66773.1"
FT                   /translation="MSILEQKSFISSIHPFENLTANELDDFVESLDIVYFKENQIIQAQ
FT                   ESSPKFLYFILKGLVQEKQDDEVLSVYSKNEIFDSISLIESFSKNSFVTAEETICYILP
FT                   REVFIKILHGNIELEKYFFQSISEKLNNNILHEKNREMANIMIAKVKDARIHKAVIIDT
FT                   EKTIFEAASIIKKEKIPTILLKDENDEMYIVTDSDFRQKVILNRMDFDDKVVKIATKGL
FT                   IYIDENDFLFNAQLMMAKHGLKRVVVKNDKNQIIGILDQISLSSFFATNIFSVSNQIVK
FT                   AETVEELKEASLSFIKIIKSLNAKGVKIDFVSRLINQLNKKLLDKLYKILAPKELSEKS
FT                   CLVVMGSEGRGEQILRTDQDNALIISDDCTISDEELKNFTQNFTETLVDFGFPRCEGNI
FT                   MISNPYWCRKISDFKELIFTWVNEPSGDNFMNIAIFYDALCVSGDIKMIKELKEYLFKV
FT                   SSNSQTFYAHFAKVISSFDVPLGFFDGFVFNSKDEKHKDEIDIKRGGIFILVQGIRSLC
FT                   LENRVLNTNTIKRINKLQELGVLENEMAKELIMAFNFLLNLKLKSNLAKLDKNLAIDNY
FT                   INPNNLNKMEKELLKDSFKIINKLKKNLEFHFKLNYV"
FT   gene            complement(508154..509821)
FT                   /locus_tag="Abu_0499"
FT                   /note="AB0501"
FT   CDS_pept        complement(508154..509821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0499"
FT                   /product="sodium:solute symporter family protein"
FT                   /note="Pfam match to PF00474 SSF, score 451.9, E-value
FT                   7.6E-133"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66774"
FT                   /db_xref="GOA:A8ES50"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES50"
FT                   /protein_id="ABV66774.1"
FT                   /translation="MLKVLALISIFAISLFAAGDATFEGKRDLNIPAIIMFFVFIAGTL
FT                   GITYWAARKTKSASDFYTAGGGISGFQNGLAIAGDYMSAAAFLGVSGLIYMSGYDGVIY
FT                   AVSFLVGWPVILFFMAEKLRNLGKFTFADIAAYRLGQKEIRTLAAFGSLSVVVLYLIAQ
FT                   MVGAGKLIQILFGMEYEYAVFMVGALMIIYVTFGGMLATTWVQIIKAILLLSGVSFMAV
FT                   MILYHFDFSFESLAVQAVEHHKNGEAILKPGGFLSDPISAISLGMALMLGTAGLPHVLM
FT                   RFFTVGNAKEARKSVVYATGFVAYFWIIITIVGFGAIAFLNTAEGAQYFDGAKAYLDGG
FT                   KLFGGSNMASVHLSHMLGGNAFLGFISAVAFATILAVVSGLTLAGASAISHDIYANVIN
FT                   PNATDEQVVKISKITVIIVGIVGVTLGIAFESQNIAYMVGLAFGIAASANFPILFLSIY
FT                   WSQLTTRGAFIGGFMGLITAVVLVILGPNVWVQILGNEKAIFPYAHPALFSVTVAFVSI
FT                   WFFSKIDNSEKAIKERALFRGQNIRANTGIGAAGAVSH"
FT   gene            complement(509821..510135)
FT                   /locus_tag="Abu_0500"
FT                   /note="AB0502"
FT   CDS_pept        complement(509821..510135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0500"
FT                   /product="conserved hypothetical protein (DUF485 domain
FT                   protein)"
FT                   /note="Pfam match to PF04341 DUF485, score 100.1, E-value
FT                   6E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66775"
FT                   /db_xref="GOA:A8ES51"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES51"
FT                   /protein_id="ABV66775.1"
FT                   /translation="MNEKLIERIESNPKYIELVSKRNSLALKLGFFVLIMFYGYISIVA
FT                   FDKELFATKIGDGVTTIAIPIAFAILIISFLTTLIYVRRANTEFEDLTTQIKKDVKDLL
FT                   "
FT   gene            complement(510362..512011)
FT                   /locus_tag="Abu_0501"
FT                   /note="AB0504"
FT   CDS_pept        complement(510362..512011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0501"
FT                   /product="sodium:solute symporter family protein"
FT                   /note="Pfam match to PF00474 SSF, score 467.5, E-value
FT                   1.5E-137"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66776"
FT                   /db_xref="GOA:A8ES52"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES52"
FT                   /protein_id="ABV66776.1"
FT                   /translation="MLKILTLLGLSSLALFAADGAGAVNINAVIMFFVFIVGTMGITKW
FT                   AASKTKSASDFYTAGGGITGFQNGLAIAGDYMSAASFLGISGMIFLHGFDGMIYAIGFL
FT                   VGWPIILFLMAEKLRNLGKFNFTDIAAYRLDQQKIRILAAFGSLTVVTFYLIAQMVGAG
FT                   KLIELLFHIPYGWSVVIVGALMIIYVTFGGMLATTWVQIIKAVLLLSGVTFIAIMVLSH
FT                   YGFSFGELAAQAVSMHPKADAILKPGPFVADPVSAVSLGLALMLGTAGLPHILMRFFTV
FT                   GNAKEARKSVVYATAFIGYFYLIIGVVGLGAIVFLLSPEGAAYFKDGVIDLKGIIGGNN
FT                   MAAVHLSQAVGGDIFLGFIAAVSFATILAVVAGLTLAASNSIAHDLYAIVIRKGQATDA
FT                   EEMKVSKRTVLVIGIVAILLGFAFEKQNIAFMVGLAFAIAASANFPILILSIYWSKLTT
FT                   RGAFIGGFLGLLTAIVLVVLSKTVWVDIFGFEKAIFPYTQPALFSILAAFIGIWFFSIT
FT                   DSSARAEEDKSGFEAQKIRAETGIGADGAVSH"
FT   gene            complement(512011..512379)
FT                   /locus_tag="Abu_0502"
FT                   /note="AB0505"
FT   CDS_pept        complement(512011..512379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0502"
FT                   /product="conserved hypothetical protein (DUF485 domain
FT                   protein)"
FT                   /note="Pfam match to PF04341 DUF485, score 114.6, E-value
FT                   2.5E-031"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66777"
FT                   /db_xref="GOA:A8ES53"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES53"
FT                   /protein_id="ABV66777.1"
FT                   /translation="MFLQLKYFTISMNLILGEKMDNKLVERIKANPKYAELVSKRSSFA
FT                   VKLAIFMLVIYYGFVLTIAFDKEFFATKVGEVMTVAWPIAATIIVISFITTLIYVVRAN
FT                   GEFEDLETSIKNDVKDIL"
FT   gene            complement(512451..513062)
FT                   /gene="dnaQ2"
FT                   /locus_tag="Abu_0503"
FT   CDS_pept        complement(512451..513062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ2"
FT                   /locus_tag="Abu_0503"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Pfam match to PF00929 Exonuc_X-T, score 95, E-value
FT                   2E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66778"
FT                   /db_xref="GOA:A8ES54"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES54"
FT                   /protein_id="ABV66778.1"
FT                   /translation="MLKNILRNWNRKQLKNKKYDFLFETPPQNEYVSLDCETTGLNPKK
FT                   DEILSIGAVLIKDNKILMRKTFNIFLKPSKDINIESIKVHHLRQIDLNDALEPEIGIYQ
FT                   LLDFIGSRPIVGYYIEFDMAIISKYTKKYLGIKLPNTPIEVSSIYYDSRKSTSNYGFID
FT                   LKFDTIMKNLNIPVLGKHDALNDAIMTSMIFLKLKQFINQ"
FT   gene            complement(513062..514882)
FT                   /locus_tag="Abu_0504"
FT                   /note="AB0507"
FT   CDS_pept        complement(513062..514882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0504"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="Pfam matches to PF03445 DUF294, score 180.7, E-value
FT                   3.3E-051, and to PF00571 CBS, score 57.3, E-value 4.4E-015,
FT                   and to PF00027 cNMP_binding, score 37.1, E-value 5.6E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66779"
FT                   /db_xref="GOA:A8ES55"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES55"
FT                   /protein_id="ABV66779.1"
FT                   /translation="MSIQDQESFLSNIHPFEVLTPSQMAMCIQHMDIAYYPKDTILISP
FT                   EKIPEHFFIIIKGSVYEYSNENIVVMDYQHEDSFDSNSLIYGKCDHTFKVNEELICYEI
FT                   EKKTFLSLIEKNQEFKDFFLKDLVNKIQSLKDKEYTSQLSSFMIAKVGDTLIHEACMVD
FT                   ENTKLIDAIEKSMQFKTSTIIVKKSDGGYGIITDSLLKVKVLLQGRDLTIPVRDIAIFP
FT                   LLTIQKDDYLFEALTILIKRNIKRIGVTNNKGEMIGILEQIDILSHFANHTYVIESKIK
FT                   NANKVEDLKIASNEFLNIIKSLQAKGVKIYHISNLIGQLNTKVYQKLYSLVLPEELQKN
FT                   ACLIVMGSEGRNEQIIKTDQDNALVIKNGIDVEQYRPYMQQLTNHLVDLGYPPCEGNIM
FT                   VSNPYWCKTADEYKTDITKWINSPDMKSYLDLAIFIDAFAVAGDKELLINLKEYLYNKI
FT                   QSKDIFMAYFAKSTLAFDTPTTFSSFMAKDDLINIKKAAIFPIVQGIRSLALKEKIKET
FT                   TTIKRIKILEARNILEKTKAAELIEAFEIASTLRLKNQLDCIQEGVALTNEINTNDLGK
FT                   IERDLLKESFKIVVEFKKFINYIFKLDKIY"
FT   gene            complement(514902..516671)
FT                   /locus_tag="Abu_0505"
FT                   /note="AB0508"
FT   CDS_pept        complement(514902..516671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0505"
FT                   /product="sodium:solute symporter (Ssf family)"
FT                   /note="Pfam match to PF00474 SSF, score 66.4, E-value
FT                   3E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66780"
FT                   /db_xref="GOA:A8ES56"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES56"
FT                   /protein_id="ABV66780.1"
FT                   /translation="MELQSLIYLFGTITFAIYVGLALWTKASSTKDFYIANNKVNPIFI
FT                   GVSIATEWIGAASFISIAGTISYLGYNGTPYILGFTGGFVLLTLLVVPYLKKFGKFTIP
FT                   DFIAQRYYSNKARLLTIIIIILASFIYISAQMKGLGIIFSRFFQVDMNVGLLSAIGILF
FT                   LYAIFTGMRTNNYTQIAQYIIILFAYTFCAIFLSLQLTNNFLPQLAIFSTTTFDFITPI
FT                   QTIKEGTPFLIALDKILLDFGFNSYSKSLDLVNVFMITMALMLGTAVLPHLLIKFFALT
FT                   TVKDAKKSALWALIFVALIFTTISSVASFSKINLLKNVQNIDYEAYTQGELINYDGSTN
FT                   NGKWLKIWQNTGFISWNDKNEDKKIQINGTANNELFINPDIITLVNAEIANLPNWIIAL
FT                   LISGALAAILATTTGLLLIIVTTISYDLWDEFIYKNNKKHVLKNRIKKLTIILIVFIIV
FT                   VLATFFTIPFYSIVQTVTISFTLIAATIFPAIILGIFDRRMNKEGAFFGILTGFIFTFC
FT                   YIVYFLFFNNSIENMSNYLFGITPEGIGTIGAILNFVIALIISRLTPLPPKSVQRLIHK
FT                   IRIPTNTKKKMEL"
FT   gene            complement(516677..516931)
FT                   /locus_tag="Abu_0506"
FT                   /note="AB0509"
FT   CDS_pept        complement(516677..516931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66781"
FT                   /db_xref="GOA:A8ES57"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES57"
FT                   /protein_id="ABV66781.1"
FT                   /translation="MNQKKAKEYWKENVFLIIKLLIVWFVISFGCGILFVEQLNLIEIN
FT                   GVKLGFFMAQQGAIYLFIILIIIYIKKMSQIDKKYDVSE"
FT   gene            complement(517007..517669)
FT                   /locus_tag="Abu_0507"
FT                   /note="AB0510"
FT   CDS_pept        complement(517007..517669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0507"
FT                   /product="two-component response regulator"
FT                   /note="Pfam matches to PF00072 Response_reg, score 80.2,
FT                   E-value 4.1E-024, and to PF00486 Trans_reg_C, score 51.7,
FT                   E-value 2.2E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66782"
FT                   /db_xref="GOA:A8ES58"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES58"
FT                   /protein_id="ABV66782.1"
FT                   /translation="MKILLLEDELLLNNAISEYLRNIGHMVESFQDGQDVLDNIDSSFD
FT                   LLILDINVPTVDGFGVLAYLNSKKIHIPTIFISALVDIEDITKAYNLGCREYIKKPFHL
FT                   GELGIKINQILKKEQNNTSHIRFSENYSYSKDKQTLYFNGEPQNLTKKQLEIIHILVLN
FT                   INMIVDFERFRVDVWDAENIDNPTIRAEISRLKKALKEDFIKNIRGLGYKIDRYYSV"
FT   gene            complement(517650..519233)
FT                   /locus_tag="Abu_0508"
FT                   /note="AB0511"
FT   CDS_pept        complement(517650..519233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0508"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Pfam matches to PF02518 HATPase_c, score 51.2,
FT                   E-value 3.1E-012, and to PF00512 HisKA, score 28.3, E-value
FT                   2.5E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66783"
FT                   /db_xref="GOA:A8ES59"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES59"
FT                   /protein_id="ABV66783.1"
FT                   /translation="MLKAKSLYHLIVYSILFIIVLISFFTFIIINNAHEELQEKIHTLK
FT                   EDYTNNQKALIKNHIDYVIKFIDYYYKENVDKKDLETIKKEVIVAIKDLDLSDNPNEYI
FT                   FIYDFDGNLLQNSIDNVNVGKNFLNFTDQSGRKIIEELINISKNKDGGFINYFWSKPEI
FT                   HKEANKISYVKSYDKWNWTIGKGVYLDEIDKLIKLKEADYNQKISNYTLQVTSLTILLI
FT                   FYSIFIYKNATILIVNDVKEIGKYFKESQKNDEPLNQNNIIFGEFKVIANYATDAMNNI
FT                   KLKTTMLEDLNKNLEDKVKEKTKELTDLVDSQKSFIKNSVHEINTPLSIIRTNIDLLKM
FT                   KIPNNNYITNIESGSKTIQYIYDDLSYLIKKDRVVYEKEYLDFTSILKERLEFFDEIIK
FT                   SNSLYLIQNLEDDLYIKFNITELQRIIDNNLSNAVKYSSSKSPIFVKLYYLNDDEIEFS
FT                   ITTISKKIENVDKIFEDYYRENSSRGGFGLGLKIVKDICDKNLVIINIDSNEKETKFTY
FT                   RFKINEDTTS"
FT   gene            complement(519310..519386)
FT                   /locus_tag="Abu_0509"
FT   tRNA            complement(519310..519386)
FT                   /locus_tag="Abu_0509"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: GTC"
FT   gene            complement(519407..519482)
FT                   /locus_tag="Abu_0510"
FT   tRNA            complement(519407..519482)
FT                   /locus_tag="Abu_0510"
FT                   /product="tRNA-Val"
FT                   /note="anticodon: TAC"
FT   gene            complement(519502..519576)
FT                   /locus_tag="Abu_0511"
FT   tRNA            complement(519502..519576)
FT                   /locus_tag="Abu_0511"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon: TTC"
FT   gene            complement(519599..519674)
FT                   /locus_tag="Abu_0512"
FT   tRNA            complement(519599..519674)
FT                   /locus_tag="Abu_0512"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   gene            complement(519692..519768)
FT                   /locus_tag="Abu_0513"
FT   tRNA            complement(519692..519768)
FT                   /locus_tag="Abu_0513"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: GTC"
FT   gene            complement(519832..519907)
FT                   /locus_tag="Abu_0514"
FT   tRNA            complement(519832..519907)
FT                   /locus_tag="Abu_0514"
FT                   /product="tRNA-Val"
FT                   /note="anticodon: TAC"
FT   gene            complement(519927..520001)
FT                   /locus_tag="Abu_0515"
FT   tRNA            complement(519927..520001)
FT                   /locus_tag="Abu_0515"
FT                   /product="tRNA-Glu"
FT                   /note="anticodon: TTC"
FT   gene            complement(520024..520099)
FT                   /locus_tag="Abu_0516"
FT   tRNA            complement(520024..520099)
FT                   /locus_tag="Abu_0516"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon: TTT"
FT   gene            complement(520163..520669)
FT                   /locus_tag="Abu_0517"
FT                   /note="AB0512"
FT   CDS_pept        complement(520163..520669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0517"
FT                   /product="CinA-like protein"
FT                   /note="Pfam match to PF02464 CinA, score 209.8, E-value
FT                   5.7E-060"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66784"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES60"
