(data stored in ACNUC7421 zone)

EMBL: CP000362

ID   CP000362; SV 1; circular; genomic DNA; STD; PRO; 4133097 BP.
XX
AC   CP000362;
XX
PR   Project:PRJNA16426;
XX
DT   23-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Roseobacter denitrificans OCh 114, complete genome.
XX
KW   .
XX
OS   Roseobacter denitrificans OCh 114
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Roseobacter.
XX
RN   [1]
RP   1-4133097
RX   DOI; 10.1128/JB.01390-06.
RX   PUBMED; 17098896.
RA   Swingley W.D., Sadekar S., Mastrian S.D., Matthies H.J., Hao J., Ramos H.,
RA   Acharya C.R., Conrad A.L., Taylor H.L., Dejesa L.C., Shah M.K.,
RA   O'huallachain M.E., Lince M.T., Blankenship R.E., Beatty J.T.,
RA   Touchman J.W.;
RT   "The complete genome sequence of Roseobacter denitrificans reveals a
RT   mixotrophic rather than photosynthetic metabolism";
RL   J. Bacteriol. 189(3):683-690(2007).
XX
RN   [2]
RP   1-4133097
RA   Touchman J.W.;
RT   ;
RL   Submitted (13-APR-2006) to the INSDC.
RL   DNA Sequencing Center, Translational Genomics Research Institute, 445 N.
RL   Fifth Street, Phoenix, AZ 85004, USA
XX
DR   MD5; d089945ddb597976766bad558d6f8435.
DR   BioSample; SAMN02602987.
DR   EnsemblGenomes-Gn; EBG00001036510.
DR   EnsemblGenomes-Gn; EBG00001036513.
DR   EnsemblGenomes-Gn; EBG00001036515.
DR   EnsemblGenomes-Gn; EBG00001036518.
DR   EnsemblGenomes-Gn; EBG00001036519.
DR   EnsemblGenomes-Gn; EBG00001036520.
DR   EnsemblGenomes-Gn; EBG00001036521.
DR   EnsemblGenomes-Gn; EBG00001036522.
DR   EnsemblGenomes-Gn; EBG00001036523.
DR   EnsemblGenomes-Gn; EBG00001036524.
DR   EnsemblGenomes-Gn; EBG00001036525.
DR   EnsemblGenomes-Gn; EBG00001036526.
DR   EnsemblGenomes-Gn; EBG00001036527.
DR   EnsemblGenomes-Gn; EBG00001036528.
DR   EnsemblGenomes-Gn; EBG00001036530.
DR   EnsemblGenomes-Gn; EBG00001036532.
DR   EnsemblGenomes-Gn; EBG00001036534.
DR   EnsemblGenomes-Gn; EBG00001036535.
DR   EnsemblGenomes-Gn; EBG00001036536.
DR   EnsemblGenomes-Gn; EBG00001036537.
DR   EnsemblGenomes-Gn; EBG00001036538.
DR   EnsemblGenomes-Gn; EBG00001036540.
DR   EnsemblGenomes-Gn; EBG00001036541.
DR   EnsemblGenomes-Gn; EBG00001036542.
DR   EnsemblGenomes-Gn; EBG00001036543.
DR   EnsemblGenomes-Gn; EBG00001036545.
DR   EnsemblGenomes-Gn; EBG00001036547.
DR   EnsemblGenomes-Gn; EBG00001036548.
DR   EnsemblGenomes-Gn; EBG00001036550.
DR   EnsemblGenomes-Gn; EBG00001036552.
DR   EnsemblGenomes-Gn; EBG00001036553.
DR   EnsemblGenomes-Gn; EBG00001036555.
DR   EnsemblGenomes-Gn; EBG00001036556.
DR   EnsemblGenomes-Gn; EBG00001036557.
DR   EnsemblGenomes-Gn; EBG00001036558.
DR   EnsemblGenomes-Gn; EBG00001036559.
DR   EnsemblGenomes-Gn; EBG00001036560.
DR   EnsemblGenomes-Gn; EBG00001036561.
DR   EnsemblGenomes-Gn; EBG00001036562.
DR   EnsemblGenomes-Gn; EBG00001036563.
DR   EnsemblGenomes-Gn; EBG00001036565.
DR   EnsemblGenomes-Gn; EBG00001036568.
DR   EnsemblGenomes-Gn; EBG00001036570.
DR   EnsemblGenomes-Gn; EBG00001036573.
DR   EnsemblGenomes-Gn; EBG00001036574.
DR   EnsemblGenomes-Gn; EBG00001036576.
DR   EnsemblGenomes-Gn; RD1_0066.
DR   EnsemblGenomes-Gn; RD1_0233.
DR   EnsemblGenomes-Gn; RD1_0459.
DR   EnsemblGenomes-Gn; RD1_0714.
DR   EnsemblGenomes-Gn; RD1_0717.
DR   EnsemblGenomes-Gn; RD1_0727.
DR   EnsemblGenomes-Gn; RD1_0728.
DR   EnsemblGenomes-Gn; RD1_0729.
DR   EnsemblGenomes-Gn; RD1_0730.
DR   EnsemblGenomes-Gn; RD1_0731.
DR   EnsemblGenomes-Gn; RD1_0760.
DR   EnsemblGenomes-Gn; RD1_0780.
DR   EnsemblGenomes-Gn; RD1_0791.
DR   EnsemblGenomes-Gn; RD1_0812.
DR   EnsemblGenomes-Gn; RD1_0994.
DR   EnsemblGenomes-Gn; RD1_1063.
DR   EnsemblGenomes-Gn; RD1_1148.
DR   EnsemblGenomes-Gn; RD1_1257.
DR   EnsemblGenomes-Gn; RD1_1285.
DR   EnsemblGenomes-Gn; RD1_1466.
DR   EnsemblGenomes-Gn; RD1_1810.
DR   EnsemblGenomes-Gn; RD1_1844.
DR   EnsemblGenomes-Gn; RD1_1853.
DR   EnsemblGenomes-Gn; RD1_1971.
DR   EnsemblGenomes-Gn; RD1_1972.
DR   EnsemblGenomes-Gn; RD1_2206.
DR   EnsemblGenomes-Gn; RD1_2227.
DR   EnsemblGenomes-Gn; RD1_2248.
DR   EnsemblGenomes-Gn; RD1_2251.
DR   EnsemblGenomes-Gn; RD1_2301.
DR   EnsemblGenomes-Gn; RD1_2317.
DR   EnsemblGenomes-Gn; RD1_2324.
DR   EnsemblGenomes-Gn; RD1_2483.
DR   EnsemblGenomes-Gn; RD1_2512.
DR   EnsemblGenomes-Gn; RD1_2535.
DR   EnsemblGenomes-Gn; RD1_2571.
DR   EnsemblGenomes-Gn; RD1_2574.
DR   EnsemblGenomes-Gn; RD1_2669.
DR   EnsemblGenomes-Gn; RD1_2688.
DR   EnsemblGenomes-Gn; RD1_2717.
DR   EnsemblGenomes-Gn; RD1_2788.
DR   EnsemblGenomes-Gn; RD1_2830.
DR   EnsemblGenomes-Gn; RD1_2833.
DR   EnsemblGenomes-Gn; RD1_3068.
DR   EnsemblGenomes-Gn; RD1_3159.
DR   EnsemblGenomes-Gn; RD1_3195.
DR   EnsemblGenomes-Gn; RD1_3312.
DR   EnsemblGenomes-Gn; RD1_3378.
DR   EnsemblGenomes-Gn; RD1_3440.
DR   EnsemblGenomes-Gn; RD1_3454.
DR   EnsemblGenomes-Gn; RD1_3463.
DR   EnsemblGenomes-Gn; RD1_3566.
DR   EnsemblGenomes-Gn; RD1_3983.
DR   EnsemblGenomes-Gn; RD1_4010.
DR   EnsemblGenomes-Gn; RD1_4088.
DR   EnsemblGenomes-Tr; EBT00001639528.
DR   EnsemblGenomes-Tr; EBT00001639529.
DR   EnsemblGenomes-Tr; EBT00001639530.
DR   EnsemblGenomes-Tr; EBT00001639531.
DR   EnsemblGenomes-Tr; EBT00001639532.
DR   EnsemblGenomes-Tr; EBT00001639533.
DR   EnsemblGenomes-Tr; EBT00001639534.
DR   EnsemblGenomes-Tr; EBT00001639535.
DR   EnsemblGenomes-Tr; EBT00001639536.
DR   EnsemblGenomes-Tr; EBT00001639537.
DR   EnsemblGenomes-Tr; EBT00001639538.
DR   EnsemblGenomes-Tr; EBT00001639539.
DR   EnsemblGenomes-Tr; EBT00001639540.
DR   EnsemblGenomes-Tr; EBT00001639541.
DR   EnsemblGenomes-Tr; EBT00001639542.
DR   EnsemblGenomes-Tr; EBT00001639543.
DR   EnsemblGenomes-Tr; EBT00001639544.
DR   EnsemblGenomes-Tr; EBT00001639545.
DR   EnsemblGenomes-Tr; EBT00001639546.
DR   EnsemblGenomes-Tr; EBT00001639547.
DR   EnsemblGenomes-Tr; EBT00001639548.
DR   EnsemblGenomes-Tr; EBT00001639549.
DR   EnsemblGenomes-Tr; EBT00001639550.
DR   EnsemblGenomes-Tr; EBT00001639551.
DR   EnsemblGenomes-Tr; EBT00001639552.
DR   EnsemblGenomes-Tr; EBT00001639553.
DR   EnsemblGenomes-Tr; EBT00001639554.
DR   EnsemblGenomes-Tr; EBT00001639555.
DR   EnsemblGenomes-Tr; EBT00001639556.
DR   EnsemblGenomes-Tr; EBT00001639557.
DR   EnsemblGenomes-Tr; EBT00001639558.
DR   EnsemblGenomes-Tr; EBT00001639559.
DR   EnsemblGenomes-Tr; EBT00001639560.
DR   EnsemblGenomes-Tr; EBT00001639561.
DR   EnsemblGenomes-Tr; EBT00001639562.
DR   EnsemblGenomes-Tr; EBT00001639563.
DR   EnsemblGenomes-Tr; EBT00001639564.
DR   EnsemblGenomes-Tr; EBT00001639565.
DR   EnsemblGenomes-Tr; EBT00001639566.
DR   EnsemblGenomes-Tr; EBT00001639567.
DR   EnsemblGenomes-Tr; EBT00001639568.
DR   EnsemblGenomes-Tr; EBT00001639569.
DR   EnsemblGenomes-Tr; EBT00001639570.
DR   EnsemblGenomes-Tr; EBT00001639571.
DR   EnsemblGenomes-Tr; EBT00001639572.
DR   EnsemblGenomes-Tr; EBT00001639573.
DR   EnsemblGenomes-Tr; RD1_0066-1.
DR   EnsemblGenomes-Tr; RD1_0233-1.
DR   EnsemblGenomes-Tr; RD1_0459.
DR   EnsemblGenomes-Tr; RD1_0714.
DR   EnsemblGenomes-Tr; RD1_0717-1.
DR   EnsemblGenomes-Tr; RD1_0727-1.
DR   EnsemblGenomes-Tr; RD1_0728-1.
DR   EnsemblGenomes-Tr; RD1_0729-1.
DR   EnsemblGenomes-Tr; RD1_0730-1.
DR   EnsemblGenomes-Tr; RD1_0731-1.
DR   EnsemblGenomes-Tr; RD1_0760.
DR   EnsemblGenomes-Tr; RD1_0780.
DR   EnsemblGenomes-Tr; RD1_0791.
DR   EnsemblGenomes-Tr; RD1_0812-1.
DR   EnsemblGenomes-Tr; RD1_0994-1.
DR   EnsemblGenomes-Tr; RD1_1063-1.