FT                   /protein_id="ABV66784.1"
FT                   /translation="MFKKIFNKKDMIELQDILRNNKKTITTAESCTGGLVASMITKVSG
FT                   SSDIFNGSIVSYSNKIKNQELNVNNETLEKFGAVSTEVVNEMLDGAIKKFEADFAIAIS
FT                   GIAGPTGATKNKPVGTVVIGISDANNVKTIDTFYFKGTREEVQIQAAKTALKKILKFVK
FT                   KTLDN"
FT   gene            complement(520766..522124)
FT                   /gene="mqo"
FT                   /locus_tag="Abu_0518"
FT   CDS_pept        complement(520766..522124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="Abu_0518"
FT                   /product="malate:quinone oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="Pfam match to PF01266 DAO, score 44.9, E-value
FT                   1.5E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66785"
FT                   /db_xref="GOA:A8ES61"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES61"
FT                   /protein_id="ABV66785.1"
FT                   /translation="MNEKHYEVVIVGGGISGAALFFELAKYSDVNSICLLEKYEDLATL
FT                   NSKGTSNSQTIHVGDIETNYTFEKAKITKRTAKMIEKFNLMYDLQDKIMFKHQKMALGV
FT                   GEKEVQFITDRYNKFKEIFPYLELWDKEALREKEPLLVYADKERTKDRPEPIVAMGTND
FT                   QYTTVDFGAMTKELVKAGQNADSSKTTDVFFNSEVEEIEQVGKKFKLTTVHGTVYTADF
FT                   VVVDAGAHSLFLAHKMGYGKHMGSLSMAGSFYITSGHFLNGKVYMVQNDKLPFAALHGD
FT                   PDILCEGKTRFGPTALALLVLERYKGGKSFFQCLKTMNFDGSIMKIFWDLLKDSDIRNY
FT                   VFKNFLFEVPGINKGLFVKDARKIVPSLSVEDIEYAKGFGGVRPQVLNKDEKKLMLGEA
FT                   SITELDGIIFNMTPSPGATSCLGNAERDIKKVCQYLGKTFYEDKFLSDFTDDK"
FT   gene            522392..525151
FT                   /gene="ileS"
FT                   /locus_tag="Abu_0519"
FT   CDS_pept        522392..525151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="Abu_0519"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Pfam matches to PF00133 tRNA-synt_1, score 925.2,
FT                   E-value 2.5E-275, and to PF08264 Anticodon_1, score 61.3,
FT                   E-value 7E-017, and to PF06827 zf-FPG_IleRS, score 29.9,
FT                   E-value 8.3E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66786"
FT                   /db_xref="GOA:A8ES62"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES62"
FT                   /protein_id="ABV66786.1"
FT                   /translation="MDYKESLLLPKTDFPMRGNLPQNEPVKYKQWDEKKVYEKMKKNRV
FT                   GCPSFTLHDGPPYANGNIHIGHALNKILKDIINKFHYFEGKSIRYVPGWDCHGLPIEQK
FT                   VEEKIGSEKKKELPKSKLRQLCRDHATKFVEIQKDEFKKLGVIADWENPYLTMDFKFEA
FT                   NIYRELCAIAKQGLLIQRSKPVYWSWAAQTALAEAEVEYEDKTSPSIYVAFEMSNESKA
FT                   IHGLENKKAAFVIWTTTPWTLPANTGISLHPVEMYVLTSDGYIVAKALYSKLKEEAVIN
FT                   GEIVTEFEPFMFESNIAINPLNGRTSKIVLGDHVMMDSGTGAVHTAPGHGEDDYKVGLR
FT                   YNLDVIMPVDAYGKYDETIVREKLFKDTNKYLGLNVFKANELILEELGSALLKRVDIRH
FT                   SYPHCWRTHTPIIFRATKQWFISIDDKYGNKNNTLRENALEVVENLKFYPEWGRNRLKA
FT                   MLEGRPDWCISRQRDWGVPIAFFRNKKTDEIIFDEKVLNYTAMIFEQKGCDAWYDLEIK
FT                   ELLYPGSGLNPDDLEKTLDILDVWFDSGSTQNAVLRSRNYDAGTFPADMYLEGSDQHRG
FT                   WFQSSLLTTLASSEIAPYKSILTHGFTVDEKGEKMSKSKGNVVAPDKVIKEYGSEILRL
FT                   WVAMSDYQSDLKISDNILKQNGELYRKIRNTARFLLANIDDLEEIIDVSKMGPLDKWIL
FT                   NKAKKVFDEIEAAFNVYEFSKGLNKLNNFLVVDLSGIYLDVCKDRLYCDDKKDIHRLAS
FT                   QSAMALIAKKLISTLACILTYTMDELLEFAPAFIKDGCEDIFDFKKVELPVVESSLDES
FT                   ILLSAKEKFSEIKDALSKEKVIKSTLELMLYTNSEDILALDEVEASDWFLVSQVSKDKQ
FT                   NSDILGSFQIDGKDFEVYKATAHKCPRCWKFTANAEESLCKRCEEVIK"
FT   gene            525275..525553
FT                   /locus_tag="Abu_0520"
FT                   /note="AB0516"
FT   CDS_pept        525275..525553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0520"
FT                   /product="conserved hypothetical NifU-like protein"
FT                   /note="Pfam match to PF01106 NifU, score 72, E-value
FT                   1.7E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66787"
FT                   /db_xref="GOA:A8ES63"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES63"
FT                   /protein_id="ABV66787.1"
FT                   /translation="MMPFTDEDLQNPVSSIIENKISPMLARDGGAIKLLAIKNARIFVQ
FT                   LQGACVGCSASSSTLKYIVEKELKSAIHPDLEIINVPQGMENNLEEL"
FT   gene            525556..526152
FT                   /locus_tag="Abu_0521"
FT                   /note="AB0517"
FT   CDS_pept        525556..526152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66788"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES64"
FT                   /protein_id="ABV66788.1"
FT                   /translation="MINEDRLLNEANSLFLQKRFEEALFLYSQLSSNFPDNKEYPIYAL
FT                   FCDIASEDVSKALSLYDYFTVIKDDSLDEAIRYVEDIVNAYDGDIDKMMEILKDLSTST
FT                   VESLDAIRYEDFKKLIEVRGSFRIAFEDIMFSTKVAIENKDDFYDFVTKLIDNDFNSTA
FT                   YSYLDGFNEYFTYDKEIEKLYKKLEEKKLETNHKR"
FT   gene            526130..527419
FT                   /gene="murE"
FT                   /locus_tag="Abu_0522"
FT   CDS_pept        526130..527419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="Abu_0522"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Pfam matches to PF08245 Mur_ligase_M, score 162.5,
FT                   E-value 1E-045, and to PF02875 Mur_ligase_C, score 105.6,
FT                   E-value 1.3E-028"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66789"
FT                   /db_xref="GOA:A8ES65"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES65"
FT                   /protein_id="ABV66789.1"
FT                   /translation="MKLIINDKTYTDNSAEADKNSIFVVSKHNEKYLQNAKENGCIEFL
FT                   NSSELKNHLDMSSIKIIGITGTNGKTTTATTIYKILLSLGFKVALQGTRGFFINETQVE
FT                   DYSLTTPIQLGNFVHIQKAIQNGCQFFVMEVSSHAIEQNRIEGLTFALKIHTNITRDHL
FT                   DYHKTIEEYIRVKNSFLSDESVKLVNIDDNVMKYNFTNAFTYSLKNLSDYKVTKYEFEH
FT                   GMKVEFSYKEKTYTFTSMMMGIFNIYNLMASIAAVHITTQKSLEDICQTLKNFSCVSGR
FT                   MEIVSLNPLVIVDFAHTPDGMDEVLKSFPNKDIICVFGAGGNRDSAKRPLMGEVAKKYS
FT                   KHIIVTSDNPRFEEPKMIIEDILAGINDKSNVEVLIDRKEALKKAISLANEKSVILVLG
FT                   KGDEATQIIGDKKFEFSDKDEVLKILNSKI"
FT   gene            527751..528728
FT                   /locus_tag="Abu_0523"
FT                   /note="AB0520"
FT   CDS_pept        527751..528728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0523"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="Pfam match to PF03595 C4dic_mal_tran, score 256.2,
FT                   E-value 6.3E-074"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66790"
FT                   /db_xref="GOA:A8ES66"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES66"
FT                   /protein_id="ABV66790.1"
FT                   /translation="MQEQEHIKAIPSNRLQFFPIMMFAVIMGLGGLTLVYERMTSVFFF
FT                   PISVAMAILVVTVSLFFLVLFFYILKIIRFKEEVKKEFSHPIRINFFAAFSISMLILSI
FT                   DFRVFSIEISEIFFIIGALFHIFFTYYTIKFWINNNLEIQHSNPAWFIPIVGNLIVPIA
FT                   GVGIVDNTILYFYFSIGIFFWIILFAIILNRIIFHNQFAPKFMPTLFILIAPPAIGFIS
FT                   YIKLTGSLDFFAQILFNLGIFFTILVFVMYKNFVKIKFFISWWAFTFPMAAVTLSTVLM
FT                   YELTKNDIYAIFAYVLTFITTIIVLLVAIATIKHMKKKEICIME"
FT   gene            528768..529787
FT                   /gene="tas"
FT                   /locus_tag="Abu_0524"
FT   CDS_pept        528768..529787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tas"
FT                   /locus_tag="Abu_0524"
FT                   /product="oxidoreductase Tas, aldo/keto reductase family"
FT                   /note="Pfam match to PF00248 Aldo_ket_red, score 184.6,
FT                   E-value 2.2E-052"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66791"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES67"
FT                   /protein_id="ABV66791.1"
FT                   /translation="MEFRYIGKSGLRVSSICLGTMTFGSTTDEKEAFNIMDKAYENGIN
FT                   FFDTAEIYPVPPKANTVGITENIVGKWLKTKQRDSIILATKVAGAASGWFVPPVRHGLT
FT                   AIDSFHIKKAIEGSLKRLQTDYIDLYQMHWPDTIVPIEESLKAFDELVKEGKVRYIGTS
FT                   NDSAYGLTKANETSKNKNLSRFESIQNNFSLLNPRFFDELATVCRKENISLLPYSPMAG
FT                   GVLSGKYNGNFYPQDARFTSYLNNESKRVRLMADRFVNDKTLKATAKYLELAKEYNVSP
FT                   VTLAISYSKHFDFVASTIIGARVLSQLDDSLKAFVFKIDDELLSKIEIIQKEILYPMG"
FT   gene            529857..531344
FT                   /gene="pitA"
FT                   /locus_tag="Abu_0525"
FT   CDS_pept        529857..531344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="Abu_0525"
FT                   /product="phosphate transporter family protein"
FT                   /note="Pfam match to PF01384 PHO4, score 196.2, E-value
FT                   7E-056"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66792"
FT                   /db_xref="GOA:A8ES68"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES68"
FT                   /protein_id="ABV66792.1"
FT                   /translation="MSVLWDALNNIDNFAIVLLLLSLSIALFYEMINGFHDTANAVAMI
FT                   IYTNSMKAGYSVIMAGIMNFIGVVLGGIGVAYVIVHLLPLDIMVSSNQNATLVMVFSLL
FT                   ISAVVWNLGTWYFGLPVSSSHSLIGSIVGVSIAFGMMNGFTFSQSVNWKVVYGILTALA
FT                   VSPLLGFGFAFLIMKLSRKFVKNPKFFKTPTGDKKKKPNFWMRTGIIATGAGVSFAHGS
FT                   NDGQKGIGLIMIILIGILPTYYALNMEAHQYKIMQTRDSAANLAKFYADNNDTLTKLLE
FT                   EKRLISALKIENKIAECNVNQVYNTTLEISKKLDGLKSYSELSKEDRWKIHTAVLCSDN
FT                   FFGQVERAYKLIDKDKSDYIADQRKQMITSTEYVPFWVIFAVALMLGIGTMIGYKRVVH
FT                   TIGEKIGSKPINHMQGTVSQAMAMITILLANFAHAPVSTTHIVSSAVAGTMVAEPDGGV
FT                   QKKTINTILIAWIFTLPVTAIMGAAIYVALSYITKIA"
FT   gene            531631..534174
FT                   /locus_tag="Abu_0526"
FT                   /note="AB0523"
FT   CDS_pept        531631..534174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0526"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam matches to PF00015 MCPsignal, score 149.4,
FT                   E-value 8.7E-042, and to PF00672 HAMP, score 52.8, E-value
FT                   1E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66793"
FT                   /db_xref="GOA:A8ES69"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES69"
FT                   /protein_id="ABV66793.1"
FT                   /translation="MKDLNISKKFTLINLIVTLLVLIMGYFVLNKYKNDLVDEVHNDVI
FT                   ANLKSLSEQRIKAKLEVGISNAISIANDSAIKESLANNDRELAIKTLANLSSSMKESTP
FT                   FQNIQIHLHTKDNRSFFRSWQADKFGDDLSPFRPSVVKVNAEKKAVNGFEIGKDGLSLR
FT                   AVVPIFDSNKNHIGSLEFMQGLNSVAISFDEEKRAFLLLMDLSLTVENVKDENKLDKYL
FT                   ISQKFINKDFLEDAKKIDFSKLLKEKYLITNKYFYTFNDITDFNGKKLGIALVAEPISY
FT                   VNNAIKHASNIIWVSLTILVFAVVLIMIISLLNMKNNILKPIFNLKNSIENISNNLSET
FT                   KKIEITSKDEIGDLVHSFNNYLDSIEKGLIQDQKVIEEAQIVIEKVNAGLFNDTIKQKA
FT                   NSNRVNSLISEINNMITTTQKNLLVLSDVLVGLSNARFDYNIPNIQGLTGVMASLLSGT
FT                   KVTQSSINEIMCLIEKSNIELNSSSTELAEASKKLSNSSNIQAASLEETAAAIEEISAT
FT                   VSRSTENASKMAKYAQNVTKSTNTGKELALKTATSMDEINNQVRLINEAIGVIDNIAFQ
FT                   TNILSLNAAVEAATAGEAGKGFAVVAQEVRNLASRSAEAAHEIKAIVENATIKANEGKN
FT                   ITSEMIEGYNELNENIDITIKLIEDVATASKEQQLAMTQINDTVNSLDKATQQNANLAS
FT                   TISEMANKTSQLVVHLDDTIKQTSFDRNAHKRICDTTMIIDINKLKSDHINFKNMNFSQ
FT                   AKEGFKFTVKNHHECNLGKWIDENQDKKFAKSKEWEDLKLAHKNVHNLVQEVVNLYAQK
FT                   SDNKQIFEVTKEIEENIETVFDLLNKIREINCEEE"
FT   gene            complement(534237..534638)
FT                   /locus_tag="Abu_0527"
FT                   /note="AB0524"
FT   CDS_pept        complement(534237..534638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66794"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES70"
FT                   /protein_id="ABV66794.1"
FT                   /translation="MSIFALQSIAGGFLDEDLQHFNKKFDDWCIQFNTYEEAINIAKTL
FT                   ENPENIDVVEITPLSYPKYFFPNLQGTIYVTRQIENKIICVVEPFIGSSFRIAICDLKT
FT                   KDVRLTQTHYKNIPSIESAFANFKDIILS"
FT   gene            complement(534781..536682)
FT                   /locus_tag="Abu_0528"
FT                   /note="AB0525"
FT   CDS_pept        complement(534781..536682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0528"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam match to PF00015 MCPsignal, score 161.4,
FT                   E-value 2.2E-045"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66795"
FT                   /db_xref="GOA:A8ES71"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES71"
FT                   /protein_id="ABV66795.1"
FT                   /translation="MFARMNIAQRLYSGFGIIILLIVIITIVGINRVNKIDNTLQEIVE
FT                   VNSVKQRYAMNFRGSVHDRAIAIRDVVLSENSNSDLFKISTQHISSLEKYYEESAKPMD
FT                   QIFAKKENIDNKEIEILNNIKEIEKKTLPLVKEIIKLKNENNSIQASKILLDEASPAFT
FT                   SWLKVINEFIDYQEAKNLKATPIAREIAKSFSFSMISILVISLIIGIVTAYLISSSLSK
FT                   AANEVSKGLEGFFAFVNKQTNKSTTIELYSQDEFGKMAKIINENIHQTEENLKKDEEFV
FT                   KDVSRFINELKSGNMLAKLEKDSNTPSLQELKNLLSQLQDYLEHTIARDLNNLLGVLES
FT                   YKHQDFTKRFDKPYAKVAVTINELGDVISNLLKQSLEVGITLESSSNKLIQNVNSLNSS
FT                   ATNAAASLEETASALEEITSTVINNANNVVQMSKYSNEVSSSAKKGQELARSTTNAMDD
FT                   ITKQVNAINEAIGVIDNIAFQTNILSLNAAVEAATAGEAGKGFAVVAQEVRNLATRSAE
FT                   AAREIKNIVENATSKANEGKQISNEMIKGYEELLENITKTTQMIDEISRASKEQEKGIT
FT                   QINDAVTGLDQQTQQNASIANQTREIALQTDNIAKEIVSNAMDKEFIGKDKIVRMTV"
FT   gene            536838..537200
FT                   /locus_tag="Abu_0529"
FT                   /note="AB0526"
FT   CDS_pept        536838..537200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF03061 4HBT, score 58.8, E-value
FT                   1.1E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66796"
FT                   /db_xref="GOA:A8ES72"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES72"
FT                   /protein_id="ABV66796.1"
FT                   /translation="MDLRVYYEYTDFGGVVYHSNYLNFCERARSELFFQKGLSPHNNDE
FT                   FFVVRSATIDWIKPAVFGDLLEVKTKLIEKKSASIVMYQEILRNDEVIFKATFKLAFLK
FT                   NFKPAKIPLEIFEILE"
FT   gene            537210..537680
FT                   /locus_tag="Abu_0530"
FT                   /note="AB0527"
FT   CDS_pept        537210..537680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66797"
FT                   /db_xref="GOA:A8ES73"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES73"
FT                   /protein_id="ABV66797.1"
FT                   /translation="MLKIILISFLFVINLYSSEVYLLPKQSDDAESKISELIQEANSEI
FT                   FIAMYNFSYKKFADDLIEASKHGVRITVLFDQKKTKKDDEILDLLRENGIKTVVNKDKN
FT                   KMHLKVVLIDSKTAIIGSTNWTKESFEENYDLIYITDDKKLILKLKEFVSKI"
FT   gene            537720..538940
FT                   /locus_tag="Abu_0531"
FT                   /note="AB0528"