DR   EnsemblGenomes-Tr; RD1_1148-1.
DR   EnsemblGenomes-Tr; RD1_1257-1.
DR   EnsemblGenomes-Tr; RD1_1285-1.
DR   EnsemblGenomes-Tr; RD1_1466-1.
DR   EnsemblGenomes-Tr; RD1_1810-1.
DR   EnsemblGenomes-Tr; RD1_1844-1.
DR   EnsemblGenomes-Tr; RD1_1853-1.
DR   EnsemblGenomes-Tr; RD1_1971-1.
DR   EnsemblGenomes-Tr; RD1_1972-1.
DR   EnsemblGenomes-Tr; RD1_2206.
DR   EnsemblGenomes-Tr; RD1_2227-1.
DR   EnsemblGenomes-Tr; RD1_2248-1.
DR   EnsemblGenomes-Tr; RD1_2251-1.
DR   EnsemblGenomes-Tr; RD1_2301-1.
DR   EnsemblGenomes-Tr; RD1_2317.
DR   EnsemblGenomes-Tr; RD1_2324.
DR   EnsemblGenomes-Tr; RD1_2483.
DR   EnsemblGenomes-Tr; RD1_2512-1.
DR   EnsemblGenomes-Tr; RD1_2535-1.
DR   EnsemblGenomes-Tr; RD1_2571.
DR   EnsemblGenomes-Tr; RD1_2574-1.
DR   EnsemblGenomes-Tr; RD1_2669-1.
DR   EnsemblGenomes-Tr; RD1_2688-1.
DR   EnsemblGenomes-Tr; RD1_2717-1.
DR   EnsemblGenomes-Tr; RD1_2788-1.
DR   EnsemblGenomes-Tr; RD1_2830-1.
DR   EnsemblGenomes-Tr; RD1_2833-1.
DR   EnsemblGenomes-Tr; RD1_3068-1.
DR   EnsemblGenomes-Tr; RD1_3159-1.
DR   EnsemblGenomes-Tr; RD1_3195-1.
DR   EnsemblGenomes-Tr; RD1_3312.
DR   EnsemblGenomes-Tr; RD1_3378-1.
DR   EnsemblGenomes-Tr; RD1_3440-1.
DR   EnsemblGenomes-Tr; RD1_3454.
DR   EnsemblGenomes-Tr; RD1_3463-1.
DR   EnsemblGenomes-Tr; RD1_3566-1.
DR   EnsemblGenomes-Tr; RD1_3983.
DR   EnsemblGenomes-Tr; RD1_4010-1.
DR   EnsemblGenomes-Tr; RD1_4088.
DR   EuropePMC; PMC1797316; 17098896.
DR   EuropePMC; PMC2811117; 20021642.
DR   EuropePMC; PMC3150298; 21714912.
DR   EuropePMC; PMC3330761; 22566756.
DR   EuropePMC; PMC4127530; 25157246.
DR   EuropePMC; PMC4543880; 26347732.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01727; SAM-SAH.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000362.
DR   SILVA-SSU; CP000362.
DR   StrainInfo; 109965; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4133097
FT                   /organism="Roseobacter denitrificans OCh 114"
FT                   /strain="OCh 114"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Roseobacter denitrificans"
FT                   /db_xref="taxon:375451"
FT   gene            1723..2871
FT                   /locus_tag="RD1_0003"
FT   CDS_pept        1723..2871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0003"
FT                   /product="aminomethyltransferase, putative"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29743"
FT                   /db_xref="GOA:Q16E50"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E50"
FT                   /protein_id="ABG29743.1"
FT                   /translation="MAIIYRTSALAQRHAEIGGELEDWNGMGTAWFYDHSDERAKADYE
FT                   AVRTKAGLMDVSGLKKIHLSGPHAAAVIDRATTRNVDKLMPGRAVYAAMLDDRGLFIDD
FT                   CVIYRLSVNNWLLVHGTGTGHESLAMAAYGKNVSMIFDDDLHDMSLQGPVAVDFLAKHV
FT                   PGIRDLAYFGIIQTKLFGMPVMISRTGYTGERGYEIFCEGRHAIALWDAILEDGKDMGI
FT                   RPVQFSTLDLLRTESYLLFYPGDNSETYPFENGAACGDSLWELGLEFTVSPGKTGFRGA
FT                   ENHYALEGKERFKIYGVRLEGTTAADEGADLLKDGEKVGVVTYGMRSDLFDHTVGIARM
FT                   PVECATPGTKMTVRNGDGTEIPCVAEEMPFYDKDKAIRTAKG"
FT   gene            2948..3556
FT                   /locus_tag="RD1_0004"
FT   CDS_pept        2948..3556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29744"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E49"
FT                   /protein_id="ABG29744.1"
FT                   /translation="MSKFQFPKSIRSRPVYGTLTPRRGKSHLMIADAEGAEALLDLAQQ
FT                   DAEVFRTAHLIYIPKATGETYVEKLKALKPAQFYVGPSYEASVSRIRRVLSDAHMGLQV
FT                   YLTGTEGLMGQAMNEAMTAGIPHQAIQTEHRGSVARRMQCVHCKGITEDVMTDPFQCTH
FT                   CGLHLFVRDHYSRRLAAFQGVCIDAEDPGNIPEPVELYK"
FT   gene            3553..4539
FT                   /gene="vanB"
FT                   /locus_tag="RD1_0005"
FT   CDS_pept        3553..4539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanB"
FT                   /locus_tag="RD1_0005"
FT                   /product="vanillate O-demethylase oxidoreductase, putative"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29745"
FT                   /db_xref="GOA:Q16E48"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E48"
FT                   /protein_id="ABG29745.1"
FT                   /translation="MSAAPQKAKAGAEKIEVEVSAIVPVNELVSRFEFKRRDGQPFPPF
FT                   SAGAHTVVEMNDNGRMRLNPYSLMSDPADTSIYAISVRRDDEGRGGSLFMHRHVKVGDP
FT                   MTITYPVNLFPLDLRGHKHVFLAGGIGITPFLSMIATLERMGGRWEMHYACRSKALGSY
FT                   VDELTGRHPDKVHVYCDDQDEAIPLESLLDGQPLGTHVYVCGPAGMINWVHSTAEAHGW
FT                   PKEHVHSEEFLAPQPGKPFEVRLCKSDIVIQVGEHESLLEAIERCGVQAPFLCRGGACG
FT                   QCETDVVEADGEFIHRDHWLEEEEHASGKKIMPCVSRFVGKTLVLDR"
FT   gene            4551..5618
FT                   /locus_tag="RD1_0006"
FT   CDS_pept        4551..5618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29746"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E47"
FT                   /protein_id="ABG29746.1"
FT                   /translation="MTIQFNTETFRDDYSFRNSDWAIKRFPFPFHEDSYMYSVNMEQHR
FT                   GGPKGSVYEMRFDVDEHYVSEMADRAIVLAEDPLRCQSLPHMTLAGWDTLELIMVSKSE
FT                   DYPDLFELHRDGNRWRWINKPMDIDHTFTFLDETTLPCGPLEYITRQAQGDYAVLDQRD
FT                   DMLYMDAGMVTTQADWSLDFDIGMDFFEWHAPVPLAHEMGIFKRALKFLLNIQQGAPAR
FT                   RLNWTMTVNPLLDTSPENYHKWGVQKTTLTPENIGSKQHLRVELQTFYRLPRSNALLFP
FT                   IRCYLISFQDLVTIPKWGRRLHRVIRDLPEELATYKGFIDNRPLMLDYLSRYDDGLPTS
FT                   PGVWPDLDTEPSLQK"
FT   gene            complement(5659..6306)
FT                   /locus_tag="RD1_0007"
FT   CDS_pept        complement(5659..6306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0007"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29747"
FT                   /db_xref="GOA:Q16E46"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E46"
FT                   /protein_id="ABG29747.1"
FT                   /translation="MNVDSTKTMTKLIQDPHGVREEREKVLEVAIGREVRAYRKQKGMT
FT                   VAELSRLTDLSIGMLSKIENGNTSPSLTTLQALANALSVPLTAFFKGFEEHREAVHTKA
FT                   GEGLEIERAGTRAGHHYDLLGHIGSNNSGVIVEPYLITLNTEADTFQTFQHEGIEMIYM
FT                   LEGKVGYMHGNAHYTLEAGDTLFFDADAPHGPEDLIELPARYLSVICYPQRS"
FT   gene            6341..7435
FT                   /gene="araC"
FT                   /locus_tag="RD1_0008"
FT   CDS_pept        6341..7435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="RD1_0008"
FT                   /product="transcriptional regulator, AraC family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29748"
FT                   /db_xref="GOA:Q16E45"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E45"
FT                   /protein_id="ABG29748.1"
FT                   /translation="MQHTRLATKGKRFSTYCKKILLRLKNVLHMTRSTTSPRSIGFLLF
FT                   PGFPMACLTSVIEPLRAANEISGATAFTWELIAEQPGPVASSAGIPFGPQSLLADVDAP
FT                   DYLLLLSAPSVRFADQRTPAHLRRLARHGCTLGAISGGVFPLVRSGAVEGARLSVHWCY
FT                   EAAFAAEFPDMLQSDEVIETSDRCVTASGAAAAFDLALGFIDTALGPNVATEVACWFQH
FT                   PMMRKIGVKQSVPAHLTDSIQNDLSPLVSDAIRIFAEDLSNPVSVAGVAKALNVSPRHL
FT                   ERSFKKAAGQNPTTYFRWLRMQAARQIVLYTNDAISDVAAAVGYASTKHFIRHYRAEYG
FT                   LSPQEDRKRINLYRTEGNRPVPSV"
FT   gene            complement(7540..8100)
FT                   /gene="soxG"
FT                   /locus_tag="RD1_0009"
FT   CDS_pept        complement(7540..8100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxG"
FT                   /locus_tag="RD1_0009"
FT                   /product="sarcosine oxidase, gamma subunit"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29749"
FT                   /db_xref="GOA:Q16E44"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E44"
FT                   /protein_id="ABG29749.1"
FT                   /translation="MHDLIPITPLGGQAPRVDTVGAVTVTEVTDRALASVAARMGAEKA
FT                   AGETLSKTIGAQAPAPSRLAGDTLSAFWTGPDQWMIEAPIDTHEDLAKQLVAAFGSTAS
FT                   ATEQTDAWCRFDLSGPHLPQVMEILCPVDTHIWRGGEATRTSIDHLGCFLLCRDPQTFS
FT                   VIGPRSSAGSLHHALLTACRAAL"
FT   gene            complement(8093..11044)
FT                   /gene="soxA"
FT                   /locus_tag="RD1_0010"
FT   CDS_pept        complement(8093..11044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA"
FT                   /locus_tag="RD1_0010"
FT                   /product="sarcosine oxidase, alpha subunit"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29750"
FT                   /db_xref="GOA:Q16E43"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E43"
FT                   /protein_id="ABG29750.1"
FT                   /translation="MNQINRLNGGLIDRKATKSFTFDGARYTGCAGDTLASALLANGVR
FT                   LMGRSFKYHRPRGPMTAGSEEPNAIVELRSGARSEPNTRATTAELFDGLSATSQNRWPS
FT                   LKWDAMAINDSLSPFLSAGFYYKTFMWPAAFWEKLYEPIIRRAAGLGSLSHEPDPDAYD
FT                   KGFLHCDLLIIGAGPAGLAAALTAGESGARVILADEDYVLGGRLASETGLLSDQDGHAW
FT                   AQEAVARLHAMPNVRVMSRSTVIGAFDHGVYGMLERVSDHLAEPAPGKPRQILWRVYSK
FT                   RAILAAGATERPIVFENNDRPGIMLASAMRAYANRWAVTLGKSVAVFTNNDDGHRTAVD
FT                   LRAKGVKVTVIDTRSDAVSKADYETIPGGVVVNTKGRLGLKCVDVRRASGGLRTLYVDG
FT                   LGVSGGWNPNVHMTCHQRGRPEWNDDLAAFVPGGTLPTGLIPAGAATGAFSTHAALASG
FT                   QDAACTALTDLGHTPTRPDLPAAEDAPLRISAFWHVKDAKRAWVDQQNDVTAKDVKLAH
FT                   QENFVSVEHLKRYTTLGMATDQGKTSNIAGLAIMAEVAGKQIPQVGTTMFRPPYTPTAI
FT                   GAFAGRSRDEDFRPVRKTPSHYWAEEQGAVFVEVGMWLRAQWFPKPGETNWRESVDREV
FT                   LQTRKSVGVCDCTTLGKIDVQGADAADFLNKVYANAFAKLAVGKTRYGLMLREDGIAMD
FT                   DGTAARLAEDHFVVTTTTANAVPVYRHMEFVRQCLFPDLDVQLISTTEAWAQYAVAGPN
FT                   SRKLLQKIVDPEFDISNEGFPFMACGEITVCGGLRARLFRISFSGELAFEIAVPTRYGD
FT                   ALMRRLMAEGEEFGVTPYGTEALSVMRIEKGHAAGNELNGTTSAHNLGMGRMVSKKKDC
FT                   IGNTLSERPGLTEEDALKLVGFKALNGTDKVPAGAHLITVGDPVDAAHDQGYITSACYS
FT                   PNLGCHIAIGYLKSGDSRMGEKVRLVSPLTGVDHEVEVVSAHFVDPEGERLRA"
FT   gene            complement(11041..11328)
FT                   /gene="soxD"
FT                   /locus_tag="RD1_0011"
FT   CDS_pept        complement(11041..11328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxD"
FT                   /locus_tag="RD1_0011"
FT                   /product="sarcosine oxidase, delta subunit"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29751"
FT                   /db_xref="GOA:Q16E42"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E42"
FT                   /protein_id="ABG29751.1"
FT                   /translation="MIIDHPLLGPRDAAEFVYKGDASLIHRPDWQADDAAAAFHEYGYL
FT                   RDNPAGLHRELWFHEQGDRSWLVVTRDTTTHEITKVELARDVARTEGRSK"
FT   gene            complement(11341..12591)
FT                   /gene="soxB"
FT                   /locus_tag="RD1_0012"
FT   CDS_pept        complement(11341..12591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB"
FT                   /locus_tag="RD1_0012"
FT                   /product="sarcosine oxidase, beta subunit"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29752"
FT                   /db_xref="GOA:Q16E41"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E41"
FT                   /protein_id="ABG29752.1"
FT                   /translation="MRYSGFAVLKEALTGHRGWGPAWRDASPQNAYDFVIIGGGGHGLA
FT                   TAYYLAKEFRQSRIAVLEKGWIGGGNVGRNTTIIRSNYLLDGNQPFYEFSLKLWEGLEQ
FT                   ELNYNAMVSQRGILNLIHTDAQRDAFIRRGNAMILNGADAELLSTEQIKQRYPFLNTEN
FT                   ARFPIKGGLAQHRGGTVRHDAVAWGYARAADQQGVDIIQNCEVTGFRIENGTCIGVETS
FT                   RGFIGAKKVAACVAGSSSRLMAKAEMRLPIESHVLQAFVSEGLKPLLPGVITFGAGHFY
FT                   CSQSDKGGLVFGGDLDGYNSYAQRGNLPVVEDVCEGGMAIFPNLGRARLLRMWGGIMDM
FT                   SMDGSPIIDRTHINGLYFNGGWCYGGFKATPASGFAYAHLLATDTPHPTATAYGFDRFA
FT                   TGHMIDEKGQGNQPNLH"
FT   gene            12850..13797
FT                   /gene="opuAC"
FT                   /locus_tag="RD1_0013"
FT   CDS_pept        12850..13797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /locus_tag="RD1_0013"
FT                   /product="glycine betaine transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29753"
FT                   /db_xref="GOA:Q16E40"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E40"
FT                   /protein_id="ABG29753.1"
FT                   /translation="MNKFTTALATGVLAFAPAFAMADSDDPIIIPIHNWSSQIVMSNVV
FT                   GQMFEEMGLNVEYVTTDSQAVYESIRLGDVTLGMEVWEGAFGASFRAAMEKGGIVDAGD
FT                   HNAVTREDWWYPMWTKDACPGLPSWEALNECAEIFATPETGDKGRYLDGPVDWLKHGKE
FT                   RVEALGMDFEVINAGSAAALWAEIGAAEADKRPIVVFNWTPNFAEAVWPGEFVEFPEWV
FT                   DGCDKDPAVGPNPDALYDCGNPADGYMKKAAWEGMEEKWPDAFAVLQRISFTNPQIAQM
FT                   AKLVDIEDYEPEEAAEIWLEENEDLWRPWLDASS"
FT   gene            13879..14913
FT                   /gene="opuAA"
FT                   /locus_tag="RD1_0014"
FT   CDS_pept        13879..14913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="RD1_0014"
FT                   /product="glycine betaine transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29754"
FT                   /db_xref="GOA:Q16E39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E39"
FT                   /protein_id="ABG29754.1"
FT                   /translation="MKDSMNVASDIVISAKNVWKVFGNNPEAYLKTMTAGRSFDDIRAD
FT                   GYIAGVRDVSVDVSRGELLVIMGLSGSGKSTLVRCLSRLHEITAGTITVDDQVIGDLSE
FT                   KQLIELRRNKMGMVFQSFGLLPHRTVLENVSFPLEMRGQDRHTRRERALEVIKLVGLEG
FT                   REEYFPRELSGGQQQRVGIARSLAIEPDIWFLDEPFSALDPLIRREMQDEFIRLRAMLG
FT                   KTIVFITHDFDEALRLADRIAIMKDGAIEQCDTPDQIVLNPATDYVAKFTQEIDKARVV
FT                   HAAGLIKPDLTGSGEPVKASATIQELAKMLIDDARDVIPVADETGPIGAMARKDALDIL
FT                   LQAN"
FT   gene            14913..16892
FT                   /gene="opuAB"
FT                   /locus_tag="RD1_0015"
FT   CDS_pept        14913..16892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAB"
FT                   /locus_tag="RD1_0015"
FT                   /product="glycine betaine transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29755"
FT                   /db_xref="GOA:Q16E38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E38"
FT                   /protein_id="ABG29755.1"
FT                   /translation="MAIVATNTESQTTPLSSRTLGLGLFLFAVALTLLHYAGLLPAWLH
FT                   RLPEAVIPPFETWLDAIFNFVKDDLGLLALTRFLTGGLEAVLDVTANLLYGKRRWPFID
FT                   PIPWSAIAAATTVLGYYLGGWRLAALAGGTCVWTAMIGQWEIAMETMSVLVISAPLAFM
FT                   IGLLVGIYAWKSPSFNRALLPFLSVMQTLPFFTYLLPAVIFFKVGPTAAAVATTVFAIP
FT                   PMILMTTLGLQKVSSEVVEAGKMSGCTRFQMMRHVYLPSARTEILVGVNQVIMLCLAMV
FT                   VLTAFIGMPGLGAKLLQMLGSFKIGRAFEIGVTIVLVAITLDRLSKAWVAKLPEHFDRG
FT                   TPFYIRHKYLVAGAVGFALFFALAQLVPILAEVGRRQSLSQGREIDQLIKAYLALDWVK
FT                   ASTDAMRYVLNVWILNPFRDFLLSIPTSAFIILVVAAGLVIAGPRQAVLAAVFFSLVAL
FT                   SGWWDRSVITLYSVIAAVSLALIIGIPVGILAARRETTARRMLLVCDTAQTFPSFIYLI
FT                   PAIMLFGITATSVVMSILIFAMVPLVRYTIEGLRSVPAEMMEAADMSGATKLQKLWQVQ
FT                   LPLALPTMAVGFNQAIMFAFFMVIIAAFIGTQDLGQELQRTLAGAYLGKNLVLGLCVSL
FT                   MALTFDMIVMKWAQEKKAKLGLAR"
FT   gene            complement(16992..17639)
FT                   /gene="rluA"
FT                   /locus_tag="RD1_0016"
FT   CDS_pept        complement(16992..17639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="RD1_0016"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29756"
FT                   /db_xref="GOA:Q16E37"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E37"
FT                   /protein_id="ABG29756.1"
FT                   /translation="MDETYAPPQTPLTVLHEDAEVLLVDKPAGLLSVPGKGPHLADCLL
FT                   ARVQAMFADALLVHRLDRDTSGVMIFALTPHAQRHLGLQFEKRMTRKTYVARVWGVPCD
FT                   KTGTVDLPLIVDWPNRPRQMVCHETGKPAQTEWRVLKDDGQTARMRLHPHTGRSHQLRV
FT                   HMRALGHPILGDPFYATGPARDYPRLMLHSEELRFKHPQGGRSMKVRATAPF"
FT   gene            complement(17670..20117)
FT                   /locus_tag="RD1_0017"
FT   CDS_pept        complement(17670..20117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0017"
FT                   /product="FAD dependent oxidoreductase, putative"
FT                   /EC_number="1.5.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29757"
FT                   /db_xref="GOA:Q16E36"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E36"
FT                   /protein_id="ABG29757.1"
FT                   /translation="MALPPSHARVVIIGGGVIGCSVAYHLIKQGWSDVVLLERKQLTSG
FT                   TTWHAAGLIAQLRATANMTKLAKYSQELYGNLEAETGVATGFKRCGSITVALTEERREE
FT                   IYRQAAMARAFGVDVEEISAQEVKARYEHLNISDVTGAVYLDKDGQGDPANIALALAKG
FT                   ARQGGAKVLERTCVTGITCEGRRATGVDWTQGTQTGHITADMVVNCGGMWGHEVGRMAG
FT                   VNVPLHACEHFYIVTEAIAGLTQLPVLRVPDECAYYKEDAGKMLLGAFEPNAKPWAMKG
FT                   IPADFEFDQLPEDFDHFEPILEAAVERMPMLAEAGIHTFFNGPESFTPDDAYHLGLAPE
FT                   MDNFWVAAGFNSIGIQSAGGAGMALAQWMEAGEKPFDLGDVDISRMQPFQGNKTYLFER
FT                   SKETLGLLYADHFPFRQKATARGVRRTPFHDHLIRHGAVMGELAGWERANWFAVNNQKP
FT                   EYEYTWKRQNFFVNVAEEVAAVRTNVGMYDMSSFGKIRVEGRDAVAFMNHVGGGQFDVP
FT                   VGKIVYTQFLNHKGGIEADVTVTRLSETAFLVVTPAATRLADQTWMMRHRGDFNVVVTD
FT                   VTAGEGVLAIMGPNARKLLQEVSPADFSNAVNPFGTAQEIELGMGLARVHRVTYVGELG
FT                   WEVYVSSDMAAHAFEVLHEAGQDLGVKLCGMHMMDCARMEKGFRHFGHDITCEDHVLEA
FT                   GLGFAVKTDKPDFIGRDAVLRKKDTGLESRLVQFKLKDPEPLLYHNEPVLRNGEIVGFL
FT                   SSGAYGHHLGGAMGLGYVPCAGETAAEVLASDYEVDVAGVRVAADVSLQPMYDPKSERV
FT                   KAG"
FT   gene            complement(20147..21037)
FT                   /locus_tag="RD1_0018"
FT   CDS_pept        complement(20147..21037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0018"
FT                   /product="homocysteine S-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29758"
FT                   /db_xref="GOA:Q16E35"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E35"
FT                   /protein_id="ABG29758.1"
FT                   /translation="MTQITLLDGGMGQELVHRAGDKPTPLWSAQVMVDHPGLVEAVHAD
FT                   YFAAGATVATTNSYAIHHDRLEGTGMEDAFEDLYQRALSEASAARATHGSGRIAGALGP
FT                   LVASYRPDLHPSREVAVPLFVEAAALLAPECDLLILETVASVAHARDALEGARSTNLPV
FT                   WLSLTVSDSDGMQLRSGEPLEDALEVAANADAVLVNCSAPEAVTKAMPILAQSGKPFGG
FT                   YANGFVQISEDFLKEKPTVDTLETRRDMGPRAYAGYVMEWVSAGATIVGGCCEVGPKHI
FT                   AELKKRLLAAGHTLV"
FT   gene            complement(21034..23484)
FT                   /locus_tag="RD1_0019"