FT   CDS_pept        537720..538940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0531"
FT                   /product="peptidase, M48 family"
FT                   /note="Pfam match to PF01435 Peptidase_M48, score 164,
FT                   E-value 1.4E-048"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66798"
FT                   /db_xref="GOA:A8ES74"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES74"
FT                   /protein_id="ABV66798.1"
FT                   /translation="MLEIFVIAFCIYFAFNIYTSFMQIGFIKEARNLKAIILDSNKYLE
FT                   AADYAIEKEKLALASTFYDFVLFILWIGFGLSYLDSLVQIDSYWLKAIVFVDLFIIINW
FT                   ILTLPFELYSTFKLNKKYEFSNITPALFIKDTIKTGVLFLVFGSLVIAGISFIINNFPS
FT                   WWIFGFVFIFAVIILINMLYPVIRDKMFDKFEKLKDKELEEKIEKLLDEVGFKSSGVFS
FT                   VDASKRDNRLNAYFGGLGSTKRVVLFDTLVEKLTHNELLAVLGHELGHFKNGDILKNIG
FT                   IMGFVMFVFFAIFGNLSDELFLGLNLQNEPYAIITVFLIFSPILSFFLMPLISLISRHN
FT                   EYAADSFGSNLATKEDLVTALLKLANENKSFPLSHPLYIFFYYSHPPLIERFKELGYDV
FT                   HTKEFKK"
FT   gene            538937..540136
FT                   /locus_tag="Abu_0532"
FT                   /note="AB0529"
FT   CDS_pept        538937..540136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0532"
FT                   /product="DNA recombination protein RmuC-like protein"
FT                   /note="Pfam match to PF02646 RmuC, score 408.3, E-value
FT                   1E-119"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66799"
FT                   /db_xref="GOA:A8ES75"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES75"
FT                   /protein_id="ABV66799.1"
FT                   /translation="MITIDYLVLIAIFLIIFVIFFAIIFTLKQKYQNIINSYLLKISTL
FT                   EELSKVEKENLKEKINFLENNKQQMKLEFENLANKLFDEKEKKSTTNLTFVLSSFKEQL
FT                   DSFSKRVNDIYNDETKQRSSLLTEIKNLKELNNQISNDAINLTKALKGQNKTQGDWGEM
FT                   ILSSILDQTGLREGKEYTIQGSFTSAEGKRLRPDVIVHLPSNKDIVIDSKVSLNAYINY
FT                   SKAENEDEKQQASKELVKSITSHIKDLSSKSYENIDGVRTLDFVLMFIPIEGAFLLATS
FT                   SDDNLFKLAFDNNIMLVSPSTLYVTLRTIENIWRNEHQNENAQLISKKAADLYDKFVAF
FT                   VGDIEDIGTNITRTQKAYDGAMNKLSSGNGNLIRRTEEFLELGVKPKKQLPNRYLSVEE
FT                   "
FT   gene            complement(540149..541048)
FT                   /locus_tag="Abu_0533"
FT                   /note="AB0530"
FT   CDS_pept        complement(540149..541048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0533"
FT                   /product="integral membrane domain protein (DUF6 domain
FT                   protein)"
FT                   /note="Pfam match to PF00892 DUF6, score 62.3, E-value
FT                   1.5E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66800"
FT                   /db_xref="GOA:A8ES76"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES76"
FT                   /protein_id="ABV66800.1"
FT                   /translation="MNKNIFYILIVLAMISWGTSWISTKVLTNYINAYELVFLRMGICF
FT                   VTMIPIIYFLKLSFKVNLKSFILILIASLLLVLYSISMFWGVEHGTGSFGGALVPTLIP
FT                   INTFILLAIINKKTISLKHSFALVLGAFGVLNMLNVWNFNLNEILSKDNVYFILASLLW
FT                   AILTIVTAKATKVNAFVFTFYTYIISTFVLYIFYIDNSLFERVYDYDFIFWFNIFVITI
FT                   LSTTFGTSIYFIGATKLGTKEVSSFVFLVPASAMATGSIFLGEKITLNMIIGTIFAIIA
FT                   IYILNNLNLFQIFKKQKS"
FT   gene            complement(541048..542268)
FT                   /gene="moeA2"
FT                   /locus_tag="Abu_0534"
FT   CDS_pept        complement(541048..542268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA2"
FT                   /locus_tag="Abu_0534"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="Pfam matches to PF03453 MoeA_N, score 166.3, E-value
FT                   7.3E-047, and to PF00994 MoCF_biosynth, score 143.5,
FT                   E-value 1.7E-041"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66801"
FT                   /db_xref="GOA:A8ES77"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES77"
FT                   /protein_id="ABV66801.1"
FT                   /translation="MRNFISYEKSLEILNNIKLNKGVTQKLFIIDAIGKVLAKDIIANH
FT                   NSPEFPTSGMDGYAIKYEDINSDFLEIIDKNPAGFVVSSEVSKGKCIKTFTGSLMPKGS
FT                   NTLVPIENVQVIDNKIKITQEVPFSFAVRNVGENYKKDEVLIKEGTIIGFAEIGVLSSL
FT                   NISLVEVFVNPTIAVASTGSEILELGETQTNDSQIRSSNHLTLEALFKSAGANVLQMGT
FT                   IKDDIQTITNFFENALQKADIVVTTGGVSVGDYDFVQDVVKDRLKAEVLFHGVSIKPGM
FT                   HILVALKDGKIIVALPGFAYSSTVCAILYVLPLIYRLKNSNEKLPIVKAKISCDFPKKM
FT                   KKTIFAACNVSYENGEYIINFEGKKSGTSAILTNMLENPALLIQNEDSCDIKNGDLVDI
FT                   LLLNNLK"
FT   gene            complement(542279..542476)
FT                   /locus_tag="Abu_0535"
FT                   /note="AB0532"
FT   CDS_pept        complement(542279..542476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66802"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES78"
FT                   /protein_id="ABV66802.1"
FT                   /translation="MTIEEQEIFFNKIKETILPLAINMQDEQIKKIIQTVEETNENLPT
FT                   GFSAFLFEQIIIHKYNRTIK"
FT   gene            542584..543369
FT                   /locus_tag="Abu_0536"
FT                   /note="AB0533"
FT   CDS_pept        542584..543369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF01171 ATP_bind_3, score 49, E-value
FT                   1.5E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66803"
FT                   /db_xref="GOA:A8ES79"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES79"
FT                   /protein_id="ABV66803.1"
FT                   /translation="MVELSKKISTIVGRTNAEYGLIKEGDKVLVGFSGGKDSLTLIHSL
FT                   NRLKKVVPYNFEFKAVTVTYGMGEQVEFLSNHCKEHGIEHEIINTEIFELAGEKIRKNS
FT                   SFCSFFSRMRRGYLYSTALEQGYNKVALGHHLDDAMESFFMNFFYNGTMRTMPPIYKAE
FT                   NGLEVIRPLIFCRERQLRAFANTNEIRVIGDEACPGLRFDVKMPHARATTKELLAKLEE
FT                   ENPKIFVSMKAAFSNIQLPTFFYKDLKDIKLNLQEDENI"
FT   gene            543366..543866
FT                   /locus_tag="Abu_0537"
FT                   /note="AB0534"
FT   CDS_pept        543366..543866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0537"
FT                   /product="conserved hypothetical protein (DUF523 domain
FT                   protein)"
FT                   /note="Pfam match to PF04463 DUF523, score 164.4, E-value
FT                   2.7E-046"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66804"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES80"
FT                   /protein_id="ABV66804.1"
FT                   /translation="MKILVSSCLLGEDVRYDGLNSSVAFNPKFPFSLKELFMDILCENE
FT                   IYSFCPEVAGGLGIPRNPAEIVKNEKPFKILDNEQNDVTINFLLGAKKALDTCKNENIL
FT                   VALLKSKSPSCSNKEIYDGTFSNNLVQGQGLTARLLEENGIKVFNENELKELAKFIKKN
FT                   KSL"
FT   gene            complement(543869..544108)
FT                   /locus_tag="Abu_0538"
FT                   /note="AB0535"
FT   CDS_pept        complement(543869..544108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66805"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES81"
FT                   /protein_id="ABV66805.1"
FT                   /translation="MTINNNLNAMVASELQFQDMATNLATVANTVAEPEFQEVTSDLID
FT                   SIAGQIPQIISYSANAQNIELQGEMLNTLLNIKA"
FT   gene            complement(544092..544589)
FT                   /locus_tag="Abu_0539"
FT                   /note="AB0536"
FT   CDS_pept        complement(544092..544589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66806"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES82"
FT                   /protein_id="ABV66806.1"
FT                   /translation="MEISDNVLNTSSIYQELALKKSELSNLDKKELQKSSFEKNDEVVL
FT                   GENYDENDYQRVLNKFKNKDSEVKTHEQTHASGATTTSAINYNYQVGPDGKLYAIGGSV
FT                   RFDTSIPKDPQSAKVKMDQLQSASSSVSSLSGADASIAQTASLNKMLLESIKEGFNYDN
FT                   QQ"
FT   gene            544832..545629
FT                   /gene="rpsB"
FT                   /locus_tag="Abu_0540"
FT   CDS_pept        544832..545629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="Abu_0540"
FT                   /product="30S ribosomal protein S2"
FT                   /note="Pfam match to PF00318 Ribosomal_S2, score 343.1,
FT                   E-value 4.3E-100"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66807"
FT                   /db_xref="GOA:A8ES83"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES83"
FT                   /protein_id="ABV66807.1"
FT                   /translation="MVTMKDLLECGVHFGHQTRRWNPKMKKFIFGVRKNIYIIDLQKTL
FT                   RYFRYTYNVVRDRAAEGQTMIFVGTKKQASETIKKAAISCGMPYVNHRWLGGMLTNFGT
FT                   IKKSIRKLEIIKKMREEGQLDLLTKKEALMLTRKEEKLELYLGGIKEMNKLPDMMFVLD
FT                   AVKEKIAIQEARRLGITVVAPLDTNCDPDVVDLPIPGNDDAIRSIHLFCNEMAAAMNEG
FT                   KAALADETGVEVEPISAEEKEELIAEAVAEGEEFNFAEEGENA"
FT   gene            545629..546675
FT                   /gene="tsf"
FT                   /locus_tag="Abu_0541"
FT   CDS_pept        545629..546675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="Abu_0541"
FT                   /product="translation elongation factor EF-Ts"
FT                   /note="Pfam matches to PF00889 EF_TS, score 150.5, E-value
FT                   3.9E-042, and to PF00627 UBA, score 53.9, E-value 4.9E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66808"
FT                   /db_xref="GOA:A8ES84"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ES84"
FT                   /protein_id="ABV66808.1"
FT                   /translation="MAGVTPQLIKELREMTGAGMMDCKNALNETNGDLDKAVQALREAG
FT                   LGKAAKKAGNVAAEGLISVLVNSDNTKAVLLELNSQTDFVAKNENFVNLTKEITTHALN
FT                   NGIADAQTLASSKINGEEFQTYLNEKIATIGENLVARKLSLVSGQVVNGYVHATGRVGV
FT                   VLAATCNDAVKDKAAALLRNIAMHASAMKPTVISYKDLDPAFVESENKAIRAEIEAEND
FT                   ELRRLGKPQKRIPEFVSKSQLTDEAIAAAKARFEDELKAQGKPEKIWANIIPGQIERFI
FT                   ADNTQLDGRFALLSQPYVMDDKKTVEQAIAEVDSSIVITEYIRFELGEGIEKKEEDFAA
FT                   EVAKQMGK"
FT   gene            546721..547401
FT                   /locus_tag="Abu_0542"
FT                   /note="AB0539"
FT   CDS_pept        546721..547401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0542"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Pfam match to PF00005 ABC_tran, score 166.6, E-value
FT                   5.9E-047"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66809"
FT                   /db_xref="GOA:A8ES85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES85"
FT                   /protein_id="ABV66809.1"
FT                   /translation="MSELENKNGLIGSLLLEAKNLSHKFDYELFKNINLSLQKQESIAI
FT                   IGTSGSGKSTLLNILSSLLKPTSGNVVFQRKDIYSLSQNDLLKIRRDDFGIIFQAHYLF
FT                   RGFSANENLEIAEFLSGEKIDKNLLKELNIEHVINQGVGELSGGQQQRLSIARVLTKKP
FT                   KIIFADEPTGNLDKDTANVVMNTLFNYIKKNNAGLILVTHENELALRCDKVYKLDNLEL
FT                   KDMR"
FT   gene            547398..548219
FT                   /locus_tag="Abu_0543"
FT                   /note="AB0540"
FT   CDS_pept        547398..548219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES86"
FT                   /protein_id="ABV66810.1"
FT                   /translation="MNLLLVCETPIIEHIFTLVCKKMKIDLTIQKNNKVNKNYDLIVID
FT                   QNFVDSKFNKIKNFCKRIGAISSEELPMERLRDFIIPRPFLPTKLETLLIEQITYIKED
FT                   LTQKEPYKEEVFEYAPEDDIDILPVIDYLEEGLNENIPKSPEKIVQNEYEEDDESIVSL
FT                   SKLNAGGVLDSSELNKINDILHEDEIYNGITLEKRDWKDISSIIDDALEEVKEYEFDLK
FT                   NEPMKTYNLVLSKYGIDELRPLLEKFDQTIIDKIASGQTIDLRVSLRDTNR"
FT   gene            548216..548833
FT                   /gene="gmk"
FT                   /locus_tag="Abu_0544"
FT   CDS_pept        548216..548833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="Abu_0544"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Pfam match to PF00625 Guanylate_kin, score 151.2,
FT                   E-value 2.5E-042"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66811"
FT                   /db_xref="GOA:A8ES87"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES87"
FT                   /protein_id="ABV66811.1"
FT                   /translation="MNDKKGAILIISGPSGCGKSTLLKEVYKNISDYYFSISTTTREPR
FT                   VGEVNGVDYFFVSKEEFEEDIKNGNFLEYAKVHDNYYGTSLKPIINALNEGKLVIFDID
FT                   VQGHHLVRKKMNDSVTSVFITTPSLKVLEERLNNRNSDSLEVIEKRVKNAKKEIEFFDE
FT                   YDYFIVNDNLESASNELVSIANIARAKAKLFDKEKIVSNWLN"
FT   gene            complement(548834..550459)
FT                   /locus_tag="Abu_0545"
FT                   /note="AB0542"
FT   CDS_pept        complement(548834..550459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0545"
FT                   /product="EAL/GGDEF domain protein"
FT                   /note="Pfam matches to PF00563 EAL, score 162.7, E-value
FT                   8.4E-046, and to PF00072 Response_reg, score 97.6, E-value
FT                   1.9E-029, and to PF00990 GGDEF, score -14, E-value
FT                   5.2E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66812"
FT                   /db_xref="GOA:A8ES88"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES88"
FT                   /protein_id="ABV66812.1"
FT                   /translation="MINNISILKNMSILYVEDEKDLREVTHEILKSFTKNQYIAENGQE
FT                   GLELFKKYEKNIDLIVTDINMPILNGLEMAKEIKNINPNIPIIITTAFSNKEYLLESID
FT                   IGIDKYVLKPIDIAKLLQAMSQSIIYYELKELFVDKLTNLPNRNRLKKDLNQTDDVLMA
FT                   FFDIDGFLTLNDLFGEEIGDGILVELSYKLKEHFPANEYSVYKLDVDKFVVVAVNSGKS
FT                   VEEFYKYTKSFISKIENQSFLVNENEIDINLTVGVSHANGALAYKYAQRTITYARTKLR
FT                   KIMIYNDSFNIHQSFENNIKWLKQLKNGFKENKFQAYFQPIVDTQTKEIYKYEALIRYI
FT                   DENGNEVGPYNFLDIAKKTKQYPNIIKVILKDALKLIKEKNKKVSINISYADISNKNTT
FT                   KYIYDFLTAQSIEHTKLLSFEILESEEIVDFEEVSRFISEVKKFECIVGIDDFGAGYSN
FT                   FHLLSKLKISFIKIDGSLIQNIHNSKDLEIIVRTISNIAKEFNVKTVAEFVANEEIYNK
FT                   VKELNIDYSQGFYFDKPISYDCIK"
FT   gene            550556..552994
FT                   /locus_tag="Abu_0546"
FT                   /note="AB0543"
FT   CDS_pept        550556..552994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0546"
FT                   /product="cation-transporting ATPase, P-type"
FT                   /EC_number="3.6.3.4"
FT                   /note="Pfam matches to PF00122 E1-E2_ATPase, score 235.2,
FT                   E-value 4.2E-071, and to PF00702 Hydrolase, score 89.6,
FT                   E-value 3.3E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66813"
FT                   /db_xref="GOA:A8ES89"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES89"
FT                   /protein_id="ABV66813.1"
FT                   /translation="MSKIKCNHCHLEFDKNIMIKDNDLNFCCKGCQGVYHLLKSDGLES
FT                   FYEKLGNKTIAPPIEVFNDDITKFDSLNFYDNYVSKTKEGFNQIDLIIEGIHCAACVWL
FT                   NEKILFDTKGIVEANINFTTNKARIIWDDDILKLSQIILKIRSIGYNAYAYDSSVADIA
FT                   ASKAKQDYFVRIMVAVVCTMNIMMLSVAKYTGFFTGITPEVMQMIHLGEFILSTPVLFY
FT                   SGWVFYKGAYYGLKNKMVTMDLAVSTGATLSYIYSLTILLGAKGDSYFDSVAMIITFVL
FT                   VGKYLEVIGKKSAVDTLDKIKSTLPLEAVIINGNEKKVVALNSVNIGDIVEIKAGDKVP
FT                   VDGKVISGNGSFDESTITGESIPVYKKVGDAVFSGTINLDSLIHFEVTKNFKNSTFSSI
FT                   VSLLEDSLNSKPSIQIKANKISRGFSATILSLAFATFLVWYFFGLDLGFIYEGTNQFER
FT                   SFIVAVSVIVIACPCALALATPMASLVGISELAKKGLLFKEAKFIETLAVASSVVFDKT
FT                   GTLTKGELNVVKARILDDNIHKLNLLYSLIDSSTHPVSLSIKRYLEKNYNLELKKLENV
FT                   KNIEAKGMSATYKNVDEKEFEILGGNVELLREFGIYYKFDSSRTVYLFAINKRVIATFE
FT                   LEDEIKDGSKELINYLQNKNIEVIMLTGDNEQVASRIAKELGIKKYLSHQTPVSKADFI
FT                   KELKKQNKVVVMVGDGVNDSVALSSSDVAIAMGNSADISLAVSDVVLLNSTLKSLKEAF
FT                   LISNKTYKHIKQNLGFSLLYNATTVPLAMAGFVIPLIAALSMSLSSLIVVLNSLRIKMK
FT                   "
FT   gene            553011..553238
FT                   /locus_tag="Abu_0547"
FT                   /note="AB0544"
FT   CDS_pept        553011..553238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0547"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF03597 CcoS, score 38.6, E-value
FT                   1.9E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66814"
FT                   /db_xref="GOA:A8ES90"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES90"
FT                   /protein_id="ABV66814.1"
FT                   /translation="MINDTLLFMLIVGIIISAGLLLLFVWAAKTGQFDDADRMLNNPLY
FT                   DSVDDLNDAIRKEQKIKEEKEAKEEKQKKE"
FT   gene            complement(553268..553558)
FT                   /locus_tag="Abu_0548"
FT                   /note="AB0545"
FT   CDS_pept        complement(553268..553558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0548"
FT                   /product="conserved hypothetical protein, possible
FT                   cytochrome c-553"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66815"
FT                   /db_xref="GOA:A8ES91"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES91"
FT                   /protein_id="ABV66815.1"
FT                   /translation="MKKIVLTTLAVAAFAFADAPAAYATCKACHGAKGEINITTKSASH
FT                   VPANLTKAEIEKALHGYKDGTYGGPMKALMKGQVAKLSDADIKALADYMGK"
FT   gene            553758..554360
FT                   /locus_tag="Abu_0549"
FT                   /note="AB0546"
FT   CDS_pept        553758..554360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0549"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Pfam match to PF00005 ABC_tran, score 156.8, E-value
FT                   5E-044"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66816"
FT                   /db_xref="GOA:A8ES92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES92"
FT                   /protein_id="ABV66816.1"
FT                   /translation="MDKDLVLDINDLTFYYKKENPIYKDFSLKLQKGQLVTIFGKSGSG
FT                   KTTLFELIIGSLKPIKGTIDKLDVSMIFQDPFNSFHPTYKIIEQIKDVVQRDFTTELDS
FT                   LLKKLNLSKDILDKYSYQLSGGQLQRCSILRAILMKPKLLLIDEPTSALDNIIAYDVMK
FT                   LLITFLEDSAILLVTHDLDMAKWCSDKIIRLETDARK"
FT   gene            554347..555276
FT                   /gene="hemH"
FT                   /locus_tag="Abu_0550"
FT   CDS_pept        554347..555276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="Abu_0550"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="Pfam match to PF00762 Ferrochelatase, score 319.6,
FT                   E-value 5E-093"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66817"
FT                   /db_xref="GOA:A8ES93"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES93"
FT                   /protein_id="ABV66817.1"
FT                   /translation="MQENKKALVLLNMGGARDKSELKMFLTNMFNDENILTIKNAFIRK
FT                   MVASFITNSRLESAWKNYEKIGNHSPINPLTEQLVNKCNDKIENYKTYQVMRYTPPFAK
FT                   EIISQMKKDGIKEVLLLPLYPQYSTTTTKSSLEDFIKFAKNSFNISSIETFYKNDKFNE
FT                   CIVNEILNNVEDETSYNLVFSAHGLPQKIVNAGDPYEKQMNEHVKILSEELQKRGKNFK
FT                   SINLAYQSKVGPLKWLEPSLENMLKNFKNENVIIYPLSFIVDNSETVFELDIEYKEIAH
FT                   EIGIKEYKVCSCVNDSDEFIEAIKDIIK"
FT   gene            complement(555304..557412)
FT                   /gene="feoB1"
FT                   /locus_tag="Abu_0551"
FT   CDS_pept        complement(555304..557412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB1"
FT                   /locus_tag="Abu_0551"
FT                   /product="ferrous iron transport protein B"
FT                   /note="Pfam matches to PF02421 FeoB_N, score 137.3, E-value
FT                   3.8E-038, and to PF01926 MMR_HSR1, score 121, E-value
FT                   3.1E-033, and to PF07664 FeoB_C, score 70.2, E-value
FT                   6.1E-018, and to PF07670 Gate, score 69.8, E-value
FT                   7.8E-018"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66818"
FT                   /db_xref="GOA:A8ES94"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES94"
FT                   /protein_id="ABV66818.1"
FT                   /translation="MKNNVIKIALVGQPNVGKSMLINSISGAKLKVGNFPGVTVSKEEV
FT                   FFKYKDYEFQIIDLPGSYSLNNYSIEEKITKDFLYNSTYDLILNVVDSTNLQRNLLLTT
FT                   ELLLLNKKMIIALNMIDEANDELIEINDAELGSILGRPCVKTSASKKIGIQTLLEEIIN
FT                   QYESEKTLSKLIFSNPIETEIKSITQIFEDFNFETDLTYREVAIKLLQEDKKTFELLHS
FT                   QPIWLKLQDTLNNSFEHLYLHYQTKNIDDIFNDEKFAFVKGVITKTVHQKNKKDTTLTE
FT                   KIDSLLIHKFFGLPIFFLLMWALFQLTFVLGNIPMDIIDSFFAQLIDQTKEILGDNQIS
FT                   SIIGDGIIAGVGAVVLFLPNIIILFFGIALLETTGYMSRVAYLLDGFFHKFGLHGKSFI
FT                   PLITGFGCSVPAYMAARTLKNERDRLLTLFIIGFMSCGARLPIYVLFIGAFFSQYNEGN
FT                   VLFLIYICGAFIGLISAKVLKVVVFKGEEEPFVMEIPKYRLPSLKLIWFTVYNQAMMYL
FT                   KKAGTFILAASILIWVASNYPKHEDVEEMYQQKIELATTDEEKTNLENELSLYNLENSY
FT                   LGYVGKFSEPLFRPLGFDWKMSVALETGLAAKEVVVSTLSILYGLGDEADETSSTLIEK
FT                   IRNNIPFASAISFIVFVMIYLPCLAATMVFVREAGKWKYLLYLFVFTTTTAWILSFIAY
FT                   NVTSFFVS"
FT   gene            complement(557402..557629)
FT                   /locus_tag="Abu_0552"
FT                   /note="AB0549"
FT   CDS_pept        complement(557402..557629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0552"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF04023 FeoA, score 61, E-value
FT                   3.6E-015"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66819"
FT                   /db_xref="GOA:A8ES95"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES95"
FT                   /protein_id="ABV66819.1"
FT                   /translation="MSLNDLELEQIAKIKNINCNNILKNRLYSLGITKGALIKVEKKTL
FT                   TNSTLKININDSKIAIRANEASQIEVEYEK"
FT   gene            557827..558573
FT                   /locus_tag="Abu_0553"
FT                   /note="AB0550"
FT   CDS_pept        557827..558573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0553"
FT                   /product="conserved hypothetical protein (DUF218 domain
FT                   protein)"
FT                   /note="Pfam match to PF02698 DUF218, score 119, E-value
FT                   1.2E-032"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66820"
FT                   /db_xref="GOA:A8ES96"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES96"
FT                   /protein_id="ABV66820.1"
FT                   /translation="MFLLKKIISAFLLPVPIGIILLFLALFFLLKNSYKKAKIFLVLGF
FT                   LWFALLSNQTISNMIISPLENAYPALKETPKDIKYILVLGNGHKTNDNFPITSELNTTA
FT                   INRLIEGIRHYKNLENSKLIVSGYSFDDVNSHAQMQKKLAISLGVNEADIITLDTPKDT
FT                   KEEAIEAKKIVGNQKLILVTTASHMKRAVMLFEKEDLNIIASPTNHKFFTSTYPTSYFN
FT                   ATNIKKVELAFHEYLGMVYSYVKGEI"
FT   gene            558630..559370
FT                   /locus_tag="Abu_0554"
FT                   /note="AB0551"
FT   CDS_pept        558630..559370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0554"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Pfam match to PF00005 ABC_tran, score 181.4, E-value
FT                   2E-051"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66821"
FT                   /db_xref="GOA:A8ES97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES97"
FT                   /protein_id="ABV66821.1"
FT                   /translation="MELINISNLSFKYQKTNVLENINLSIKSDDFLAIIGPNGGGKSTL
FT                   LKLILGLLEPQSGTIIKNIKTSQMGYVPQNTNLNMDFPITALEIVLMGHTTSKRKIFGY
FT                   SKEDIACAKLSLEQVGMSAYANSKIGDLSGGQRQRVFIARALCSNPKIMLLDEPTASID
FT                   VKGQQEIYDLLQELNKQICVVVVSHDISVLLNYAKNVAHINKNIVYHSLENIQKNLTTQ
FT                   NEHLCEVELLSALGKTQICCNHTH"
FT   gene            559384..560184
FT                   /locus_tag="Abu_0555"
FT                   /note="AB0552"
FT   CDS_pept        559384..560184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0555"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Pfam match to PF00950 ABC-3, score 272, E-value
FT                   1.1E-078"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66822"
FT                   /db_xref="GOA:A8ES98"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES98"
FT                   /protein_id="ABV66822.1"
FT                   /translation="MFEILQYDFIQNALISGILISIAAGIIGSLVVVNKVTFLTGGIAH
FT                   SSYGGIGLAIYLGIPVLLGATIFAVITAILIAFITLKNRTRIDAIIGMMWASGMAIGII
FT                   FVDLTPGYNVDLMSYLFGSIIAVSHQDIIYMTLLDVFIIAIVVFFYKQILAVSYDSEFA
FT                   SLRGINVEFFYTLILILSALCVVAAIKAVGLILVIALLTIPTYLAETFASRLSNMMIIS
FT                   AILATIFTIIGLVVSYLYDISSGASIIMVAVVILGVVKLLKLKK"
FT   gene            560208..561032
FT                   /locus_tag="Abu_0556"
FT                   /note="AB0553"
FT   CDS_pept        560208..561032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66823"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:A8ES99"
FT                   /protein_id="ABV66823.1"
FT                   /translation="MNEKIEIGKINTLKVNRVSEPGIYLISGDETEVLLPNAYVEKSML
FT                   VDSLLDVFIYTDSEDRLVATTLKPYLYLHEFAFLKVVDTAKFGAFVDIGLPKDILVPKN
FT                   RQKSSFFVGSYKVLQLQLDEKTNRLIASEKYDLLKKIRNLEKNDEVEIILYSKTPLGYK
FT                   VIVNNRYEGMIFHSEVFENLKIGDKKRAYVKNVREDNKLDISLQKIGQKIVDDKVFEVL
FT                   EKNDGKLNFTYKSEAEDIKEVFGISKKSFKASLTKLLSENKIILEENCIRIK"
FT   gene            561113..561652
FT                   /gene="tpx"
FT                   /locus_tag="Abu_0557"
FT   CDS_pept        561113..561652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="Abu_0557"
FT                   /product="thiol peroxidase"
FT                   /EC_number="1.11.1.-"
FT                   /note="Pfam match to PF08534 Redoxin, score 141.3, E-value
FT                   2.4E-039"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66824"
FT                   /db_xref="GOA:A8ESA0"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA0"
FT                   /protein_id="ABV66824.1"
FT                   /translation="MATVKFKGELEVTLNGTELNVGDIAPVVTVVGQDLSDITIGGQNG
FT                   KAQVIVVVPSLDTGVCATETRRFNSEAAKIENAEVIVVSMDLPFAMKRFCTTEGIENLK
FT                   VGSDFRAKAFAKSYGVLQANGPLAGLTARAVFIINASGKIVYKQIVPEITAEPDYEAVL
FT                   EAAKGATSTSCCGSCH"
FT   gene            561764..562492
FT                   /locus_tag="Abu_0558"
FT                   /note="AB0555"
FT   CDS_pept        561764..562492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0558"
FT                   /product="conserved hypothetical secreted protein"
FT                   /EC_number="3.5.2.6"
FT                   /note="Pfam match to PF08238 Sel1, score 43, E-value
FT                   9.1E-010"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66825"
FT                   /db_xref="GOA:A8ESA1"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040239"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA1"
FT                   /protein_id="ABV66825.1"
FT                   /translation="MFKNLFKTMLLLSLGFLTLNASVVNDGFEELEKGNVLEAANIFQN
FT                   SCNEGASSGCYNLGLMYYKGDKIAKNYPKAVQLFSKACDLGHTNACYNLAYMYENAQEV
FT                   KDSFKAVELYEKLCNQGISAACYNLGTMYETGDGVERHTFKAVEFLTKACDLNHAKACY
FT                   NLAVKYQNEDGVEKAPLKAANLYIKSCDLGNASACYNLGIMYSDGKFFAKNSANAKEYF
FT                   RRACDMNFDEACKAYNNLNK"
FT   gene            complement(562512..563489)
FT                   /locus_tag="Abu_0559"
FT                   /note="AB0556"
FT   CDS_pept        complement(562512..563489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0559"
FT                   /product="putative efflux protein, bile acid:sodium
FT                   symporter family"
FT                   /note="Pfam match to PF01758 SBF, score 23, E-value
FT                   2.5E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66826"
FT                   /db_xref="GOA:A8ESA2"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA2"
FT                   /protein_id="ABV66826.1"
FT                   /translation="MNFSKIKELLENQQIIIYFIAISISILITFFIPNTSYFETAINPA
FT                   LALMLFVTFLQVPISELTSVFKNIKFIFALLFSNFIIIPIIVFSLIQFLPDNPLLKLGV
FT                   LFVLLTPCIDYVVTFSHLGKANAKLLLSSTPILLIVQMSLLPIYLNIFLGKEASLLVEI
FT                   SPFIEAFIFLILIPFSLATIFQIWSKKSNFGEKIVDVFNILPVPSTALVLFIVILAVVP
FT                   RLSLAINDILYVIPIYVAFAIIAPMVGLSVGKLFKLKKEEKVSIAFSSSTRNSLVILPL
FT                   ALAVPNALPLLPAVIVTQTFIELIAEIIYIRIFTKLDKKAISTK"
FT   gene            563572..564762
FT                   /locus_tag="Abu_0560"
FT                   /note="AB0558"
FT   CDS_pept        563572..564762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66827"
FT                   /db_xref="GOA:A8ESA3"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA3"
FT                   /protein_id="ABV66827.1"
FT                   /translation="MFSWYKKFTSQPHQPFFVNGVLFFALFMMLFILIYSNLLNVQAPL
FT                   LVYHAYSLVFVVFIQFFLGFLFVVFPKFLMQSEIASKDYMRLFYIYFISSLGIFLSLIF
FT                   YSKITIVFQVLLLIAQILSFNLLYNIHKKSVIKVKEDTKWVLISFFVGLISHFVFLVSN
FT                   LDFINSYFFSKLSINSGFYLFLFMIIFTIAQRMIPFFTTAKAPNYVINKSPKIVQTIFL
FT                   LLILKVFLLSFENAKLNLIADIPLLYVITKELIRWKLPLFKVPSIVWVLYLGLYWIVVA
FT                   FFISIIESVFAFIAPNFYFEKAVIHTLALGYFVTLLLGFGTRVILGHSGKVIIANKFAT
FT                   FIFIVMQFVVLLRIFSSISTNFGFDYVFFINLTVFLLLILLFLWSSRYVTILIEGK"
FT   gene            565013..565939
FT                   /locus_tag="Abu_0561"
FT                   /note="AB0559"
FT   CDS_pept        565013..565939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0561"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /note="Pfam match to PF00174 Oxidored_molyb, score 208.9,