FT   CDS_pept        complement(21034..23484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0019"
FT                   /product="dimethylglycine dehydrogenase, putative"
FT                   /EC_number="1.5.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29759"
FT                   /db_xref="GOA:Q16E34"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E34"
FT                   /protein_id="ABG29759.1"
FT                   /translation="MAEFPTTARVVIIGGGVVGTSTLYHLAKAGWKDCVLLEKNELTAG
FT                   STWHAAGNVPNFAGSWAVMNMQRYSAAMYRTLGDDVDYPMNYHVTGAVRLAHSKERMQE
FT                   FEKVAGMGRAQGLQMDICTPEELQQYNPFMETHDLAGGMWDPLDGDIDPAQLTQALAKG
FT                   ARQAGGRIERFCPVIGMDRDGDEWIVKTEKGDIRCEKVVNCAGYYAQRVGEMFKPFGGR
FT                   TVPMVVMSHQYFLTEPIPELEAWTKENGKKVAMIRDVDTSYYLRQEKTGLNLGPYERNC
FT                   KAHWVTPEDPMPEDFSFQLYPDDLERLEYYIEDAMARLPLLGTSGVGRNINGPIPYAPD
FT                   GLPMIGPMPGVRNAFEGHSFTFGIAQGGGAGKVLSEWIMHGETELDMWAVDPRRYTDYA
FT                   DHDYCLSKALETYGHEYAMHFPRHEWPAGRDKKLSPVDEKIRALGGQMGAFNGWERANW
FT                   FAKPGDDTSEESTQTWDRNGPWAARIKEEVEAVRDGVGVLDLPGFSRFKVAGPGADEWL
FT                   RGLTTGSLPRIGRVGLLYFADSRGRILTEMSVTREAEDRFVLVTAASAQWHDREWLEAQ
FT                   MPDNCAFTLEDWTDRMSTLIVTGPEARALLGKLCDADLTLPWLSFQETEVAGGWAALLR
FT                   VSFAGELGWEVHAENADIPAMYDAILDAGAVPFGMYALNSMRIEKGYRAWKGDLSSDYS
FT                   LLEGGLERFIRFDKPQDFPGKAALLNEKQQGVKKQFVTLVVDAGAQDAPYMAPLFHGDE
FT                   VVGETTSGDWGYRVNKSIALGMLRKDLTEPGTEIEVEIYGQRRRATVQADQPLWDPQNE
FT                   RIRA"
FT   gene            complement(23486..23650)
FT                   /locus_tag="RD1_0020"
FT   CDS_pept        complement(23486..23650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29760"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E33"
FT                   /protein_id="ABG29760.1"
FT                   /translation="MAFPMRRGATDMTSNVTTPNPNTPPAGFDRETHRFAVGKGGYDKT
FT                   TDFVPQEEK"
FT   gene            complement(23619..24242)
FT                   /locus_tag="RD1_0021"
FT   CDS_pept        complement(23619..24242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0021"
FT                   /product="homoserine/lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29761"
FT                   /db_xref="GOA:Q16E32"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E32"
FT                   /protein_id="ABG29761.1"
FT                   /translation="MMGFEAWTIFALFWIVFVTTPGPNAVNCIQNGIYLGFGRAMIGVL
FT                   AILTQATLFLILSAFGITALIAASPAGFFAAKMIGAGFLIYLGVRGWMQARTPVTISAK
FT                   PAKSIYFQALAIATINPKSVAGYLAAFSQFVQADVPIWEQMIVIVPTALTLTALSYTGF
FT                   CALGAGLGRAALDAVFSVWLRRILASCFVIYGLLLGLSNAPGRN"
FT   gene            complement(24239..24811)
FT                   /locus_tag="RD1_0022"
FT   CDS_pept        complement(24239..24811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0022"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29762"
FT                   /db_xref="GOA:Q16E31"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E31"
FT                   /protein_id="ABG29762.1"
FT                   /translation="MHHSLPDEPQTLGADLRALRKARGLTLADLAERLGRSVGWLSQVE
FT                   RDKSDPSISDLRAIAKVLEVSISMLFRHAPATATEAGYIVRAAARRPMGSKTEGLVEEL
FT                   LSPDLTDDFEMVHSTFEPGSRVSEMVTRPTQEVAYLLSGTLQIEINDTVHTIYPGDSFR
FT                   IRGEAFRWSNPYAEPAVAIWVIAPPVY"
FT   gene            24803..24910
FT                   /locus_tag="RD1_0023"
FT   CDS_pept        24803..24910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29763"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E30"
FT                   /protein_id="ABG29763.1"
FT                   /translation="MVHGRENSPSNFTVPELNEKIQTFFTPQGAFFPPD"
FT   gene            complement(24931..25386)
FT                   /locus_tag="RD1_0024"
FT   CDS_pept        complement(24931..25386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29764"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E29"
FT                   /protein_id="ABG29764.1"
FT                   /translation="MKTDYPTLAKTIAALTEGETDVIALMATVACEIHHCDDRFDWTGF
FT                   YRVTGPQMLKIGPYQGGHGCLVIPFSRGVCGAAARTREIQLIEDVDAFPGHIACASSTR
FT                   SELVLPVENARGALLGVFDIDSDQPAAFEQRDADEIDDILKAVFGRL"
FT   gene            complement(25435..26607)
FT                   /locus_tag="RD1_0025"
FT   CDS_pept        complement(25435..26607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0025"
FT                   /product="thiolase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29765"
FT                   /db_xref="GOA:Q16E28"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E28"
FT                   /protein_id="ABG29765.1"
FT                   /translation="MTDVLILGAARTPMGGFQGALSSFSAAQLGGVALKSALQDAGVSS
FT                   VDEVLMGCVLPAGQGQAPARQAGFAAGLDETVPATTLNKMCGSGMKAAMIAFDQIALGQ
FT                   AGLVAAGGMESMSNAPYLLHKMRSGARLGHSEVIDHMFLDGLEDAYDKGRLMGTFAEDC
FT                   AEMFQFSRQAQDAYALASLSRAVEAQKSGAFDGEITPVDVVSRKGTIKVSADEQPGAAR
FT                   PDKIPQLKPAFREGGTVTAANASSISDGAAALVLASGAYAASKNLTARARIVGHATHAQ
FT                   TPGLFTTAPVPAARKLLEKTGWDKGSVDLWEVNEAFAVVPLAFMHEMALDHEVVNVNGG
FT                   ACALGHPIGASGARIMVTLLNAMEKRDVKRGVAAICIGGGEATAIAIERG"
FT   gene            26690..27043
FT                   /locus_tag="RD1_0026"
FT   CDS_pept        26690..27043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0026"
FT                   /product="anti-anti-sigma factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29766"
FT                   /db_xref="GOA:Q16E27"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E27"
FT                   /protein_id="ABG29766.1"
FT                   /translation="MELASKTEEQLRIVSVQDTRIDAAVAIEFKDAMRVETDDGPDLVV
FT                   LDLSRVEFIDSSGLGAIVAAMKHMGKDRKMALAGLTPTVERVFTLTRMDSVFSVFPTLE
FT                   GALAELKPQQTCQ"
FT   gene            27055..27501
FT                   /gene="rsbW"
FT                   /locus_tag="RD1_0027"
FT   CDS_pept        27055..27501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="RD1_0027"
FT                   /product="serine-protein kinase, putative"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29767"
FT                   /db_xref="GOA:Q16E26"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E26"
FT                   /protein_id="ABG29767.1"
FT                   /translation="MESEQLRPFRVCVESGQYAAREALREFLDALRPLKLDVEESGTIE
FT                   LVLAEVLNNIVEHAYPPSQPSGPIAIECAHRQDGLILKIKDEGHAMPDGKMPLGELTPL
FT                   DVELEDMPEGGFGWFLISHLAKDVRYARVGHENHLNMRLAVGTS"
FT   gene            27764..29341
FT                   /gene="ggtA"
FT                   /locus_tag="RD1_0028"
FT   CDS_pept        27764..29341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggtA"
FT                   /locus_tag="RD1_0028"
FT                   /product="gamma-glutamyltranspeptidase, putative"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29768"
FT                   /db_xref="GOA:Q16E25"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E25"
FT                   /protein_id="ABG29768.1"
FT                   /translation="MRDFHLPGRSPVLASNGMCATSHPLAAKTAVDVLQQGGNAMDAAI
FT                   AGAVLLGLCEPAMTGIGGDCFVLWSDRDRQNVRALNGSGRAPAALDAHDLREAGETTVP
FT                   SFSAHAVTIPTAVAAFAHLAETVGTLGLDRLLAPSIKYAQEGIPVAPRVAFDWENYGHN
FT                   LQGSAREQYLIDGKLLKTGDIFRAPGQAEVLRRIAEQGASAFYTGEIAEDMVATLQAAG
FT                   GVHTLDDFAAAACDETTPIFGTYKDIDIVEHPPNGQGATAILMLNILAQFDLASMAPFG
FT                   TQRAHIEAEAAKLAYDARNRFLADADHTTRLAHMLDMSLAKKLAAMIDPGKAMPAAAPL
FT                   TEMVHKDTVYISTVDRDGMAVSLIYSIFKDFGSGIASDKFGILLQNRGAGFTLEQGHPN
FT                   ELKGGKRPMHTIIPAMLRKNGKVIMPFGVMGGAYQPNGHARFVTNLTDFGMDPQATIDA
FT                   PRAFSDMGNMQVERGYSDAVRQELTDLGHSVSIPQTAIGGAQAIMMHDNGVLEGASDPR
FT                   KDGCALGY"
FT   gene            complement(29350..29676)
FT                   /locus_tag="RD1_0029"
FT   CDS_pept        complement(29350..29676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29769"
FT                   /db_xref="GOA:Q16E24"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E24"
FT                   /protein_id="ABG29769.1"
FT                   /translation="MIKTRAKYHLGQIVRHKKHPFRGVIFDVDPEFSNTEEWYEAIPED
FT                   SRPVKEQPYYHLLAENEQSYYVAYVSEQNLIADYSGEPVDHPDIPDLFGPLQDGSYPLH
FT                   FQLN"
FT   gene            29762..30643
FT                   /locus_tag="RD1_0030"
FT   CDS_pept        29762..30643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0030"
FT                   /product="auxin efflux carrier family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29770"
FT                   /db_xref="GOA:Q16E23"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E23"
FT                   /protein_id="ABG29770.1"
FT                   /translation="MNLALTVLEIVAPVFLLAAIGFVWVKLGNEYRIRFVTQLAMTLSV
FT                   PCLIFVSLMETQIAPEDLTALSLAAIGAYGVVTVAILALVFVLRLNRQTFAAPLMFGNT
FT                   GNIGLPLAFFAYGETGLGYAIIVFGIMAVWSFTFGVWLVAGAGSFGKVVREPMVAGTIL
FT                   GAIFLWQGWQTPPFVTNTLDLIGQMAIPLMLITLGVAIARLKPGGILRATALSAVKLVI
FT                   CTGVAWYIGDAFELDRIALGVLVLQVATPVAVTSYMLAEKYGADAEEVAGLVVASTLMS
FT                   VAALPLLLGFLL"