FT                   E-value 1.1E-059"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66828"
FT                   /db_xref="GOA:A8ESA4"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA4"
FT                   /protein_id="ABV66828.1"
FT                   /translation="MKMIRKKSWQINENLVTPQEFFEKRRSFIKLGAASLVSSGMILEL
FT                   LANEKDSLPPLKLNSFEQITSHNNFYEFTTNQSAVKDMAHTLKTKNWKVTIDGLVEKTM
FT                   EIDLDDLKKMFDIEERIYRFRCVEGWSMVVPWNGFALSSLIKKVKPLSSAKYLRFETLV
FT                   DKDSFPDQNRGVFSTLDYPYVEGLRMDEAMNDLSFLATGLYGQNLPKQNGAPIRLVVPW
FT                   KYGFKSIKSIVRISFVEKEPLNTWQIQNPKEYGFYANVNPNVDHPRWSQKKERVLGSFL
FT                   KQNTLMFNGYENEVASLYKNMDLTKYF"
FT   gene            565939..566505
FT                   /locus_tag="Abu_0562"
FT                   /note="AB0560"
FT   CDS_pept        565939..566505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0562"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Pfam match to PF01794 Ferric_reduct, score 50.3,
FT                   E-value 2E-013"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66829"
FT                   /db_xref="GOA:A8ESA5"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA5"
FT                   /protein_id="ABV66829.1"
FT                   /translation="MARFFIYLLSLAPLVYLNISLFIFDNVNDPIKYIYTITGATATLI
FT                   LFLTISISLIRDRINLIKYRKEVGLLGFFYALLHLLNFVVLDASFDLDFIIKETIEKPF
FT                   IYLGMIAFFIVLFMSITSTKQLFRKYNKYHKLIYLALILITIHWIMAQKSVNIPQYIYI
FT                   LIIIFIGFSKLFQQVIKNIKINSLS"
FT   gene            566755..568800
FT                   /gene="rep"
FT                   /locus_tag="Abu_0563"
FT   CDS_pept        566755..568800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="Abu_0563"
FT                   /product="ATP-dependent DNA helicase, UvrD/Rep family"
FT                   /EC_number="3.6.1.-"
FT                   /note="Pfam match to PF00580 UvrD-helicase, score 311.6,
FT                   E-value 1.3E-090"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66830"
FT                   /db_xref="GOA:A8ESA6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA6"
FT                   /protein_id="ABV66830.1"
FT                   /translation="MPLSNLNQEQLQAATCHQGFNLIIASAGTGKTSTIVGRIAYLLNS
FT                   GINPKEILLLTFTNKAAAEMINRVAKFFGKDIAKEIMAGTFHSVSYKLLKELNVNITLK
FT                   QPNELKTLFKSIYEKRVFFDRSDEVSPYDGGYLYDMYSLYLNSNDGEDFASWIVSKNSS
FT                   HEIYTLIYEDVVDEFNELKTKYGYVNFDDLLTTMLKILKEKDFDFKEILVDEYQDTNPL
FT                   QGRLLDSFRPKSLFCVGDYDQSIYAFNGSDIGIISTFSTRYKDANVFTLRKNYRSTKPI
FT                   LDLATKVIEFNERVYEKKLEVVRKEDIYKPKLLAFNELFSQYEYISELISKSQTPHSEI
FT                   AIIYRNNSSADGIEANLREFGIAAKRKGGMSFFDSVEVKFILDILVMQVSHNDMMAFIH
FT                   IVEHGKGIGKAIAKDIFDALIKLGDGDIIRGLFQPRIDISNPYETKVKNQQLGLFDDFI
FT                   ELGSISKFKDCNFEETFLSNPILKHPKLSVDGGKYLYDIYLLLKHLRRTKIPETLVASI
FT                   SSSMAYSKLKDFLATKRATQKDGTINDIQKTKALAKINRKAMLLKNLARNFNDLSKFIN
FT                   SMILGGSEMSEGEGVNLLSIHASKGLEFKEVYVIDLMDGRFPNRKLMSKGGSLEEERRL
FT                   FYVAVTRAKDILYLSYAKYDKIKKMTFVASPFLKEAGMAINEEEDS"
FT   gene            568847..570004
FT                   /locus_tag="Abu_0564"
FT                   /note="AB0562"
FT   CDS_pept        568847..570004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0564"
FT                   /product="probable sodium/hydrogen antiporter"
FT                   /note="Pfam match to PF00999 Na_H_Exchanger, score 148.1,
FT                   E-value 2.1E-041"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66831"
FT                   /db_xref="GOA:A8ESA7"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA7"
FT                   /protein_id="ABV66831.1"
FT                   /translation="MEKIILIITVCMIIMAAPIISKMIKTPVVVIEITLGLLCGYLGLI
FT                   YSDETLKLVAKFGFVYLMFLAGLEINFKLVKIIKATLAVNVILYFILLYTISGLVCWLF
FT                   GLGLTYFVALPIFSLGMIMMLLKEYGKEQPWLNLALSIGVVGEIISILALTLFSGWTEY
FT                   GFTSNFFYSILTIALVIVAIILLLRVSYVLFWWFPEIRNFIIPENQDDKHDQDIRFSLS
FT                   LLLIFVSIMLILKIDVVLGAFTTGLFFKMFFNQKHELLEKIESFGYGFFAPIFFIYTGS
FT                   TVKLDMVTLEILHHAIFIMCAIITIRLISSYLVFYNYLKFKQTMLFALSDSMPLTFMVA
FT                   IAMLSYNYGLISQDEYFSFIIASIIDGLFLMILIRKLYKYFIPHT"
FT   gene            570246..571580
FT                   /gene="soxC"
FT                   /locus_tag="Abu_0565"
FT   CDS_pept        570246..571580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxC"
FT                   /locus_tag="Abu_0565"
FT                   /product="sulfur oxidation protein SoxCD, sulfur
FT                   dehydrogenase subunit"
FT                   /EC_number="1.8.3.1"
FT                   /note="Pfam matches to PF00174 Oxidored_molyb, score 200.4,
FT                   E-value 3.7E-057, and to PF03404 Mo-co_dimer, score 56.6,
FT                   E-value 7.7E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66832"
FT                   /db_xref="GOA:A8ESA8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030835"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA8"
FT                   /protein_id="ABV66832.1"
FT                   /translation="MKKSDVLDIKKDSDFVIQTSRREFFKKTAIYSAGALSVSSVLSPV
FT                   SLKADDPAIINEAPWGQKLGDPVDKNLYGVPSPYEHNNIRRTHDLFSSGDPYASVSMCP
FT                   IHESEGIITPNGLFFTRNHGGTAHVDPNEWRLMIHGKVKKEIVLTLDDLKKYPSETRIY
FT                   FIECPANGSPEWRGPQFNSLQFMKGLMSAAQWTGVMLKTILDDLGLEKDAVWMLAEGSD
FT                   NASNPRTIPVEKALDDVMVVWAQNGEALRPEQGYPVRLIVPGWEGNLNTKWLRRLEFSD
FT                   KPWHSKEETSKYTMLQKSGKAIRYFWVNEVNSVITSPCPEKPWTNLKKGELVEIEGLAW
FT                   SGHGTIKGVDISFDGGDNWVEAKLKGLVLPKSWTRFSYMIRWEGKPLILASRSYDDFGN
FT                   IQPTIDQETSAVGVESVYHRNAIVTWEITEKGECNNVQIRKHKKA"
FT   gene            571549..572733
FT                   /gene="soxD"
FT                   /locus_tag="Abu_0566"
FT   CDS_pept        571549..572733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxD"
FT                   /locus_tag="Abu_0566"
FT                   /product="sulfur oxidation protein SoxCD, diheme cytochrome
FT                   c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66833"
FT                   /db_xref="GOA:A8ESA9"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESA9"
FT                   /protein_id="ABV66833.1"
FT                   /translation="MFKLENTKKLKNTLLGISLVSFLATTAIAASKETSVDGAVKYPLK
FT                   DGKYSSYYVNTQTVKDSNIGRIPTIKEVKAWDVDVRPDGTGLPEFDMKNGEIVLGEDGK
FT                   PKKAEGSVELGNELYDAQCVMCHGDFGSGGKGYPMLAGGSKESLKVQRLNPADEHPNPD
FT                   TPVRTIGSYWPYASTLYWYVQDSMPFTHPKSLTNSETYAITAYLLSVNNITIDGEELDD
FT                   EYVLDKEKLMKVIMPNHDGFYPEVDTKNPRDGVKNMTALLSNPKIYGTGTRCMKDCIKE
FT                   DTNNLLMKINIDLTANANQAMSVERSLPNIKADSVKPGQVDYQSSCSVCHENAAIGAPV
FT                   LGDKVAWTKVLEKGVDKVYFNAINGVNAMPPKGGTDFSDEKIKEIIDYMINSSK"
FT   gene            572748..573101
FT                   /gene="soxX"
FT                   /locus_tag="Abu_0567"
FT   CDS_pept        572748..573101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxX"
FT                   /locus_tag="Abu_0567"
FT                   /product="sulfur oxidation protein SoxXA, monoheme
FT                   cytochrome c subunit"
FT                   /note="Pfam match to PF00034 Cytochrom_C, score 33.7,
FT                   E-value 5.9E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66834"
FT                   /db_xref="GOA:A8ESB0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB0"
FT                   /protein_id="ABV66834.1"
FT                   /translation="MSLIKNLVKAIAVSAVIAISSFAIDADLVKKGEKIFTTNTQGNCI
FT                   ACHAINGKTLDGPGSMGPVLQYLSLWPEEALYDKIYDPYISNPISAMPAFGKNGWLSDD
FT                   EIKALVAYLKTIN"
FT   gene            573117..573569
FT                   /gene="soxY"
FT                   /locus_tag="Abu_0568"
FT   CDS_pept        573117..573569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxY"
FT                   /locus_tag="Abu_0568"
FT                   /product="sulfur oxidation protein SoxYZ, sulfur covalently
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66835"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB1"
FT                   /protein_id="ABV66835.1"
FT                   /translation="MINRRNFLGLGLAALAIAAVPGRLSAIDFRETKPKAWTATKVDDA
FT                   IKELFGSSTLVDGGINLSAPDIAENGAVIPVSFSTELKATKIAVFQDANPESAVAVFNL
FT                   NEFSVPDFAIRIKMAKTGTVTVVAEADGKLHSASKLVKVTIGGCGG"
FT   gene            573627..573932
FT                   /gene="soxZ"
FT                   /locus_tag="Abu_0569"
FT   CDS_pept        573627..573932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxZ"
FT                   /locus_tag="Abu_0569"
FT                   /product="sulfur oxidation protein SoxYZ, sulfur compound
FT                   chelating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66836"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB2"
FT                   /protein_id="ABV66836.1"
FT                   /translation="MAGTTKIKAKLKDGIVEVKALATHPMLSYQEAERAKKEPNFITYV
FT                   IAKVGDKVVYEASTSQFLSKDPYLKFSFKGANVGDTIELTWKDLKGNTDVSSEQIK"
FT   gene            573970..574884
FT                   /gene="soxA"
FT                   /locus_tag="Abu_0570"
FT   CDS_pept        573970..574884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA"
FT                   /locus_tag="Abu_0570"
FT                   /product="sulfur oxidation protein SoxXA, diheme cytochrome
FT                   c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66837"
FT                   /db_xref="GOA:A8ESB3"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB3"
FT                   /protein_id="ABV66837.1"
FT                   /translation="MLSKVVKSTALLVLAAYSLNAANYNAGAEKDRLALIKYFESKFAD
FT                   PEKNSNRFFPYSTQEELKNDYEKNLKHHDFNIGTYAFSKDAKAQYEAIKEMPPYEDAID
FT                   AGEELYKKTFANGKSFASCFPDTTAMNLFPYYNEKKNDVVTLTSAVNDCLRDNGEKEWN
FT                   TQKGDMANLQAYLVNQTKEAGKKFDIKIQSEAAKKAYEAGKEFYYSQRGYLKMSCATCH
FT                   VQGAGQRVRNEKLSTLTGQITQFPVHRLRWEELGTLERRLSGCIVDQGQVAPKDESKEM
FT                   KQLAYFLAYMSNGMNIDGPDIRK"
FT   gene            574898..575317
FT                   /locus_tag="Abu_0571"
FT                   /note="AB0569"
FT   CDS_pept        574898..575317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66838"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB4"
FT                   /protein_id="ABV66838.1"
FT                   /translation="MKNSVLKFATVTALVLGLTTLGASELSKLDVKKECNVEANGVEKV
FT                   IATAAKYNEIAVKHQVEFMRLGMKASQYIEAVNNSLKNGLKTIDIVDAKGKKTEEATIE
FT                   FGAWRACSFAIGAVVQEEEAKTTWKLASPSDGYKY"
FT   gene            575449..577215
FT                   /gene="soxB"
FT                   /locus_tag="Abu_0572"
FT   CDS_pept        575449..577215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB"
FT                   /locus_tag="Abu_0572"
FT                   /product="sulfur oxidation protein, sulfate thiol esterase"
FT                   /EC_number="3.1.3.5"
FT                   /note="Pfam match to PF02872 5_nucleotid_C, score 75.8,
FT                   E-value 1.2E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66839"
FT                   /db_xref="GOA:A8ESB5"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB5"
FT                   /protein_id="ABV66839.1"
FT                   /translation="MSKLSRREFIYMMAVLGAAPVFANSHTRMVGTSAKLEDYYKLKPF
FT                   GNARLLHMTDSHAQLLPVYFREPSVNLGFFSNFGKPPHIVGETFLDYYGIKGNKRLEYA
FT                   YSCVNFEKHAKAMGKTGGFAQIKTVVDFLRDSFGKDKTLLLDGGDTWQGTATALWTRGK
FT                   DMVGAMNLLGVDVAVGHWEFTYKAEEVLANVKELKAEFLAQNIFVKEDSLMNGVEAYDE
FT                   DSGLAFKPYTIKELGKSRVAIIGQAFPYTTIANPQRFIPDWTFGIKDDKMQELVNKIKA
FT                   EEKPDAIIVLSHNGFDTDKKMAEICTGIDFIMGGHTHDGVPEAVPVKNASGTTYVCNAG
FT                   SNGKFLNVLDLDIQNGKIKDFKFTLLPIFSDLIAEDKAMKKYIEDVRLPYLKELTREIA
FT                   TTEQTLFRRGNFNGSWDQIICDALLEVKEAQISLSPGFRWGTSVMPGQAITFDDLMTQT
FT                   AMTYPETYARDISGKDIKDILEDVADNLFNEDPFYQQGGDMVRTGGISYKINPKAKMGE
FT                   RISDIVLTKTGEKLDASKAYKVAGWSTVGAQSDGEPIWETVETYLKNIKHISKVKIDTP
FT                   DIIGVKGNPGII"
FT   gene            577302..578096
FT                   /locus_tag="Abu_0573"
FT                   /note="AB0571"
FT   CDS_pept        577302..578096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66840"
FT                   /db_xref="GOA:A8ESB6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB6"
FT                   /protein_id="ABV66840.1"
FT                   /translation="MKIIFLSLLFILNLFADFKEGETLFKSKCSSCHIDYIFMNVLKEN
FT                   FFEKNNKLLNLKAPTVNMIVYAIMDSPKKIGDSNDIEMQEMEIENYLKSYLENPDRFNS
FT                   ICDEHILPFYDNKMSMKGELKDEDYKNLTNYFMLYKDNLTISNKEIEKSFSSTNEKEII
FT                   EKAKKENKKIIVYASSKSCFFCKRMDRDVLNLDEVKKEMNKHYIFVKNDMDESTLPFDL
FT                   QKVYKKITPTFFILSKDGTYIKQYPGAWIKSDFLEILKENNK"
FT   gene            578093..578527
FT                   /locus_tag="Abu_0574"
FT                   /note="AB0572"
FT   CDS_pept        578093..578527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66841"
FT                   /db_xref="GOA:A8ESB7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB7"
FT                   /protein_id="ABV66841.1"
FT                   /translation="MKVLETFSATKEAHGFIRPKVKELNLIENFGIENDKFAGKKLEQT
FT                   VMIVGLKSYEIARQQNINLEFGSLGENILLDFDPHDFEIGTNFIIGDAIIEITQVCSVC
FT                   SHLSVFDKTLPQLLKAHRGVYCKIIKSGFIHKNMEIKIKG"
FT   gene            578531..578971
FT                   /locus_tag="Abu_0575"
FT                   /note="AB0573"
FT   CDS_pept        578531..578971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66842"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB8"
FT                   /protein_id="ABV66842.1"
FT                   /translation="MIKKFVLISLLAIFSFAESKFSDPQPTFENPRKVVYSLYVGDLET
FT                   VNHTIGSMYNILKEYPSESLKIVVVAYGKGLRTLKKDYDKKTLDRIKSLMEYDVEFVAC
FT                   RNTMETMKWTEKDFIDGISYTQAGIVEVIEKQQEGYIGITAY"
FT   gene            578989..579780
FT                   /locus_tag="Abu_0576"
FT                   /note="AB0574"
FT   CDS_pept        578989..579780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0576"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF00561 Abhydrolase_1, score 30.7,
FT                   E-value 2.2E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66843"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESB9"
FT                   /protein_id="ABV66843.1"
FT                   /translation="MLKKTLIISSLILVSNLSLNAAKISKDDCSKKGESFIYAGNECIQ
FT                   YKKFLGEEEGALNIIVHGTWNEGTDTLARYSPFVEDLAMRTDITTIAVALPGYSQSSTN