FT   gene            30714..31298
FT                   /locus_tag="RD1_0031"
FT   CDS_pept        30714..31298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0031"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29771"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E22"
FT                   /protein_id="ABG29771.1"
FT                   /translation="MSRTLRAMAILLLVASCGGVSSTAPRNLNDACSIAEQRPEYMRAF
FT                   QRTQQKWGVPVHVQMATMHQESRFIGNAKTPHKYALGVIPMGRVSSAYGYSQALDGTWS
FT                   DYQRATGKRLARRDRIRDASDFMGWYMNISQQRNGIPLHDARNQYLAYHEGHTGYARGS
FT                   YNRKSWLLNVADKVDARADLYQAQLATCNLR"
FT   gene            complement(31304..31864)
FT                   /gene="lolA"
FT                   /locus_tag="RD1_0032"
FT   CDS_pept        complement(31304..31864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="RD1_0032"
FT                   /product="outer membrane lipoprotein carrier protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29772"
FT                   /db_xref="GOA:Q16E21"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E21"
FT                   /protein_id="ABG29772.1"
FT                   /translation="MIPVASAAAEQLKLAEISAYLNSLETLKGTFRQINDDGSVSTGQL
FT                   YIRRPGRMRFEYDPPEQALVIAAASAVVIIDRKSNQPSETYPLSRTPLSLLLGRDIDLT
FT                   RAAMVRNARFDGTATIVTAEDPDNLENGFLEMYFTDQPTRLEQWVIHDASGAQTRVILD
FT                   AFETGMELPNSLFDADREKGRDR"
FT   gene            complement(32002..34818)
FT                   /gene="ftsK"
FT                   /locus_tag="RD1_0033"
FT   CDS_pept        complement(32002..34818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="RD1_0033"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29773"
FT                   /db_xref="GOA:Q16E20"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E20"
FT                   /protein_id="ABG29773.1"
FT                   /translation="MKGKKGMAFQTRGRDPLFDSNMAEAMEKRGKELFGLVLMVLGAMA
FT                   CAMIASYTPDDPNWMVSTDATVQNWMGRIGASIAAPLFMIVGWGSWGIGIVLVAWGLRF
FT                   ALHAGAERALGRLIFAPIAIALGSIYAATLTPAGNWLDIHSFGLGGLFGDTVMGAILTL
FT                   LPVGSTVTVKLMSLLMAIGIIVFGGFVLGFTRAEVARIGRFLLMGLVMLYAGVMTLLGR
FT                   SAQGAVSTAQELAARRAERRAQAEEMAALAQTEVAPLPDNMMFETAETQPKTGLFARMP
FT                   SLVRRPDAMPEPELVAQPDAPDVEEGPGEDRIKARIADVIKSRVRSSTAVHVPATAPLT
FT                   RGRGRGPDPLVLDTTPVVRPEPPLTARHAKPPAPEIEVEDTASFDMPEPRVDEVIEIPR
FT                   PAPRRVVQQPVRKPVQPSRRAQAEAQPTLSFDDTHPGFELPPLNLLENPIDVPRLHLSD
FT                   EALEENARMLESVLDDYGVKGEIVAVRPGPVVTMYELEPAPGLKASRVIGLADDIARSM
FT                   AALSARVSTVPGRSVIGIELPNDTREKVVLREILSARDFGDTNMRLPLALGKDIGGDPI
FT                   VANLAKMPHLLIAGTTGSGKSVAINTMILSLLYKLTPQECRMIMIDPKMLELSVYDGIP
FT                   HLLSPVVTDPKKAVVALKWVVGEMEERYRKMSKMGVRNIEGYNGRVREALSKGEMFSRT
FT                   VQTGFDEETGEPIFETEENTPVALPYIVVIVDEMADLMMVAGKEIEACIQRLAQMARAS
FT                   GIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGMGDMLYM
FT                   AGGAKITRCHGPFVSDEEVEEIVNHLKAYGEPDYVNGVVEGPSEDAESNIDAVLGLGGN
FT                   TDGEDALYDTAVQVVLKDRKCSTSYIQRKLAIGYNKAARLVEQMEDQGLVSPANHVGKR
FT                   EILVPEQG"
FT   gene            complement(34824..36002)
FT                   /locus_tag="RD1_0034"
FT   CDS_pept        complement(34824..36002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0034"
FT                   /product="aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29774"
FT                   /db_xref="GOA:Q16E19"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E19"
FT                   /protein_id="ABG29774.1"
FT                   /translation="MYPERFSNLPAHAWPRLRALLDVHEGGGVPVHMTIGEPKHLFPQW
FT                   VMEVINEHSAGFNSYPPNDGAPELRQAIASFVQRRYGVPVDADTQVMALNGTREGLYNA
FT                   VMALCPETKNGQRPAVLMPNPFYQVYMIAALSVGADPVMVPATIENGHLPDFSSLSEET
FT                   LNRTTAAYICSPANPQGAVASAEYWRDLMGLAERYDFKVFADECYSEIYRGAPPVGALQ
FT                   VAQDIGADPDRVVIFHSLSKRSNLPGLRSGFVASGAKNIAEIKQLRNYAGAPLPLPLQM
FT                   AAAAVWNDEAHVHENRALYVEKYEIADRILGNVPGYASPDAGFFLWLPVENDERAAVKL
FT                   WRETGVRVLPGGYLAQDWEGVNPGQGYIRAAMVAPKAETERGIQMIRDCLYP"
FT   gene            complement(36111..37439)
FT                   /locus_tag="RD1_0035"
FT   CDS_pept        complement(36111..37439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0035"
FT                   /product="amidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29775"
FT                   /db_xref="GOA:Q16E18"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E18"
FT                   /protein_id="ABG29775.1"
FT                   /translation="MQAWLKLTAADLGRGITAGEIDPVDLTQTYLDAISVYPLRDRIYA
FT                   RVTPERALHEAAAARGRARSGQRRSPLDGVPISWKDLFDSAGVATEAGSLLLKNRVPER
FT                   DAKVLQNATAAGLVCLGKTHMSELAFSGLGYNPSTATPPCINDDGAVPGGSSSGAAASV
FT                   AFDLAAVGVGSDTGGSVRIPAAWNDLVGLKTTSGRLSNDGVVPLAARFDTVGPLCRSVE
FT                   DAALMLAVLQGGRAADLSGASLTGRRLAVLNTVAMEDLRSGPAEAFSAAVSKLELAGAQ
FT                   VEEIHIDAVNDAMALTTCLYTAEAYGLWRDVIEANPDAMYEEILKRFRLGQNHSGPDYV
FT                   AAWAALEAARVSYHQATAGFDAVILPTAPILPPNLNRLNTDHDYYVTENLMSLRNTRIG
FT                   NLMGLCALSLPTDTPSCGLMLMAPPHREEALLRLGTAAEQALA"
FT   gene            37491..38753
FT                   /gene="ubiH"
FT                   /locus_tag="RD1_0036"
FT   CDS_pept        37491..38753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="RD1_0036"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29776"
FT                   /db_xref="GOA:Q16E17"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E17"
FT                   /protein_id="ABG29776.1"
FT                   /translation="MDNPPAPAIFRHMAFDSDILIVGGGLNGPTLALALAQAGHSVTMI
FT                   DAVPLGSRKSPGFDGRCYAMALTSTRLLEAVGIWETLEPDAQPMLDIKVTDGRAGEGPS
FT                   PFFMHFDHAEIEEGPMGYMVEDRHLRPALLSASDAHENIQTLHGETVVSQSAEAGSVSV
FT                   TLASGRVLTGRLLVGCDGRGSGTAMRAGIKRTGWDYGQTALVCAVEHALPHHGVAHQFF
FT                   MPPGPLAILPLTGNRSSIVWSETAENAALINEMPDEAYIDVLKPRFGSFLGDITRVGTR
FT                   YTYPLSLSLANTLVAPRVVLVGDAAHGVHPIAGQGLNAGVRDIAALAEVVTDAKRRGED
FT                   IGAEGVLSRYQEWRRFDNTTLALATDTFNRLFSNDNPVLRAVRDIGMGIVGNMPALRRS
FT                   FIREAAGLTGDLPKLLKGQRL"
FT   gene            complement(38853..39038)
FT                   /locus_tag="RD1_0037"
FT   CDS_pept        complement(38853..39038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29777"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16E16"
FT                   /protein_id="ABG29777.1"
FT                   /translation="MSETEVVFDRRMLEALICPRSHETLKYDQERQELISETANLAYPI
FT                   RNGIPVMLIDEARVLD"
FT   gene            complement(39035..39679)
FT                   /gene="lonD"
FT                   /locus_tag="RD1_0038"
FT   CDS_pept        complement(39035..39679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonD"
FT                   /locus_tag="RD1_0038"
FT                   /product="ATP-dependent protease La domain protein,
FT                   putative"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29778"
FT                   /db_xref="GOA:Q16E15"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E15"
FT                   /protein_id="ABG29778.1"
FT                   /translation="MIKASELPDTIAIFPLGGALLLPRSRLPLHIFEPRYLQMLEDALK
FT                   TRERLIGMIQPNEVPGRGGTGLHTIGCAGRIMQFSETEDGRYLITLAGVSRFRVVKEIE
FT                   GFTPYRRCDVVWDGFDRDLGPDETDTAFQRQGFLKLLERYFDARQLSADWETLKEADDE
FT                   LLVNSLSMMLDFDPEDKQALLEAPSLTTRRETLVTLMEYQLRGGQESEMMQ"
FT   gene            complement(39707..40624)
FT                   /gene="trx"
FT                   /locus_tag="RD1_0039"
FT   CDS_pept        complement(39707..40624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="RD1_0039"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29779"
FT                   /db_xref="GOA:Q16E14"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E14"
FT                   /protein_id="ABG29779.1"
FT                   /translation="MMDLNLGAAPAADDLIKDTTEATFMADVVDTSQTVPVIVDFWAPW
FT                   CGPCKTLGPQLEAAVRAAKGAVKMVKINVDEAQMIAGQLQIQSIPTVYAFSKGQPIDGF
FT                   QGALPESEIKAFVDRVVKATGGEAPGDGLADAVAAAEEMLAEGAAADAAQTFAAVLGED
FT                   EKHAAAYGGMVRAHIAMGELDQAEAILNGAPAEISKAPELEAAFAQLELARQAEGAGPV
FT                   DELKAAVAADPDNNQARFDLAQALHANGDVEGGVAELLELFRRDQEWNDGAAKAQLFTI
FT                   FEALKPNDPIVLNGRRKLSSIIFA"
FT   gene            complement(40679..41467)
FT                   /gene="xth"
FT                   /locus_tag="RD1_0041"
FT   CDS_pept        complement(40679..41467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="RD1_0041"
FT                   /product="exodeoxyribonuclease III, putative"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29780"
FT                   /db_xref="GOA:Q16E13"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E13"
FT                   /protein_id="ABG29780.1"
FT                   /translation="MAFSLATWNINSVRLREALVLKLMTEELPDVLCLQECKSPVDKMP
FT                   LEAFAAAGYGHVVARGQKGYNGVAILSKIPMQEAAAEDFAGLGHARHIAGRLENGVTVH
FT                   NFYVPAGGDVADREVNEKFGQKLDYLTEMRDWFHAQKPEKSILVGDLNIAPREDDVWDH