FT                   NFPSLSSKGVENLGAKKEYVEFVASLVEALKEKFKANKITYIGHSAGCMMGATITGLKP
FT                   DLINNLVCAGGVYNIHEKSKEKDLISIVDVLDNVSKNTKFVLLYGTADDISKPQVTKDF
FT                   YNLAKNKGFDVKLVEAKDAVHIDLDMTTEAKDSIEEIVTDD"
FT   gene            complement(579811..580377)
FT                   /gene="pfpI"
FT                   /locus_tag="Abu_0577"
FT   CDS_pept        complement(579811..580377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="Abu_0577"
FT                   /product="peptidase, ThiJ/PfpI family protein"
FT                   /note="Pfam match to PF01965 DJ-1_PfpI, score 94.3, E-value
FT                   9E-021"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66844"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC0"
FT                   /protein_id="ABV66844.1"
FT                   /translation="MSKKILILAGDFVEDYELMVPYQCLKMLGYSVDVVCPNKKAGEQI
FT                   KTAIHDFEGDQTYTEKPGHNFTLNATFDDINEFVYDGLLIPGGRAPEYIRLNSRVIEIV
FT                   QNFNKINKPIASVCHGILLLTAAKIIENKTCSCYPACSPDVDLSGGKWADIGFESAIVD
FT                   GNLVTAAAWPAHPEWLAKFHELLSK"
FT   gene            complement(580452..581369)
FT                   /locus_tag="Abu_0578"
FT                   /note="AB0578"
FT   CDS_pept        complement(580452..581369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0578"
FT                   /product="conserved hypothetical protein,
FT                   beta-lactamase-like protein"
FT                   /note="Pfam match to PF00753 Lactamase_B, score 97.5,
FT                   E-value 3.6E-026"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66845"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC1"
FT                   /protein_id="ABV66845.1"
FT                   /translation="MLKNILVLILVSNYIFAFDYNLKATKVSSDIWCFFGKLEAPSKEN
FT                   GGFMSNSCYIKTKDSYTLIDSGVSYDFAKQAYETMKKIENLPVKNVIITHSHDDHWLGN
FT                   SFYKEKFNATIYGPKSINIEFNTTSQIRGLNVLSEENKIKTKFVPIDKVINETTTLKIG
FT                   NKEINIIPTGLKAHTSDDLFVYLPNEKVLFSGDLVMNGRVTSNRDGSVIGALKAIEMIN
FT                   SKKWDILIPGHGLDTSKTATDEMVKYFTLLKQRVMQAIENEVTGNEIAKVVTMEEFKDK
FT                   ALYDELNSRNVYDAYRELEFYEED"
FT   gene            581459..582511
FT                   /locus_tag="Abu_0579"
FT                   /note="AB0579"
FT   CDS_pept        581459..582511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0579"
FT                   /product="conserved hypothetical protein, HD domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66846"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC2"
FT                   /protein_id="ABV66846.1"
FT                   /translation="MDKKKQMVFNLNNFLLAMSNILDFKEFDLKNTKLNHFKRVSYIAL
FT                   NLGIKFNFEPKIMADLCSLTLVYTLKKNDLEKLPFLNGKEFLENSLIKEIIDFSSKLDK
FT                   MFNLDDNQIENRVKAIEFVKENKENFSNELINNFLEVSSQISFWLDLQYENEILMYIYS
FT                   SLHDFTTVSDFEEILNLTTIFHKLENKNSQLLQRANIITDEFNFEHKDKQIFLIATSLQ
FT                   NIGKMMIPSSILNKKEKLSSSELEIIKSYPYHTKRVLSSIMGFTDILSLVIKVQERLDG
FT                   SGYIYGFEAKSLSLKDRLLISLVIYNALREDRSYRNAFSHEEAIKIMENEAKIGKIDES
FT                   LIGIFDNVFK"
FT   gene            complement(582535..583209)
FT                   /locus_tag="Abu_0580"
FT                   /note="AB0580"
FT   CDS_pept        complement(582535..583209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0580"
FT                   /product="rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66847"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC3"
FT                   /protein_id="ABV66847.1"
FT                   /translation="MIKIVLGSTVLASLIFAADLQTSGVEVTYKNSKDENKTVTIKREK
FT                   KEECKDVGFDPKVVYGGEHQASESVNANCKRAFVTYMGKISPMKYSDKVETFGEVEVLE
FT                   FIEKAKTNKNMMLVDSRTENWFYHETIPSAVNIPYIYMKQSQYPDEFEEYVEMLGVKKV
FT                   NGKYDFSNAKTILMFCNGAWCGQSPESMKALTAIGYPEEKLKWYRGGMQSWLSLGLTTV
FT                   KP"
FT   gene            583395..586010
FT                   /gene="valS"
FT                   /locus_tag="Abu_0581"
FT   CDS_pept        583395..586010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="Abu_0581"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Pfam matches to PF00133 tRNA-synt_1, score 783.9,
FT                   E-value 8.5E-233, and to PF08264 Anticodon_1, score 119.4,
FT                   E-value 9.3E-033"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66848"
FT                   /db_xref="GOA:A8ESC4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC4"
FT                   /protein_id="ABV66848.1"
FT                   /translation="MSEKYEPSKVEDKFYKIWESRGYFEIDGNKSIQEEGKNFAIMMPP
FT                   PNVTGSLHIGHALTFTLQDIITRYKRMDGFKTLWQPGTDHAGIATQNVVEKQLLAEGTT
FT                   KEELGREKFLERVWKWKEFSGGTIVHQMRKLGVSPAWSRERFTMDEGLKEAVKEAFVHL
FT                   YNEGMIVQNNYMVNWCTHDGALSDIEVEHDEVQGKFYHMNYHFADGSGYVTVATTRPET
FT                   YFGDTAIMVHPEDVRYSSIVGKEVILPLTTRKIKVITDEHVDMEFGTGVVKVTPAHDQN
FT                   DYEVGKRHDLEFITCFDEKGILNDYCGEFAGLERLEARPLIVKKLQDEGFIIKIEEHVH
FT                   QVGHCYRCKNIVEPYISKQWFVRKEVAAKSIEKTYAGEAKFHPSHWLNSYRAWMDELRD
FT                   WCISRQLWWGHRIPVFYCDDCGHQWADKADVPHSCPKCASKNFTQDPDVLDTWFSSALW
FT                   AFSPLGWGNNGQMNGTFNESDLKDFYPNSLLITGFDIMFFWVARMMMMGEHFRGELPFK
FT                   DIYMHALVRDEHGAKMSKSKGNVIDPLDMVEEHSADIIRFTLAYLAVQGRDIKLGAKNL
FT                   EQFRNFTNKLYNASNFLALNVDTFPDLKDIEIKSPLGLYMQSRLSDAIDEVRGALESYK
FT                   FNEAASVLYRFVWTEFCDWGIEYSKASKDSIVELGAIFKETLKMVSPFMPFISDFLYHK
FT                   LSGTSLEEGESLMIMNFPKNVKKDEKIEEMFSIIEEAITAIRRAKVIIDMGNSKIAKAY
FT                   IKLDKSIDTAVAKPFIEKLAKVEDIEFVNAKVENSITDVSNNLEVYLPTSEIDMKPIID
FT                   KLTKQQEKAQKEFDKLNGMLSNERFVANAPANVIEENKKALEEVKTRLEKIEAELKSLS
FT                   "
FT   gene            586038..586856
FT                   /locus_tag="Abu_0582"
FT                   /note="AB0582"
FT   CDS_pept        586038..586856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66849"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC5"
FT                   /protein_id="ABV66849.1"
FT                   /translation="MKSLFLGMFVIFILTGCASKKDFRNMTTDEMKKDCNGKDEFKSCF
FT                   RLGKEYFKNNDMNLALTYYSKGCDGYYEIGFINKKRVIREDIHSCIKEAEILKDKKEYR
FT                   NSGTKSKLIYVADYYFESNDLTKAYEYYEDSLKYQSILFEQEIYSKQIFFNMSQILLKG
FT                   TDKIQQNIKLSEVYYIKSLQYEIYNIIRKALIVQIRLNKIYPTIEVDTEISADGKILNT
FT                   IITTIPKDENISSKVYKLLQEQTFNSIPKEYNLQQIKVNKVTLKTNANQK"
FT   gene            587017..587211
FT                   /locus_tag="Abu_0583"
FT                   /note="AB0583"
FT   CDS_pept        587017..587211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66850"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC6"
FT                   /protein_id="ABV66850.1"
FT                   /translation="MLDNKKRINIKAGLKVNVVLKQDQITGKLTSGIVKDILTNSPTHP
FT                   HGIKVRLQDGQVGRVQEIL"
FT   gene            complement(587249..588103)
FT                   /locus_tag="Abu_0584"
FT                   /note="AB0584"
FT   CDS_pept        complement(587249..588103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66851"
FT                   /db_xref="GOA:A8ESC7"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC7"
FT                   /protein_id="ABV66851.1"
FT                   /translation="MLKSKLLYIILSIFSLTFFVWDFWINFEKMKEDTISSSLLKTKTT
FT                   SIYLQENLKKFLEDKTNPEILSIINQTFNSDFKSIKVDNSTFEIKEEDLVKTSNDLDKS
FT                   QLWEVTNAIIDETLGRFVVITQSDDFEKELLTLNGSIPNEDNKSIVPSQDIYTFLPNKN
FT                   FKNQNSLTIKFKATNQFEKVVDTQATIYFDKTLAQVSNDNVNYTTPLWFKELVPIYLEE
FT                   QANDISNSWKSNATIYVNTNIEKVYFELYEKAKEKFFDNLLWFFVTILGLFGFRFLYRV
FT                   LVK"
FT   gene            complement(588110..589423)
FT                   /locus_tag="Abu_0585"
FT                   /note="AB0585"
FT   CDS_pept        complement(588110..589423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0585"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="Pfam match to PF07690 MFS_1, score 215.8, E-value
FT                   8.7E-062"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66852"
FT                   /db_xref="GOA:A8ESC8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESC8"
FT                   /protein_id="ABV66852.1"
FT                   /translation="MIKSVMPLSFIIALRFFGLFIVLPVISVYALSLDGANATLVGIVV
FT                   GGYALTQVVFQVPFGVMSDKLGRKGTIITGLLLFAIGSLICAIATDIYTLMLGRLLQGS
FT                   GAIGAVVTAMISDLVKEHERSKAMALMGSFIGLAFAIAMLAGPLIGGFIGVPVLFYITM
FT                   FLALISIYILVKKVPNPPIITHTYNDKLRLSDVLGNTNINRMNITNFLQKALMTFAFLV
FT                   IPIILTKTYGWEKKELWYVYLPAMIFGLLSMAPAAIIAEKKGKFKEILALGILFFIISY
FT                   LVIGFSSSSVVFVIGVVIFFIGFNMHEPIMQSLASKFAKVHQRGSVLGVFNSFGYLGTF
FT                   VGGLLGGIMLDNLNLSTFSIIIAVICVLWGILILTMPNPSKTKSVYLNLDEYKLENSGK
FT                   LNQNDAIDEWYINNTENIIAIKYDDEKISEEEIRALLK"
FT   gene            589501..590100
FT                   /locus_tag="Abu_0586"
FT                   /note="AB0586"
FT   CDS_pept        589501..590100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0586"
FT                   /product="HAM1-like protein"
FT                   /note="Pfam match to PF01725 Ham1p_like, score 111.8,
FT                   E-value 1.8E-030"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66853"
FT                   /db_xref="GOA:A8ESC9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ESC9"
FT                   /protein_id="ABV66853.1"
FT                   /translation="MKIVLASANKGKIKEFERLLPNDEIVAFSEILGKIEIDEDKDTFK
FT                   GNAIKKAQTIYDELQKINFGDVVVISDDSGISVPVLGNAPGVYSARYAGLNASDKENNE
FT                   KLKAELNKLGLEKTPAFYTACIAIVYKNEVYTVHGWMYGEVLNKEIGTNGFGYDPMFIP
FT                   NGYDKTLGELDEGVKKEFSHRSKALKLAMKVLEVIL"
FT   gene            complement(590090..590410)
FT                   /locus_tag="Abu_0587"
FT                   /note="AB0587"
FT   CDS_pept        complement(590090..590410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66854"
FT                   /db_xref="GOA:A8ESD0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD0"
FT                   /protein_id="ABV66854.1"
FT                   /translation="MKKAYTLLITIVLISTFSYLGVLILETKALKNQNLSNQYLYIQAK
FT                   NHLNFFEDFVKNYDLKDITHLQIEDELFDIYATKLIDSNIVDIFVKAKDFDISIHKQIT
FT                   KE"
FT   gene            complement(590407..590748)
FT                   /locus_tag="Abu_0588"
FT                   /note="AB0588"
FT   CDS_pept        complement(590407..590748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66855"
FT                   /db_xref="GOA:A8ESD1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD1"
FT                   /protein_id="ABV66855.1"
FT                   /translation="MKNSFSLLEIIITLIISSIVIIYSTLFTKELSLENKYNQELEIDK
FT                   INFLATKVFIEKNKYNISNLQFSNGNLYFENNLLLKDVKEFNIMKTSKQITIYINFKDK
FT                   IMQTWEFSL"
FT   gene            complement(590738..591025)
FT                   /locus_tag="Abu_0589"
FT                   /note="AB0589"
FT   CDS_pept        complement(590738..591025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66856"
FT                   /db_xref="GOA:A8ESD2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD2"
FT                   /protein_id="ABV66856.1"
FT                   /translation="MQKNSFTLIETLVSITLLLIVIIGFKYSTYYDENSSKNFMLLNNL
FT                   ENLFDTKNYGSFQNSAKTLQLIKNKEIIENITVTKYQFENESIKLFKYEK"
FT   gene            complement(591012..591776)
FT                   /gene="proC"
FT                   /locus_tag="Abu_0590"
FT   CDS_pept        complement(591012..591776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="Abu_0590"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Pfam match to PF03807 F420_oxidored, score 145.3,
FT                   E-value 1.5E-040"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66857"
FT                   /db_xref="GOA:A8ESD3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD3"
FT                   /protein_id="ABV66857.1"
FT                   /translation="MKLTLIGNGIMAQALAKGLIKKYEVEMIGRDIEKLKLIQEKIPQI
FT                   TIKQLEDKEDITDKIVIFCVKPYALESVSVRLIGSANVLLSILAGTKLDFLKKQIKATH
FT                   YIRTMPNIAASVHNSMTTITGDIESKAVAMEIFSCIGEALWVNTETQLDIASAITGSGP
FT                   AFLALIAESLADGAVKAGLERHLSAHLVQGLFSGTASLLRHSHPAVIKDSVMSPGGTTA
FT                   AGFAQLEEAGVRSAMIKAVESSFNKALKLAEK"
FT   gene            591846..592526
FT                   /locus_tag="Abu_0591"
FT                   /note="AB0591"
FT   CDS_pept        591846..592526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0591"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66858"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD4"
FT                   /protein_id="ABV66858.1"
FT                   /translation="MFFMIKDIRMIKSLKLKGLLLVTCATFVFTGCSSKSEQEYNKPAL
FT                   YWYNKMMKQIASGDLDEADDTYTSLESEHRNSPYIPTAIMILVNAHIEEEEYALANFYL
FT                   DEYIKKFGLSKDIDYARYLKIKANFLGFKYQFRDQQLIDDTLSQIQEFKEKYKNSPYMP
FT                   LVDTINSRLYMSKASFDQEISELYTRRDKPLGTEFYEEKVRGSWVDSSEIEPVKVPFYR
FT                   ALFE"
FT   gene            592569..594986
FT                   /gene="lon"
FT                   /locus_tag="Abu_0592"
FT   CDS_pept        592569..594986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="Abu_0592"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="Pfam matches to PF05362 Lon_C, score 325.6, E-value
FT                   8.2E-095, and to PF00004 AAA, score 159.6, E-value
FT                   4.9E-048, and to PF02190 LON, score 18.5, E-value 1.2E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66859"
FT                   /db_xref="GOA:A8ESD5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD5"
FT                   /protein_id="ABV66859.1"
FT                   /translation="MELKNYEEFPQTIPLIIEDDIFLYPFMIAPLFLSNEQNVKAVEYA
FT                   IDHNKLVMVTVSKPAKEGKREKDSFYDVGVVGNIMRKVSLPDGKIKVLFQGLTKGKILD
FT                   FASEQPLFVNVDTLKNEESNEENIKSVIEVLIENVKKLSKLNIKFPADLVKTIEENDDP
FT                   VRIADLISSVLKVKKEEAYKLFSQTNIEQRLFDIIEVIKKEIESFKIQKEITQKVNSKI
FT                   EKTHKDYFLKEQIKAIQKELGTDNQKEIEIKSYKKRLKAKKEFMSKEAYKETKKQLEKL
FT                   SRMNPDSPDASLLQTYVEQVLDIPFGEYANEKISVKNVEEQLNKDHYSLIKAKERISEY
FT                   FAVKQLLEQRNLEDLKSKGTVLCFVGPPGVGKTSLANSISQALKRPLIRVALGGMEDVN
FT                   ELRGHRRTYVGAMPGRLIKGLIDAKKMNPVMVLDEIDKLGSNHRGDPTAVMLEILDPEQ
FT                   NHEFRDLYLNFPVDLSQVIFVSTANDARRIPAPLRDRMEFIEISSYTPEEKYHIAKDYL
FT                   IPQELEKHGLQKSEVSINKATIELIISKYTREAGVRNLRRVFSKLFRKVVKQILNDPTI
FT                   EKVTIGTKDLKAYLDNPIFEIDPAEKKNSIGIANGLAWTAVGGDVLKIEAIKLKGKGNL
FT                   TVTGNLGDVMKESSRISYSVVKVLIDNKVLKIDEKIIPKSVKEEEENEKLDCSEIYKRY
FT                   DIHLHIPEGATPKDGPSAGITMALAIASILSDKAIKADVAMTGELTLSGKVLPIGGLKE
FT                   KLIAAYKAKMKKALVPRKNFDRDLDEIPDEVKNAMEIKAVDTIEDVLKEALV"
FT   gene            594990..595553
FT                   /locus_tag="Abu_0593"
FT                   /note="AB0593"
FT   CDS_pept        594990..595553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0593"
FT                   /product="rhomboid-like protein"
FT                   /note="Pfam match to PF01694 Rhomboid, score 102.1, E-value
FT                   1.5E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66860"
FT                   /db_xref="GOA:A8ESD6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD6"
FT                   /protein_id="ABV66860.1"
FT                   /translation="MLNFSKKDFTATNVIIIITVLFYLIQINVQQGSLLFGLNLYFLIG
FT                   GFYWQPLTSIFSHGGIAHLAMNMFVLWQFGNYVERSRGAKAFVLLYLITGVLTSLFSFL
FT                   YIFFLDITVNLVGASGAICAILGYVAYFDKVQRSGIITWILLISVAPLLIGLPIAWYAH
FT                   FIGLAIGFIYAIIDKSILLKKYKR"
FT   gene            595550..596008
FT                   /locus_tag="Abu_0594"
FT                   /note="AB0594"
FT   CDS_pept        595550..596008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0594"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Pfam match to PF01451 LMWPc, score 128, E-value
FT                   2.4E-035"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66861"
FT                   /db_xref="GOA:A8ESD7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD7"
FT                   /protein_id="ABV66861.1"
FT                   /translation="MKRSILFVCLGNICRSPLAHGIAQEYINKEQLDILVDSAGTGSWH
FT                   IGEAPCENSIKVALLNGVDISKQKARQVKKDDFQKFDFVIALDDNNLKDLKNLGCKNPL
FT                   KLGDFGYEGACVPDPYYFRDFEDFKNVYSMIETCVKNLIDDLINNDIA"
FT   gene            596048..597337
FT                   /locus_tag="Abu_0595"
FT                   /note="AB0595"
FT   CDS_pept        596048..597337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0595"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD8"
FT                   /protein_id="ABV66862.1"
FT                   /translation="MNKATTFYEIQDAVAFNNPIDEKNEFYTDFSGFRKGFNEKKIFKY
FT                   LNIKPTTKECNKISQTLKLFLSGHRGTGKTTELLKLKNEIDETTCFFSVFCDLSDEELD
FT                   VNNIDFIDIIILILEKLTKTLDDKKIDIPKANIEPFYDWYEQRITEINNQTDESASIEV
FT                   EGKAGIDLFSLFSLVSKTKGKLSGSNSTKETIRKVFKNKFSDFSLKFNEFILDIKGYLL
FT                   KNEISKDLLFIIDGFEKIGSLEDRKKILIDNSNKFVEIKANMIITLPIELFSEVSRLKE
FT                   FASHISFPLISLDNNSKERFKEFIYKRIEKSLFDSEQTVEKIIYYGAGSPRETLKIILE
FT                   AYVQAEGEIIDLKSVQDAQKSISEELMKYLDEKEISLLKQVYTKTKIPFSDELAKLLIK
FT                   KVLLDYEDGLERKINPILLDNQDFINLIKA"
FT   gene            597340..599022
FT                   /locus_tag="Abu_0596"
FT                   /note="AB0596"
FT   CDS_pept        597340..599022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0596"
FT                   /product="hypothetical TPR repeat protein"
FT                   /note="Pfam match to PF00515 TPR_1, score 27.8, E-value
FT                   3.6E-005"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66863"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESD9"
FT                   /protein_id="ABV66863.1"
FT                   /translation="MSSELKFEELQKKLKKVLNTNRFRFIFIFYPNENLREEIKNHICE
FT                   SFTSSNQITLNLKDNTYQDIAPILYENDKSFIFIDDFFDVLDNADLYNGFNQRRDKIAS
FT                   KNINLICFVNSNFKEKFFQTSIEYIPDLIEFKNAIFEIETPNNYENRLILKEVLSSSYS
FT                   SLGGLTTQSKKEELQRLLLKLNDVENVVEKLNLFSQITTIYRDVGEFKKALEYQEKILK
FT                   LEEENLEKNHPNLASTYNNISTIYHEMEELEKALEYQKKAIDLKEAILKKNYPDLAISY
FT                   NNISMIYQDMGDLKKALEYQQKALEIREKFSEVGKSDLATSYNNISVIYKNIGNLNKAL
FT                   EYQQKALKIFEEILEENHPNLATSYSNISIIYQEIGDLKKALEYQEKALKLREEILGYR
FT                   HPDLATSYNNISTIYKSMGELKKALEYQEKALKLREDILGWKHPLLISCYNNISLIYQD
FT                   MGELKKALGYQEKALKLGEEILGDKHPDLAISYNNISAIYKDLKECLKAKGYIQKAIDI
FT                   WQEYEYYYKELANAKKFIKEIELNIKKENKLPFNKKGRFCKDI"
FT   gene            complement(599075..599506)
FT                   /locus_tag="Abu_0597"
FT                   /note="AB0597"
FT   CDS_pept        complement(599075..599506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0597"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Pfam match to PF01047 MarR, score 80.9, E-value
FT                   1.3E-022"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66864"
FT                   /db_xref="GOA:A8ESE0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE0"
FT                   /protein_id="ABV66864.1"
FT                   /translation="MKNKEFDFSKMICFLLNSTSNAMIREYRPHLEEFQLTYPQYLVMM
FT                   TLWNNDNILIKDISKETFFDSATLTPILKRLEEKSYIIRTQSLSDERGKIIKLTKEGKD
FT                   LKDKTAHIFKNMECKIELSSEEQEDIIKICNKILSKLGN"
FT   gene            599645..599968
FT                   /locus_tag="Abu_0598"
FT                   /note="AB0598"
FT   CDS_pept        599645..599968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66865"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE1"
FT                   /protein_id="ABV66865.1"
FT                   /translation="MQLANFNGIVSNLLDNITPVEITKGVSQYILWKNNDGKLTAIYKF
FT                   EKNSKLPFLDEHNLFDEHIFVISGVFNDGNKKYKEGSFIINPKGTSHIPQSEEGCTILV
FT                   TNE"
FT   gene            complement(600032..600280)
FT                   /locus_tag="Abu_0599"
FT                   /note="AB0599"
FT   CDS_pept        complement(600032..600280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0599"
FT                   /product="hypothetical protein"
FT                   /note="Pfam match to PF01381 HTH_3, score 26.9, E-value
FT                   1.4E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66866"
FT                   /db_xref="GOA:A8ESE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE2"
FT                   /protein_id="ABV66866.1"
FT                   /translation="MFEENPELFLDEIVKNVKKERIQRKISQLKLANILDFSSPNYIAK
FT                   IETRKHGSSYNLIHLCKIAKAFDIEVVELLPQKKKKS"
FT   gene            600425..602086
FT                   /pseudo
FT                   /locus_tag="Abu_0600"
FT                   /note="methyl-accepting chemotaxis protein; AB0600;
FT                   probable pseudogene due to UGA nonsense mutation"
FT   gene            complement(602083..603621)
FT                   /locus_tag="Abu_0602"
FT                   /note="AB0602"
FT   CDS_pept        complement(602083..603621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0602"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam matches to PF00015 MCPsignal, score 116,
FT                   E-value 9.9E-032, and to PF08447 PAS_3, score 71, E-value
FT                   6E-019"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66867"
FT                   /db_xref="GOA:A8ESE3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE3"
FT                   /protein_id="ABV66867.1"
FT                   /translation="MFFSNKEDKLQLKAIDQNYAVIKFKPDGTIIEANKNFLDIMGYTL
FT                   NEIIGKHHKIFCEKKFVESKDYQEAWNTLNAGESITAEFKRIKKDGEAVFLRASYLPIT
FT                   DNNGRVKEVIKLAQDVTKRRLKDLYYLGQVNAINKSQAVIEFDMNGIVVNANKNFLDTL
FT                   GYSLNEIVGKHHSIFCEESYRNSNAYKEFWQKLNRGEYDAGEYLRIGKDGRRVWIQASY
FT                   NPILDLDGDPFKVVKYATDITLKKNTMNQIGKEIEDLTKSLTLLKNASNTMVKEAKVSM
FT                   GSSQETTVSIEELNQAVQELSKKIEFVLSSITNIADTTLHSERIALEAKEQSKSTALAI
FT                   VKLNEESTKIGETINIITQIAFQTNILSLNAAVEAATAGEAGKGFAVVAQEVRNLATRS
FT                   NDAAKDITAAIEYIQSLVKNSLDSIHQIDNIVEKISSMSSDISGAVKEQKNITNELAST
FT                   ANETSHTLNQITNNMVRVSTSASNTEKEAEKTKENSNELIEISNKLIDTLKVLN"
FT   gene            603754..603978
FT                   /locus_tag="Abu_0603"
FT                   /note="AB0603"
FT   CDS_pept        603754..603978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66868"
FT                   /db_xref="GOA:A8ESE4"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE4"
FT                   /protein_id="ABV66868.1"
FT                   /translation="MIDKKYEKYVFAFFMGTIMSFIMSFIISFINLGLVDGFFFKWMEA
FT                   FFKAAVCAIPIISVVAPLVKKVVVKVIRD"
FT   gene            604006..604878
FT                   /locus_tag="Abu_0604"
FT                   /note="AB0604"
FT   CDS_pept        604006..604878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0604"
FT                   /product="membrane protein, putative (DUF6 domain protein)"
FT                   /note="Pfam match to PF00892 DUF6, score 47.8, E-value
FT                   7.7E-012"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66869"
FT                   /db_xref="GOA:A8ESE5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE5"
FT                   /protein_id="ABV66869.1"
FT                   /translation="MKSLSFDLKLIGLVFVVLLFFASNSILARMAINTQDIDAFSFTFL
FT                   RIISAMIVLLVIYFYKNKNLKIDLKSNYLSGFMFFLYSICFSYSYINMLAGVGTLILFA
FT                   VVQLTMIILALFFNEKLTFNKIVGIFIAFGGLIYLLYPKSDFTVSYFHTFLMFLSGIGW
FT                   AVFSVLGKKSKSATLNTTDSFFKAFIFTIIFAIFYLTFFGNSFKINSTTFFIATISGSI
FT                   TTAFGVFIWYTVLPKIQIMTASIIQLLVPIIAIFLSIIFLGETLSFELFFSTIIILLGI
FT                   FIALYKKKI"
FT   gene            complement(605069..606520)
FT                   /gene="accC2"
FT                   /locus_tag="Abu_0605"
FT   CDS_pept        complement(605069..606520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC2"
FT                   /locus_tag="Abu_0605"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="Pfam matches to PF02786 CPSase_L_D2, score 350.1,
FT                   E-value 3.4E-102, and to PF02785 Biotin_carb_C, score
FT                   211.5, E-value 1.7E-060, and to PF00289 CPSase_L_chain,
FT                   score 135.4, E-value 1.4E-037"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66870"
FT                   /db_xref="GOA:A8ESE6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE6"
FT                   /protein_id="ABV66870.1"
FT                   /translation="MKKIQKVLIANRGEIALRIIRACKELEIKSVAIFSEVDVEGIWVR
FT                   KADECYPIMGDVVQAYLDYSKIISIAKKAECDAIHPGYGFLSENADFARACEENGIIFI
FT                   GPKPEHIELFGDKMASKVAMKKVGVPVLEGTDEPIIDIEEGAKIAKQIGFPVIIKAAFG
FT                   GGGRGMRIVREEKDFKELFESASNEAKKYFGRGEAFIEKYVENPRHIEIQVIADKYGNV
FT                   LHLGERDCSIQRRHQKVIEIAPSPRLNNEARKELYRIATKAMFKLGYESVGTVEFLLDP
FT                   DDNIYFIEMNTRVQVEHPVTETITGVDIIQRMIQIAEGDKMIFLQEEINFRGYSIEFRI
FT                   NAENPQKGFMPSVGTVSKYLTPGGPGVRLDSALYTGYKVPPNYDSMVGKLIVWALDWEG
FT                   AVKKAKRALDEFYIEGFPTNIPLHREIVRDQDFKDGVFTTNYLDTKMELFTLHSEDNIK
FT                   EEEEKVAKLTQLIDTINKNNIKARI"
FT   gene            complement(606769..607122)
FT                   /locus_tag="Abu_0606"
FT                   /note="AB0606"
FT   CDS_pept        complement(606769..607122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0606"
FT                   /product="conserved hypothetical protein (DUF59 domain
FT                   protein)"
FT                   /note="Pfam match to PF01883 DUF59, score 79.8, E-value
FT                   7.9E-021"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66871"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE7"
FT                   /protein_id="ABV66871.1"
FT                   /translation="MEDKVFDLENVKEKIIENLKKVYDPEIPADVYNLGLIYEINLEER
FT                   SNYLYCEIDMTLTSPTCPVADSLLEQVRYVTMAVDEVDEVKVNLVFEPVWDPSMMSEDA
FT                   KEIMGVSGAAIGF"
FT   gene            complement(607132..607542)
FT                   /gene="sufE"
FT                   /locus_tag="Abu_0607"
FT   CDS_pept        complement(607132..607542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /locus_tag="Abu_0607"
FT                   /product="putative suf regulatory protein"
FT                   /note="Pfam match to PF02657 SufE, score 90.5, E-value
FT                   4.7E-024"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66872"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE8"
FT                   /protein_id="ABV66872.1"
FT                   /translation="MSTIEQRVEEIKDDLDFFDDELAKYEYIIDLGKKLEEFDEKDKTP
FT                   ENIVHGCTSQVWLTCENKDGKLYFYGTSDAIIVKGLVYMILQIFSGSTIQELKDVDMDI
FT                   VHELNLSEVITPNRQSGVIGMIKKIKEYALKA"
FT   gene            complement(607544..608728)
FT                   /gene="sufS"
FT                   /locus_tag="Abu_0608"
FT   CDS_pept        complement(607544..608728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="Abu_0608"
FT                   /product="selenocysteine lyase/Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="Pfam match to PF00266 Aminotran_5, score 476,
FT                   E-value 4.3E-140"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66873"
FT                   /db_xref="GOA:A8ESE9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESE9"
FT                   /protein_id="ABV66873.1"
FT                   /translation="MFKNDFPYFQNSKTTYLDNGATTQKPKSVIDSQVEYYEHYCSNTH
FT                   RSNFGDANKATLEFEKTRKILKEFINASKKEEIIFTKGVTESLNFIATSFAKDFKTVII
FT                   SSLEHHSNIVPWHMQGRTLGLGLEVVNCDDNLNFDMNHFEELLKANPNAFVSITHISNA
FT                   FGKIHDIEAITKLAHSYGAIVMIDGAQSLAHTSIDVQALDVDFFAISGHKTFAPTGVGA
FT                   IYIKEKYLKSVKPYQTGGATIHEVDFSGSTLLDSPYKFEAGTQNIAGVIGFGKALEYLN
FT                   YVKYENIQSIEHNVFKYLDEELAKLPDIVFYNDLENCVGSRSFNFKGIVHDDIGILLDK
FT                   MKVAVRVGHHCAQPIMKKLGIKGTIRVSISFYNDYVDVDNLITALKKALNMLRD"
FT   gene            complement(608721..609752)
FT                   /gene="sufD"
FT                   /locus_tag="Abu_0609"
FT   CDS_pept        complement(608721..609752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="Abu_0609"
FT                   /product="Fe-S assembly protein"
FT                   /note="Pfam match to PF01458 UPF0051, score 56.8, E-value
FT                   6.6E-014"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66874"
FT                   /db_xref="GOA:A8ESF0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF0"
FT                   /protein_id="ABV66874.1"
FT                   /translation="MKIDEIKTITLPKKRDEEFLKINFEALFSYDFKNVKSFEFDKNLK
FT                   TIKDENSYESILFSIVKNFDENQKVLVIDKDINEPIILIQNMKEDETFFTNSLRIEVKE
FT                   NIKASIIELFVNSSNNSCFAVNRNIVLEKNASLEYVKIQDIDLSNSMIFATSCEQNENS
FT                   NLEISNFEFGEGFIVNSFENIINKEFINYELNGLTKLKDSSNTSTLVKTIHNEKNSTSF
FT                   VNYKNSLKDKSRAVIKIKSIVNQNAQFTKAFQNCNTILLSDDATIFAQPHLEIYIDELE
FT                   ASHGTTTGTLNEEQLLYLQSRGIRKEKAYDMLLNAFESSIKDNIKDEKIKEFIENYKKE
FT                   KYV"
FT   gene            complement(609739..610509)
FT                   /gene="sufC"
FT                   /locus_tag="Abu_0610"