FT                   KKLLKVVSHTPIEVEHLAQTQDAGGWVDITRQDIPEGRLYSWWSYRAADWDAADKGRRL
FT                   DHVWATSDIAAAGHDSRILRGARGWEKPSDHAPVFAQFDL"
FT   gene            complement(41728..42414)
FT                   /gene="mtrA"
FT                   /locus_tag="RD1_0042"
FT   CDS_pept        complement(41728..42414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA"
FT                   /locus_tag="RD1_0042"
FT                   /product="DNA-binding response regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29781"
FT                   /db_xref="GOA:Q16E12"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E12"
FT                   /protein_id="ABG29781.1"
FT                   /translation="MAQLKKILLVDDDDDLRDALSEQLIMTEDFDVFEAANGADAMVRA
FT                   KEALYDLVILDVGLPDTDGRELCRLMRKQGVKSPILMLTGHDSDADTILGLDAGANDYV
FT                   SKPFKFPVLLARIRAQLRQHEQSEDAVFQLGPYTFKPAMKTLITEDEKKIRLTEKETNI
FT                   LKFLYRSTEGVVARDVLLHEVWGYNAGVTTHTLETHIYRLRQKIEPDPSNARLLVTESG
FT                   GYRLMA"
FT   gene            42577..43665
FT                   /gene="ribA"
FT                   /locus_tag="RD1_0043"
FT   CDS_pept        42577..43665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="RD1_0043"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29782"
FT                   /db_xref="GOA:Q16E11"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E11"
FT                   /protein_id="ABG29782.1"
FT                   /translation="MSFSPDQNELIARARADLRMGVPVVIDGATPLLAAPVETLNAARL
FT                   GDVMALSQDAVLVITARRAATLKAAAYDGDLARVKLSPDATLAWVNGVADPAGDLMNPM
FT                   KGPLACARGGDAETHRFAIQLAKAARLLPAVVCAPVDNAPAFAQAHNLVCLAAQSGQAM
FT                   LDASSPLHAVISARLPMEVSEAGRLHVFRPEDGGEEHYAIEIGRPDRAAPLLTRLHSAC
FT                   FTGDLMGSLKCDCGPQLRAALAQMGAEGNGVLLYMNQEGRGIGLANKMRAYSLQDQGFD
FT                   TVEANHRLGFEDDERDFRLGAAILKSMGFSKARLLTNNPRKVAMMCENGIDVTERVPLH
FT                   VGENAHNHAYLATKVAKSGHLK"
FT   gene            43662..44156
FT                   /locus_tag="RD1_0044"
FT   CDS_pept        43662..44156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29783"
FT                   /db_xref="GOA:Q16E10"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E10"
FT                   /protein_id="ABG29783.1"
FT                   /translation="MKPDDMVVTPRGLRFQGQLFPCSIGKTGITRRKKEGDGATPTGIH
FT                   RIVGMLYRPDRIAKPADWALPIGLNDLWSDDPGHEDYNMMVRAPYSHSHEKLRRADPLY
FT                   DLVLLTDWNWPYAVKGRGSAIFMHQFRRPGFPTEGCIALSRGNLRRIAPRITLQTRLIV
FT                   P"
FT   gene            complement(44164..44820)
FT                   /locus_tag="RD1_0046"
FT   CDS_pept        complement(44164..44820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29784"
FT                   /db_xref="GOA:Q16E09"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E09"
FT                   /protein_id="ABG29784.1"
FT                   /translation="MMSLSDISQRIEKAVAQAGRDRGSVKLIAVSKVQPNERVEAVLKE
FT                   GHRCFGENRVQEAAGKWPAFRDDHDGVDLHLIGPLQTNKARQAFDLFQSIHTLDRPKLA
FT                   KTCARLAQEIGHCPELFVQVNTGEEPQKAGVAPSDADAFIAECRALDLPVRGLMCIPPI
FT                   DEEASLHFALLAKIAERNGLAGLSMGMSDDFEKAISFGATHIRVGSAIFGARVPA"
FT   gene            complement(44919..45881)
FT                   /locus_tag="RD1_0047"
FT   CDS_pept        complement(44919..45881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0047"
FT                   /product="outer membrane porin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29785"
FT                   /db_xref="GOA:Q16E08"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E08"
FT                   /protein_id="ABG29785.1"
FT                   /translation="MKKILMASTMLVATAGMAAADITFDGFGRFGIVYNDGADDAGDRS
FT                   DTQLDQRFRLNVVGTTETDGGVEFRARLRLESNDNGDGQGSGGGNVVEAPEFGVRAGGF
FT                   NVFLGNTSDLIDSGDVVDYYGNGIGLTDFAETSSNFVTGSIISGINGGDEIDPTIKTSY
FT                   TVGDFTFGASYSDNALDSATEEYQIGAGYKFGNFGVGAAFGNVDGGDFDDTDFWALSFN
FT                   GDLGSFAFSLLAADSDDQDSVALGASVAVPVGAATDVRFVVSDNGLDSDDSFAATKGDD
FT                   TAYAVGFRHSLGGGVRLQGGIGENSLGDTVGDLGVIFNF"
FT   gene            46129..46620
FT                   /locus_tag="RD1_0048"
FT   CDS_pept        46129..46620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0048"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29786"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E07"
FT                   /protein_id="ABG29786.1"
FT                   /translation="MQKIWVTQIITGMAVAAALSGCGVATPSNAVIGPQAGDNFTSQRD
FT                   RNRSSGTTIWDAFRAGGGEQTVAVNKYLWAASLEVLNFLPVESVDPFTGVIITGFGTPP
FT                   GSGRAYRATILIDDPALDARSLNVSLQTRNGPASAPAVQAVENAILSRARQLRIADDAL
FT                   "
FT   gene            46734..49280
FT                   /gene="leuS"
FT                   /locus_tag="RD1_0049"
FT   CDS_pept        46734..49280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="RD1_0049"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29787"
FT                   /db_xref="GOA:Q16E06"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16E06"
FT                   /protein_id="ABG29787.1"
FT                   /translation="MTRYTPAEIEARWQKAWRENEVFKAIRSADKPKYYVLEMFPYPSG
FT                   RIHMGHVRNYTMGDVIARYKLATGHNVLHPMGWDAFGMPAENAAMAIGGHPKDWTYGNI
FT                   KDMRDQMKPLGLSIDWSREFATCDPEYYGQQQALFLDFLEAGLVYRKNAIVNWDPVDMT
FT                   VLANEQVEQGRGWRSGALVERRELTQWFFKISDHSEELLSALDTLENWPAKVRLMQENW
FT                   IGKSRGLQFAFSTIDGPDGHDRIEVYTTRPDTLLGASFVGISPDHPLAKLLERDNDNVA
FT                   AFCAECRKGGTTEEAIETAEKLGFDTGLRVRHPFDTAAELPVYIANFILMDYGTGAIFG
FT                   CPAHDQRDFEFATKYDLPIISTFLPSQDADEVLSEAFVPAKTEKVFYNRGFAGAEFQTG
FT                   LEAIDAAIDFCESNGIGQGVTKYRLRDWGLSRQRYWGCPIPVVHCDDCGVVPEKKENLP
FT                   IELPYDVSFDTPGNPLNRHPTWRDTPCPACGKPAQRETDTMDTFVDSSWYFARFTAPRA
FT                   ETPTVMEDAQYWMNVDQYIGGIEHAILHLLYSRFFARAMQMTGHLPQSAIEPFDALFTQ
FT                   GMVTHEIYQTRDANGRPVYHLPEDVTDGRLADGTEVEIIPSAKMSKSKKNVVDPLGIIA
FT                   SYGADTARWFVLSDSPPERDVEWTASGAEAAFKHLTRVWTLSERIGKMDKDAAGQGDED
FT                   LLRAMHVCIHDVTMGIESFGFNAAIAKLYAFTAKLQKSKAGYGAQRTAIMTLAQLMSPM
FT                   TPHLAEDIWAHQGGDGLVTTAPWPRADEAMLVSDTVTLPVQINGKRRAEIVISADLSKE
FT                   EVEKIALADPAVIRSLNGATPKKIIVVPGRIVNVVV"
FT   gene            49267..49746
FT                   /locus_tag="RD1_0050"
FT   CDS_pept        49267..49746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0050"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29788"
FT                   /db_xref="GOA:Q16E05"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E05"
FT                   /protein_id="ABG29788.1"
FT                   /translation="MSSYSRRSLLFLPLALGACGFAPVYGTGSTGSALQNAVEVSDPND
FT                   VDGYLVVRRLEERLGRAAQPTYKLTLAVDSKREALAVNRNSNINRYNIVGTANYVLVEQ
FT                   ATGRVVTSGSVDNFTGSSATGTTVATLAAERDARERLMSLLADQIVVRLLSTDLT"
FT   gene            49743..50744
FT                   /locus_tag="RD1_0052"
FT   CDS_pept        49743..50744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29789"
FT                   /db_xref="GOA:Q16E04"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E04"
FT                   /protein_id="ABG29789.1"
FT                   /translation="MKLSTRDAVSYFARPDPDKTGILIYGADAMRVALKRQQLLAALLG
FT                   KEAEEEMRLTRLNGGDLRKDPALLLDAVKAVGFFPGPRAAFVQEANENTAPAILTALAD
FT                   WQPGDAQIIVTAGALKPTSKLRKAFEAHPNAYAAGIYDNPPTRAEIETTLAETGLALPT
FT                   GDVMAALSDLAQAIDPGDFRQTIEKLALYKLHDPAPISLQDIAACAPTSTEADVDDVLM
FT                   VVAEARAHEIGPMMQKLIAQGANPVGLCIGAMRHFRALHRAACDTSGRPTIFGPNRDRM
FT                   LAQSRKWGAAKLETALTVLMDTDLQLRSAGQHAPGMALVERAFIRLAMLAPR"
FT   gene            50763..51347
FT                   /locus_tag="RD1_0053"
FT   CDS_pept        50763..51347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0053"
FT                   /product="glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29790"
FT                   /db_xref="GOA:Q16E03"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E03"
FT                   /protein_id="ABG29790.1"
FT                   /translation="MYTVIGPVKSRAMRVLWMLEELGEAYNHIDAAPRSDAARTYNPSG
FT                   KVPALLDGTEVLTDSMAILTYLADKHGKLTAPAGTIARARQDAMTFWLLDEFDAILWAA
FT                   AKHSFVLPQEQRMPAVKDSLKAEFSASADQLAAKLDGPFLMGDQLTVPDILACHCLNWA
FT                   VGAGFPRVDDRLFAYGKNLRQRPAFQAAAAR"
FT   gene            complement(51326..52510)
FT                   /locus_tag="RD1_0054"
FT   CDS_pept        complement(51326..52510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29791"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E02"
FT                   /protein_id="ABG29791.1"
FT                   /translation="MSTALVIGAGPAGLMAAETLSAAGHRVIICDAKPSVGRKFLMAGK
FT                   SGLNLTKDEAFAPFMRHYFEAEAPLRPMIARFDAQAVQDWARGLGQDLFTGSTGRVFPK
FT                   AMKASPLLRAWLARLDAAGVERRTGWRWLGWDQEAALFETPAGAQKLTADVTVLATGGA
FT                   SWARLGSDGAWADAVGAQGCALTPFAPSNAAVSIRWSDHMAPHFGVALKSVAWQAGSMS
FT                   SRGEAAITQTGLEGGGVYSLTPALRAGAPLFVDLAPDRTAEKLAAELAGKSGKLRLAHW
FT                   LRNTLRLSPAKIAFFFEMTAAGRPSREAWVATLKKLAVRYDGLRPMDEAISTAGGVPFA
FT                   AMDDRLMLKSRPGVFCAGEMIDWEAPTGGYLITACLATGRWAGRGAVDYLAAAA"
FT   gene            complement(52507..53841)
FT                   /locus_tag="RD1_0055"
FT   CDS_pept        complement(52507..53841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0055"
FT                   /product="mechanosensitive ion channel family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29792"
FT                   /db_xref="GOA:Q16E01"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E01"
FT                   /protein_id="ABG29792.1"
FT                   /translation="MEFDLTGQPEIVQLAAGYALQIWEIAKSWALSPAAWSQFALLVLA
FT                   YVLAVIAAARLRGTLTRLLTPAAEAESIIARSRRTVLMFLPLLLPLLAYVFTAVGESVV
FT                   RSIFDSGAVIAFGKRVFLFLAVRTLVRDIISDPLLKLLGKYVLIPIAAIYALGLLDAVS
FT                   AKLTETTISLGNISFSVMSLIRGLIAGSVLFWLGGWSNRQSAQFIESQQDMRPSLRQLI
FT                   AKVVEFSIFGIAFLLLMNIMGINLSTLAFIGGAVGVGLGFGLQKIASNFISGVILLIEG
FT                   QATVGDYVELDGGESGRIVKMTARAAILETFDGRWIVVPNEDFITTRVVNYSDSGSANR
FT                   YEAPFSVSYDTDINRVPALIEAAVATHPGVLNEPYPPDCELRGFGDSGIDFAVEFWVNG
FT                   FDDGPNKFTSDVLFLIWNTLKENDIEIPYPQRVVEIKGGVPDLAS"
FT   gene            complement(53945..55948)
FT                   /locus_tag="RD1_0056"
FT   CDS_pept        complement(53945..55948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0056"
FT                   /product="hydantoinase/oxoprolinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29793"
FT                   /db_xref="GOA:Q16E00"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q16E00"
FT                   /protein_id="ABG29793.1"
FT                   /translation="MPILLGVDTGGTYTDAVLIRDEKEVIATAKSLTTRHDLAEGIGAA
FT                   VRAVLRDGAVAPADVSMASLSTTLATNALVEGQGGRIALILIGFQERDLDTHGLRDALK
FT                   GDPVLICSGGHDHAGAEVAALDLEQVRQFLRGQAKDVSAFAVAAQFATRNPAHELEVAA
FT                   LIGEVTGRPVSASHALSAKLNGPKRAMTALLNARLVGMIDRLIGRAEDMLRALGITAPM
FT                   MVVRGDGALISALQARHHPIETILSGPAASLVGARWLTGAQDALVSDIGGTTTDIALLR
FT                   NGRPAIDPAGARVGPYRTMVEAVAMRTTGLGGDSAVEMVSGGLARAITLGPRRVIPVSL
FT                   MAHHAPEVVHAALDAALRAAAPGEHDARFVQAVRGQSTEGLGARETTLLDRIGTGIHPL
FT                   GAVLRARLEHSALNRLVERGLVQLGGVTPSDASHVLGTLADWDAEAARKALVLLARRRS
FT                   GAGEMLARTAQDMAQMIVDQLTQQTVTALLEAAFAEENADFGGAAGDLARHGLMQAGLR
FT                   AHRGLLRFDAALDVPIVGLGASAQTYYPAVGRAVRSEMVLPAHAGVANAIGAVVGRVTM
FT                   RRAGSVTAPSDGMFRVHFDSGPQDFTDCDAALVALEAWLTERARADAAQAGAADIQISV
FT                   TRDIKTAGVEAREVFVEAMITVEAAGRPRVAV"
FT   gene            complement(56013..57056)
FT                   /locus_tag="RD1_0057"
FT   CDS_pept        complement(56013..57056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0057"
FT                   /product="4Fe-4S binding domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29794"
FT                   /db_xref="GOA:Q16DZ9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ9"
FT                   /protein_id="ABG29794.1"
FT                   /translation="MSGLKEKLVARALEEGFIACRICRPDAVPDVAARLKAFVDAGHHG
FT                   QMTWMADRIHWRGDPTQLWPQARSVIMLAESYGPEHDPMAVLQQPERGAISVYAQGRDY
FT                   HDVVKKRLKRLARWLMAEAADADLQVKVFVDTAPVPEKALGQAAGLGWQGKHTNLLSRE
FT                   WGNWAFLGAVFTTLDIAPDAPEVDHCGSCRACLDVCPTDAFPAPYQLDARRCISYLTIE
FT                   HKGPVPTDLRPLLGNRIYGCDDCLAVCPWNKFATTARDMRLSARPELTAPRLADLAALD
FT                   DAAFRALFSGSAVKRIGRNRFVRNVLYAIGNSGEASLRQTASELMDDPDDAVADAARWA
FT                   VAQLGRK"
FT   gene            complement(57069..57734)
FT                   /locus_tag="RD1_0058"
FT   CDS_pept        complement(57069..57734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0058"
FT                   /product="glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29795"
FT                   /db_xref="GOA:Q16DZ8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ8"
FT                   /protein_id="ABG29795.1"
FT                   /translation="MARLFHVPLSPFCRKVRLSLAEKKIDVELVEERYWEEDPEFMRRN
FT                   PAGKVPVLKIDGVIMAESAAICEYIEETRPDPSLMPKDAIARAEVRRLVGWFDDKFHHE
FT                   VTSKLLYERVNKKMMKLGYPDSKNVKAGSKAIKYHLDYMTWLLDHRRWLAGDSMTLADF
FT                   AAAAHLSALDYNSDVDWNRSEVVKDWYAKIKSRPAFRNILADQVPGFPPAKHYNDLDF"
FT   gene            complement(57790..58455)
FT                   /gene="mtgA"
FT                   /locus_tag="RD1_0059"
FT   CDS_pept        complement(57790..58455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="RD1_0059"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29796"
FT                   /db_xref="GOA:Q16DZ7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ7"
FT                   /protein_id="ABG29796.1"
FT                   /translation="MRKVLRIAVRVGLVVVALGLLVMFLGRFVPPWTTPYMFAEGRKLG
FT                   GVSYEWVALEDVAPVMARSVVAAEDANFCTHWGFDMVAIREAIEDGGTRGASTLSQQTV
FT                   KNLYLWHGRNYTRKAAEALLTPVLEGLWPKRRIIEVYLNIAEFDTGVFGVKAAAAHYFG
FT                   VSPDALSATQAARLAAILPSPKTRSASRPSDFVRKRARAIIDGAATIRRDGRAACFES"
FT   gene            complement(58565..63094)
FT                   /gene="gltB"
FT                   /locus_tag="RD1_0060"
FT   CDS_pept        complement(58565..63094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="RD1_0060"
FT                   /product="glutamate synthase, large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29797"
FT                   /db_xref="GOA:Q16DZ6"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ6"
FT                   /protein_id="ABG29797.1"
FT                   /translation="MTYDDAWVAREEAKRAYMAENGLYSEAEEHSSCGVGLVVSVDGKP
FT                   SREVVENGIKALKAIWHRGAVDADGKTGDGAGIHVQIPAPFFYDQVRRTGHQPKTELLM
FT                   AVGQVFLPRTDFAAQETCRTIVETEVLRMGYYIYGWRHVPVNISVLGEKANATRPEIEQ
FT                   ILISNIKGVDEETFERELYVIRRRIEKAAAAAQVPSLYIASLSCRSIIYKGMMLAEQVA
FT                   EFYPDLMDERFESAFAIYHQRYSTNTFPQWWLAQPFRMLAHNGEINTLKGNLNWMKSHE
FT                   IRMASSTFGEMAEDIKPIVPAGSSDSAALDAVFEVLVRAGRSAPMAKTMLVPESWSKQA
FT                   VELPQSWRDMYSYCNSVMEPWDGPAALAMTDGRWVCAGLDRNGLRPMRYVVTNDGMLIA
FT                   GSEAGMVPLNEANVVEKGALGPGQILAVDMHEGRLFHDTEIKDKLASNQPFGEWVGKIK
FT                   DLDEALTGVTETTIFAGNELRRRQVAAGYSIEEIEQILAPMVEDAKESLASMGDDTPSA
FT                   VLSKQYRPLSHFFRQNFSQVTNPPIDSLREYRVMSLKTRFGNLKNVLDEDSSQTEIITL
FT                   DSPFVGNAQFDTLVSHFNAELVEIDCTFEAGRGNLDAGLKRIRAEAEDAVRSGAGHIVL
FT                   TDHMSDATKVGMPMILATSAVHSHLVRQGLRTFCSLNVRSAECIDPHYFAVLIGAGATI
FT                   VNAYLAEDTVADRIERGLIDGTLTEAVARYRYAIDQGLLKIMAKMGISVISSYRGGLNF
FT                   EAVGLSRAMCAEYFPGMTSRISGIGIHGIQHKVEEVHAKGWAGAGSVLPIGGFYKARKS
FT                   GETHAWEATSMHMMQTACNTASYAMWKQYSAKMQSNPPIHLRDLLDIKPLGKPVPLEEV
FT                   ESITSIRKRFVTPGMSLGALSPEAHKTLNVAMNRIGAKSDSGEGGEDPAHFVPEPNGDN
FT                   PSAKIKQVASGRFGVTAEYLNQCEELEIKVAQGAKPGEGGQLPGMKVTDLIARLRHSTK
FT                   GVTLISPPPHHDIYSIEDLAQLIYDLKQINPRCKVTVKLVASSGVGTIAAGVAKAKADV
FT                   ILISGHNGGTGASPATSIKYAGLPWEMGLTEAHQVLAMNNLRDRVTLRTDGGLRTGRDI
FT                   VMAAMLGAEEYGIGTAALIAMGCIMVRQCQSNTCPVGVCTQDEALREKFTGNADKVVNL
FT                   ITFYASEVREILAQIGARSLDDVIGRADLLTQVSRGSAHLDDLDLNPLLITVDGAADIV
FT                   YDRARARNAVPDTLDAEIVRDAQRFLEDGEKMQLSYAIQNTHRTVGTRTSSHIVKKFGM
FT                   RNNLQPDHLTVKLSGSAGQSLGAFAAPGLKLEVSGDANDYVGKGLSGGRIVVRPPMASP
FT                   IVAGENTIIGNTVLYGATDGYLFAAGRAGERFAVRNSGAKVVIEGCGSNGCEYMTGGVA
FT                   VIVGDIGANFGAGMTGGMAYLYDPEGKAPALMNMETLVTCPVGEGHWMAELRGLLEMHL
FT                   AETNSRRVGDILQHWDIEKQHFLQVCPKEMLVHLPAPLALEEGAIPAE"
FT   gene            complement(63091..63525)
FT                   /locus_tag="RD1_0061"
FT   CDS_pept        complement(63091..63525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29798"
FT                   /db_xref="GOA:Q16DZ5"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ5"
FT                   /protein_id="ABG29798.1"
FT                   /translation="MSTDHLTGQCLCGAVQITVAGAHDPRPGACHCRMCQRWNGGVFMC
FT                   FEAQAEAVTVTGDVARYASSDFSQRAFCPRCGSHLWMRDTDTPGTAYELMPGLFDAARG
FT                   WDVRSEIYVDGAMATLTGDHPRATGAAYEAKNRFVEGDVK"
FT   gene            complement(63522..63956)
FT                   /locus_tag="RD1_0062"
FT   CDS_pept        complement(63522..63956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29799"
FT                   /db_xref="GOA:Q16DZ4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ4"
FT                   /protein_id="ABG29799.1"
FT                   /translation="MGDRQKIDGQCLCGAVQIAAVIDAPTLVACHCGMCQRQNGGPYIS
FT                   IMTEQAGTEASGPIKVFKSSDWAERAFCGTCGSTLWYGTLHDGARYLSSGLFPDAAGAP
FT                   LTLEYFSDNCPQGYAFSGDHRRMTEAETIAAFTEGGEPGA"
FT   gene            complement(64087..65520)
FT                   /gene="gltD"
FT                   /locus_tag="RD1_0063"
FT   CDS_pept        complement(64087..65520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="RD1_0063"
FT                   /product="glutamate synthase, small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29800"
FT                   /db_xref="GOA:Q16DZ3"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ3"
FT                   /protein_id="ABG29800.1"
FT                   /translation="MASQQMLKFVTVERGMPEKREADVRREDFKEIYAEYADAKAKEQS