FT   CDS_pept        complement(609739..610509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="Abu_0610"
FT                   /product="Fe-S assembly ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Pfam match to PF00005 ABC_tran, score 105.8, E-value
FT                   1.2E-028"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66875"
FT                   /db_xref="GOA:A8ESF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF1"
FT                   /protein_id="ABV66875.1"
FT                   /translation="MSKKLLLKIEDLKVSIKDKEILKGLNLEINEGEVHVLMGTNGAGK
FT                   STLVKTLSAHYDCVVNEGKITYKNKNLLEMDVAQRANEGIFMSFQSPVEVPGVNNSYFL
FT                   KTALNEKRVYQGLEPIDAMEFLKHIKEETAKFNIDRKLLQRDLNDGFSGGEKKRNELVQ
FT                   LLMLQPDLIMLDEIDSGLDVDAIKTVANVINSMLDGKRSILMITHYDRLIELIKPDFVH
FT                   ILNDGKIAKTGDYNLALELDEKGYEAIGIKDENR"
FT   gene            complement(610513..611982)
FT                   /gene="sufB"
FT                   /locus_tag="Abu_0611"
FT   CDS_pept        complement(610513..611982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="Abu_0611"
FT                   /product="Fe-S assembly ABC transporter, permease protein"
FT                   /note="Pfam match to PF01458 UPF0051, score 449.6, E-value
FT                   3.7E-132"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66876"
FT                   /db_xref="GOA:A8ESF2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF2"
FT                   /protein_id="ABV66876.1"
FT                   /translation="MSYLKKKYGVVMSDNQQIHDVINKEYKLGFETLVQSDTFEKGLNE
FT                   DVIRAISAKKDEPSWLLDFRLKAYEKWLKMEEPTWANLKYPKIDYQDIAYYSAPKKALN
FT                   SLDEVDPEILKTYEKLGIPLEEQKQLAGVAVDAVFDSVSVKTTYQEELEKLGIIFCSIS
FT                   EAAHKYPELVKNYLASVVPTVDNYFSCLNSAVFTDGSFVYIPPNTRCPMELSTYFRINA
FT                   LNTGQFERTLIICDENSYVSYNEGCSAPTRDERQLHAAVVELCALKNAHIKYSTIQNWF
FT                   PGDDKGKGGILNFVTKRGLCKGDNSKISWTQVETGSAITWKYPSCVLQGDNSVGEFYSV
FT                   AIASKSQQADTGTKMIHLGKNTKSTIISKGISAMHGVNAYRGLVKVGKNAQNARNISEC
FT                   DSLLIGHKCQAHTYPYHEIRNSSANIEHEATTSKISDEQLFYLNQRGIDEENAIAMIVN
FT                   GFCKEVLKELPMEFAAEAKELLNISLEGSVG"
FT   gene            612179..613375
FT                   /gene="iscS"
FT                   /locus_tag="Abu_0612"
FT   CDS_pept        612179..613375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="Abu_0612"
FT                   /product="cysteine desulfurase/aminotransferase
FT                   (IscS/NifS)"
FT                   /EC_number="2.8.1.7"
FT                   /note="Pfam match to PF00266 Aminotran_5, score 321,
FT                   E-value 1.9E-093"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66877"
FT                   /db_xref="GOA:A8ESF3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017773"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF3"
FT                   /protein_id="ABV66877.1"
FT                   /translation="MEVYLDNNATTMVDPKVYEEMKPFFCDIYGNPNSLHKFGAGTHPK
FT                   MVEALNFLYEGINAADEDDVIITANATESNNAVLKGIWIDKILNGDKKHIITSEVEHPS
FT                   ITAVCRFLEKQGVKVTYLKVNEEGVLEANAIKNAIKEDTALVSIMWANNETGKIFPIKE
FT                   IGAICKEAGVAFHTDATQAIGKIVVDVQDVNVDYLSFSAHKFHGPKGVGGLYIRKGYAL
FT                   TPLLHGGEQMGGNRAGTVDVASMVGMGWAMKLATSTMALAYEKNHVSKLRDKLESAILE
FT                   LPETVVIGGKENRTPNTTLISIRGVEGESMLWDLNQAGIGASTGSACASEDLEANPVMN
FT                   AFGSDSELAHTGVRFSLSRFNTEEQIDYAIDVIKKAVTRLRQISSSYAYTPSCHKSGL"
FT   gene            613406..614386
FT                   /gene="iscU"
FT                   /locus_tag="Abu_0613"
FT   CDS_pept        613406..614386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="Abu_0613"
FT                   /product="NifU-like protein"
FT                   /note="Pfam matches to PF01592 NifU_N, score 203.6, E-value
FT                   4.1E-058, and to PF01106 NifU, score 92.6, E-value
FT                   1.1E-024, and to PF04324 Fer2_BFD, score 46.3, E-value
FT                   9.5E-011"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66878"
FT                   /db_xref="GOA:A8ESF4"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF4"
FT                   /protein_id="ABV66878.1"
FT                   /translation="MAKNSLISGSIWDEYSNQVVNRMNNPKHQGEITEERAAELGARLI
FT                   VADFGAESCGDAVRLYWAVDEKTHKILESKFKSFGCGTAIASSDVMAELCIGKTVDEAV
FT                   KITNIDVEFALRDNPETPAVPPQKMHCSVMAYDVIKKAAAEYKGVDIDSFEEEQIVCEC
FT                   ARVSLATLKEVIRINDLKTVEEITDYTKAGAFCKSCIRPGGHEEKDIYLVDVLRDVRAE
FT                   MEQEKLKNAANASAAGTISFSEMTLVQRIKAIDSVLDEDIRPMLVMDGGNMEIIDIKEN
FT                   LPHYDLYIRYLGSCSGCASGSTGTLYAIESILQQKIDDNIRVLPI"
FT   gene            614517..615140
FT                   /locus_tag="Abu_0614"
FT                   /note="AB0614"
FT   CDS_pept        614517..615140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF00571 CBS, score 94.2, E-value
FT                   3.6E-025"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66879"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF5"
FT                   /protein_id="ABV66879.1"
FT                   /translation="MFTIYNNGTVGFRSTSDNLYNLQTVEEAEPVRFEPKDGLVQDFSN
FT                   ELNKQHKQDFLESYKKIANLDTLEPVYQIKDIMTKDVIYMDNKSTVEDVYNTIRSKKVH
FT                   QIPITAFGKKIIGIVNKKVILNLLMNDIENAQEILKRKIEDIYLPEILTAEPESDVRKV
FT                   VQIMLDLKLDAIPIVDENDVLMGIVSKTDILKAVSHLPKLQLWS"
FT   gene            complement(615142..616389)
FT                   /locus_tag="Abu_0615"
FT                   /note="AB0615"
FT   CDS_pept        complement(615142..616389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0615"
FT                   /product="GGDEF domain protein"
FT                   /note="Pfam match to PF00990 GGDEF, score 142, E-value
FT                   1.3E-040"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66880"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF6"
FT                   /protein_id="ABV66880.1"
FT                   /translation="MENIKEITKNTLSELKNQDLETTPENYFIEFKKQADILDIKLDEF
FT                   KLFDKIKNSLTTDEKSQLKVDSFNKLSSILTKRTTAEELKALIEVFNDILTPSINFDYI
FT                   ENIEDFICEIMKNPKKLTNKNTIFKLKEFASQRIDADRKVLKDKTNDIVKLTSLMSRYF
FT                   DKTLNDSDSSTDEIVRIKDDLINLNISNSSHRELRVVQKKLIDTIYKIENSIKENNKIL
FT                   SNNIEKFKFLNRQIEELQKELILVKEEQQFDFLTSLLNRRAYQEEVKKVEKQFTIFGSD
FT                   FAIVFIDIDHFKNINDVYGHACGDAILKNFATILKDLTRKEDIISRYGGEEFVALVNYQ
FT                   SETEIQRYIKRVKTALQNHVFIYKTQQLQIEFSAGVAFRNKYHSFAEAEASADKLLYKA
FT                   KNKGRNKVIFDDEIEL"
FT   gene            616464..617864
FT                   /gene="argH"
FT                   /locus_tag="Abu_0616"
FT   CDS_pept        616464..617864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="Abu_0616"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="Pfam match to PF00206 Lyase_1, score 259.9, E-value
FT                   4.9E-075"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66881"
FT                   /db_xref="GOA:A8ESF7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ESF7"
FT                   /protein_id="ABV66881.1"
FT                   /translation="MSNQNNQNNQILKNTNAQILDEFNASIMFDKELYAQDIKGSIAHS
FT                   KMLASQGILTNEEQKAIEKGLFQVKSEIESGEFKFSLAYEDIHMAVETRLTEIIGEPGK
FT                   KLHTARSRNDQVCTDFTLYVQDKTLSIKEQLKELVATFVDIASLHTTTLIPGMTHLQHA
FT                   QPLNFGFHLLAYANMFKRDYERFESSFERNNYSPLGSAALAGTPHNINRELTAQTLGFT
FT                   APTLNAMDTVSNRDFALEILFNISTTMMHISRISEELILWSSYEFQFVRMSDQYATTSS
FT                   IMPQKKNPDVPELLRGKTGRVYGNLISLLTVMKGLPLAYNKDTQEDKEGVFDSVKTVEI
FT                   SISILNEVIKTMIVNVDKMQNACKIGHLTATDLADYLVQKQNMPFRTAYYITKDVVALA
FT                   NSLNKDISELSIDEIRKANDELKNINEDIVLYLDLKNSMNARNSFGGTSTKQTESQIEY
FT                   FKKWLENK"
FT   gene            complement(617884..618792)
FT                   /gene="cheV"
FT                   /locus_tag="Abu_0617"
FT   CDS_pept        complement(617884..618792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheV"
FT                   /locus_tag="Abu_0617"
FT                   /product="chemotaxis signal transduction protein CheV"
FT                   /note="Pfam matches to PF00072 Response_reg, score 45.7,
FT                   E-value 1.5E-013, and to PF01584 CheW, score 36.7, E-value
FT                   7.4E-008"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66882"
FT                   /db_xref="GOA:A8ESF8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF8"
FT                   /protein_id="ABV66882.1"
FT                   /translation="MSGISGSVEQMTQGHLRNVQQLAVFYTGHNNIYAINIAKVKAFII
FT                   TEEVAINDTPKDSDIIAGIATIRGEPVTLINLDAWLGLKALDVRDYKLIIFCEFNHKKI
FT                   GFLVKDMLDIVEKTTQDLRHTEETNSKITYTTYVKVNNKDELCTVFNAEQLLRDIKWTD
FT                   DGDDDVRKYVGEELHSNKVVLAAEDSGVAREVLTKFFQKTGVKYEVYANGGLLISRLEE
FT                   LNPSEVGMVVTDIEMPGTDGYQVASFIKNNSKYSHIPVVVNSSMTTDAVRGKMNQIGVD
FT                   GFVGKTDISTLYDLTKRFLIR"
FT   gene            complement(618843..619502)
FT                   /locus_tag="Abu_0618"
FT                   /note="AB0618"
FT   CDS_pept        complement(618843..619502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0618"
FT                   /product="MoeB/ThiF family protein"
FT                   /note="Pfam match to PF00899 ThiF, score 101.6, E-value
FT                   2.2E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66883"
FT                   /db_xref="GOA:A8ESF9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESF9"
FT                   /protein_id="ABV66883.1"
FT                   /translation="MKYDRTIKLFGQETFDKFKDVKLILFGVGGIGSFALDALYNTGIT
FT                   NITIVDFDTYEDSNMNRQLGSHGNIGRIKVEVLKEKYPEVTPIHVKVTPEWIDNFDFSS
FT                   YDYILDAIDDIKPKVHLIKKHFTKVISTSGGAKRIDATKLEYISIWDTYNDQFIKKVRT
FT                   ELKNQGFKKKFKVVFSSEVPLCVEKGSFEGVTASFGLMMASVTVQKLLKKMKKAKD"
FT   gene            619565..620050
FT                   /gene="greA"
FT                   /locus_tag="Abu_0619"
FT   CDS_pept        619565..620050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="Abu_0619"
FT                   /product="transcription elongation factor GreA"
FT                   /note="Pfam matches to PF01272 GreA_GreB, score 117.5,
FT                   E-value 3.5E-032, and to PF03449 GreA_GreB_N, score 99.7,
FT                   E-value 7.8E-027"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66884"
FT                   /db_xref="GOA:A8ESG0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ESG0"
FT                   /protein_id="ABV66884.1"
FT                   /translation="MEKEPMTLAGYNKVTAELDFLKKTERPETVIALDEARQLGDLKEN
FT                   AEYHSAKEKLKLIDIQIAELNAVISKAVIIDPTTLPHDRVSFGSTIDLVDVDTDEEFTY
FT                   TIVGGVESSAEKGMISFNSPLAKQLMGKEAGDELNATLPGGAKTFEILKVYYKEISL"
FT   gene            620063..620761
FT                   /locus_tag="Abu_0620"
FT                   /note="AB0620"
FT   CDS_pept        620063..620761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="Pfam match to PF00149 Metallophos, score 30.7,
FT                   E-value 4.8E-006"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66885"
FT                   /db_xref="GOA:A8ESG1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESG1"
FT                   /protein_id="ABV66885.1"
FT                   /translation="MNLQIKDEAIFVADSHFNQKNQEFLQLLKKIENKEINISQLFLMG
FT                   DIFDFLSCECKYFIKQNIEVITLLNKLSNDIEIIYLEGNHDFNLQNLFSNIKVIKRENQ
FT                   PFFVKIEEKKVALSHGDNFLDWKYELFCKLIRNSIFLKFMNFIDINFFISKKLEQALLN
FT                   KNICHNILNFENIVEKRVKNYSDDIIIEGHYHQGKTLIFKNQKYINIASLCCQKEYLRF
FT                   KNDEFIKEMI"
FT   gene            620773..622746
FT                   /gene="uvrB"
FT                   /locus_tag="Abu_0621"
FT   CDS_pept        620773..622746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="Abu_0621"
FT                   /product="excinuclease ABC, subunit B"
FT                   /note="Pfam matches to PF00271 Helicase_C, score 66.3,
FT                   E-value 9.6E-022, and to PF02151 UVR, score 46.5, E-value
FT                   8.4E-011, and to PF04851 ResIII, score 28.9, E-value
FT                   1E-007"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66886"
FT                   /db_xref="GOA:A8ESG2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESG2"
FT                   /protein_id="ABV66886.1"
FT                   /translation="MAKFKVVSDYEPSGDQPKAIEALSSSIKAGNQYNTLLGVTGSGKT
FT                   YTIAKVIEKVQKPTLIMTHNKTLAAQLYSEFKQFFPNNHVEYFISYYDYYQPEAYIPRS
FT                   DLFIEKDSSINDELERLRLSATASLLSFDDVIVIASVSANYGLGNPSEYKAMVQRVEVG
FT                   FNYSQKEFLLKLIEMGYKRNDKFFDRADFRVNGDVIDIFPAYFEDEFIRVEFFGDEVES
FT                   ITKHEYITNTKTKDLNEVIIYSVNPFVVTQENLGRAVKEIEEELERRLDFFQKEQKLVE
FT                   YQRLKQRVEFDLEMIEGTGMCKGIENYARHLTGQKAGETPYSLLDYFEQMDEDFLLVVD
FT                   ESHVSLPQFRGMHAADRSRKEVLVEYGFRLPSALDNRPLKFDEFINKAPHYVFVSATPN
FT                   ELELEMSSVVAEQIIRPTGLLDPIIDIIDSEFQVEKLHDEIKKVIAKNERVLVTVLTKK
FT                   MAEELASYYADLGIKVKYMHSEIDAIERNQIIRELRLGTFDVLIGINLLREGLDIPETS
FT                   LVAILDADKEGFLRSKTSLIQTIGRAARNENGRVILFAKRITASMQFAIDETNRRRKLQ
FT                   EEFNKEHNITPKSTKRKLDENLKLEEYDDVAWKKQKLEKMPASERKKILIELNKQMKKA
FT                   ASDLNFEEAIRLRDEIAKIKDI"
FT   gene            622837..624720
FT                   /locus_tag="Abu_0622"
FT                   /note="AB0622"
FT   CDS_pept        622837..624720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Abu_0622"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Pfam match to PF00015 MCPsignal, score 153.2,
FT                   E-value 6E-043"
FT                   /db_xref="EnsemblGenomes-Gn:Abu_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABV66887"
FT                   /db_xref="GOA:A8ESG3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A8ESG3"
FT                   /protein_id="ABV66887.1"
FT                   /translation="MVISVKQKIFISLMTISLFASISFGIFIYYSQKNTFYDSMQNQLR
FT                   AGINATSLYLGEDFVDKYTLDNPIDADLHLNYIKKLSEFAKKINLEYIYVMTKESDNKV
FT                   HTAISSATDEELKSGEYDEFMIEYDASEMVQNGFKKNNEFFENTIDKYGHFYTLIISKE
FT                   SPTGKIYLIGADIELSFIQKALNSILIDTVLITLLIQAIAIIFAYLMSNSIGKKINSTQ
FT                   KGILDFFDFLSRKRQKASYLEIKQLDEFGIMAKTINENIDFIEKGIIADNNIVNEFVNI
FT                   SNQIQSGNLNGKINLEASNPQLSELKNVFNKMVFMLNTNITSILEILEKYSKYDFTNNI
FT                   KNKDLQGEIGKLVLGINNLGSEITNMLSNSMKNGLSLEKSSNILLNNVNLLNKSSNEAA
FT                   VALEETAGALEEITNNIRQSTQNISDMSCLASNLEKSSNDGEKLAHKTTNSMSNINNQV
FT                   DLINEAISVIDQIAFQTNILSLNAAVEAATAGEAGRGFAVVAGEVRNLANRSAQAAKEI
FT                   KDIVEKAKEITSEGKDVADEMINGYVKLNQDITSTISLINDVQNSSKEQLQGIEQINNS
F