FT                   SRCSQCGVPYCQTHCPLHNNIPDWLRLTAEGRLREAYEVSQATNTFPEICGRICPQDRL
FT                   CEGNCVIEQSGHGTVTIGAVEKYITDTAWEEGWVLPIAPAQERTESVGIIGAGPGGLAA
FT                   ADVLRRAGVQVTVYDRYDRAGGLLTYGIPGFKLEKDVVMRRNKQLELGGITFELNCTVG
FT                   EDISFEDIRARHDAVIIATGVYKSREIEAPGVGAQGLVRAIDFLTASNRKSFGDAVPEF
FT                   DDGTLNAEGKRVVVIGGGDTAMDCVRTSVRQGATSVKCLYRRDRANMPGSQREVQNAEE
FT                   EGVVFEWLSAPKGFVGDPVTGVMVQKMRLGAPDATGRQAPEVIEGADYVEEADIVIMAL
FT                   GFEPEDLPALWDQPELPVTRWGTIKAAFTTGETDLEGVYAVGDIVRGASLVVWAIRDGR
FT                   DCAEAILQKLDAGAQIAAE"
FT   gene            65746..66549
FT                   /gene="uppP"
FT                   /locus_tag="RD1_0064"
FT   CDS_pept        65746..66549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="RD1_0064"
FT                   /product="undecaprenyl-diphosphatase, putative"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29801"
FT                   /db_xref="GOA:Q16DZ2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DZ2"
FT                   /protein_id="ABG29801.1"
FT                   /translation="MTLFHLILVAAIQGLTEFLPVSSSGHLVLLPALTGQPDQGLAIDV
FT                   AVHVGSLLAVILYFWSDVRIAATGSLRLARGKVDTQGAFLALCLIIATIPVMIAGLIIK
FT                   LTGLDEMMRSVAVIGWTMLGFGLVLYWADRTGASTRTASGWTLKDAFLMGLAQILSLIP
FT                   GTSRSGITITAARRLGYEREGAAKLAMLMSIPTIIASGAVLGADVIGEADWQMARDGAL
FT                   AAALAFVSALLALALMMRLLKSVSFTPYVVYRVILGLILLVYAYS"
FT   gene            complement(66546..67529)
FT                   /locus_tag="RD1_0065"
FT   CDS_pept        complement(66546..67529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0065"
FT                   /product="NADH-ubiquinone oxidoreductase, putative"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29802"
FT                   /db_xref="GOA:Q16DZ1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ1"
FT                   /protein_id="ABG29802.1"
FT                   /translation="MSKLVTIYGGSGFVGRYIARRMAKAGWRVRVAVRRPNEAMFVKPY
FT                   GVVGQVEPVLCNVRDDASVRHVMMGADAVVNCVGILAEDSKNTFDTVQAEGAERIARIA
FT                   AQEGVARMVHISAIGADAHSDSDYARTKALGEAGVLQHMPSAVILRPSIVFGPEDQFFN
FT                   RFADMAKLGPVLPVVGAETRFQPVYVDDVAQAAEKALTETVAPGVYELGGPDVCSFRAL
FT                   MELMLETIHKRRLIVNIPFFAARIMGFTFDMIQKASLGLIRNGMITRDQVKNLARDNVV
FT                   GEGQRGFDALGIEPVTMVSVLPEYLWRFRPSGQYDAIKKSAKNLRS"
FT   gene            67695..67780
FT                   /locus_tag="RD1_0066"
FT   tRNA            67695..67780
FT                   /locus_tag="RD1_0066"
FT                   /product="tRNA-Leu"
FT   gene            complement(68288..69538)
FT                   /locus_tag="RD1_0067"
FT   CDS_pept        complement(68288..69538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0067"
FT                   /product="sulfatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29803"
FT                   /db_xref="GOA:Q16DZ0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DZ0"
FT                   /protein_id="ABG29803.1"
FT                   /translation="MGLSNEDPTLANMMKSLGYTTGQFGKNHLGDQNQFLPTTKGFDEY
FT                   WVWLYHLNAMEYTSDPDWSDDPEFEAQYGPRNVIHAFATEEMDDTVDPRWGLVGNQRIV
FT                   DDGPAPPERQKTLDDEVTARTLDFIDRAVESETPFFVWMAPARAHVWTHLSPEYEAMLG
FT                   NGRGLQDVVMKELDDNVGKVLARLEALNISDNTIVVFTSDNGPETMTWPDGGTTPFYGE
FT                   KGTTWEGGFRVPAIIKWPGKVPEGRVANGIFSGMDWMPTLVAAAGGPDNLPEVMLEGYE
FT                   GYNVHLDSYNQLPYLLGGEESQRDEIVYYEGTSLQAIHYRDWKAHFVVQHHGWAGPKDE
FT                   LNAPLLFNLRRDPYEKAAEESGMYTIWMGKKMWAFGPAARLVQGHLQSFQAFPPRGAVV
FT                   DNQDKVEKQVTTEGGMS"
FT   gene            complement(69950..70813)
FT                   /locus_tag="RD1_0068"
FT   CDS_pept        complement(69950..70813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29804"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY9"
FT                   /protein_id="ABG29804.1"
FT                   /translation="MHRFLTRALAWMFALTAMIAMAARADQAEVDELFTSVQAAVAAQG
FT                   LNPVIEIDHARLAAAEGVEMPASRVQLFSDSAINASLMLENIRAGLDLPFRVLAFDQNG
FT                   STSLTYTSSAFLSQRHGLTDARALAAFDARLNDLVAHSERARVAPVPTLDVGPDFGIVE
FT                   LRSRYDVPETVARLKAAVTAQPDTIWFGEIDFQVEAAQLGISLVASRLLLFGGPAPGGV
FT                   AMAEYPAIGLDAFCQKVFVYAGDDGNAVVIYNDIAALAKLHYGTSIDPHRMLNKRLRAT
FT                   FTPATE"
FT   gene            complement(70868..72958)
FT                   /locus_tag="RD1_0069"
FT   CDS_pept        complement(70868..72958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0069"
FT                   /product="mechanosensitive ion channel protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29805"
FT                   /db_xref="GOA:Q16DY8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY8"
FT                   /protein_id="ABG29805.1"
FT                   /translation="MSEGWPTASADDTPPKPLPRPSIGQSMTETRIEIVVTGGNAEATI
FT                   DQLASQLQDSEAVVSGADTAAQPAELIASSISASAALPQNINAWFAQIAVSEGYQPLAT
FT                   LAICAVIFAIAYLLERVIARLLSGSVSEPVTTLQKLGNATRWGGARGLSLLAFYGMSLV
FT                   GIHVVFDASTEAFELAAVALSSLMLPRAWLLVLEVLTGSQDPHRRANSLSDLEASHVMR
FT                   SALCLVVFFAATAFARDFVLGVVDAGDSGALFAVATRALDAMATGFFFFSVRKPVGGLI
FT                   VNALSCDTGNPKLFVRLLSRFWPALYIFLFLLQIIAEARGYLSGTLGEDASALKRSFAV
FT                   FVLTPFIVASLGIWRDDLMSRTDWDRRGRVAGVFSLLEGTVTVGAAIFILYAWNIDPFA
FT                   TDLEGAKRILPGLVSAAIVTVIGVSAWRMISGFFDKGTVGGADDEANVPDGEGGVGGSR
FT                   LETVLPILRTALAVLIGTVTVLLALSSLGVQIAPLLAGAGILGLAVGFGAQKIVEDIIS
FT                   GVLYLIEDAFRKGEYIETNEGQGVVDAIMLRSIRLRHHLGAVYTVPFSSIGTVQNHSRD
FT                   WVTVKLSFEVAPTQDLEKVRKLVKKVGAQLMQDPELEGQFLAPLKSQGAVAMVGSNYKI
FT                   GVKFTSKPGEQFLIRRKALNAIQKAFSENNVQIAAPRVIVDTGGEAAAAAAKTVIDRAA
FT                   PA"
FT   gene            73014..73127
FT                   /locus_tag="RD1_0070"
FT   CDS_pept        73014..73127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29806"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY7"
FT                   /protein_id="ABG29806.1"
FT                   /translation="MTPQVALSPYIDPYALLEPATPAGLVTRFYQRCAPYF"
FT   gene            complement(73785..74429)
FT                   /locus_tag="RD1_0071"
FT   CDS_pept        complement(73785..74429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29807"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY6"
FT                   /protein_id="ABG29807.1"
FT                   /translation="MSRDSILAKIDAATQTAPLVEIDAQASALIADPDSYRADFAPQPL
FT                   IARFIEKATSETVTATVEQLASLADIPAAVSHYLTEKELGAKIAVQPRACLRGIDWSGV
FT                   QITDHAQMNEPIALTIADAGIAETGSLVFFTGPDAPVLLNFLPLHHLAVLRSSTIRPYM
FT                   EDVFDAFGTTRAKQGRSCNIITGTSGTADIEARNVRGAHGPRFMHILLISE"
FT   gene            complement(74433..75839)
FT                   /locus_tag="RD1_0072"
FT   CDS_pept        complement(74433..75839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0072"
FT                   /product="4Fe-4S binding domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29808"
FT                   /db_xref="GOA:Q16DY5"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY5"
FT                   /protein_id="ABG29808.1"
FT                   /translation="MKQTSHQFNENVARALAEPTLKVALDRTTTLLRTRRAKVIDAFPQ
FT                   YAKARETAQKIKDHTLDHLGHYLRQFEENAKANGAQVHWAATPEDARQIVSDICRAQNA
FT                   KTATRVKSMLGEEIGIAQALSDAGVERVETDLAEHIIQLADDPPSHIVMPAMHKTHEQV
FT                   AELFAQKHKDPGDQQDIPSLVESARRELRPKFMNADISISGANFLIADTGSFVTITNEG
FT                   NAELTTTPPKTHIVTVGIEKMVPSLKHAAVFIRLLSRAAIGTEITQYTTFYNGPKRDGD
FT                   RDGPENLHIVLVDNHRSDMLSDFLRPMLRCIRCGACMNHCPVYAAVGGHAYGAVYPGPM
FT                   GSVLTPAMTGLKGSKDLPNACTLNGRCKEVCPVNIPLPDMLRSLRARQFESGMVTPKAR
FT                   WSLKLWAMLATRPALYHFGTSVANMMLRVLARGRGKISAVPLAGGWTRTRDLPQPEAGT
FT                   FMQQYRKQKR"
FT   gene            complement(75850..76620)
FT                   /locus_tag="RD1_0073"
FT   CDS_pept        complement(75850..76620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29809"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY4"
FT                   /protein_id="ABG29809.1"
FT                   /translation="MTNNDGPHVGFFVTCIVDSMRPNIGFASLKLLEDAGCTVEVPTAQ
FT                   TCCGQPAFNSGDDATTKAIAKQVIEAFEPFGYVVVPSGSCASMIRSHYGELFADDPAWQ
FT                   SRQKALSAKTWEVLSFLTDVMKYTPSATYQGTATYHDSCSGLRDLGVHDQPRALLAHVQ
FT                   GLSVVPLEGNNECCGFGGTFCVKYPELSTAVVTDKTTKIKATQADTLLGGDMGCLMNMA
FT                   GKLSREGREMRVFHTIEVLADMADGPGICAPRLK"
FT   gene            complement(76746..78467)
FT                   /gene="dld"
FT                   /locus_tag="RD1_0074"
FT   CDS_pept        complement(76746..78467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dld"
FT                   /locus_tag="RD1_0074"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29810"
FT                   /db_xref="GOA:Q16DY3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY3"
FT                   /protein_id="ABG29810.1"
FT                   /translation="MTNDDLIAKLKTIAGARHVLTGDRQTERYRKGFRSGEGEAIAVVI
FT                   PGSLVEMWEILKACVAADKILIMQAANTGLTEGSTPKGTYDRDVVILSTLRLDRIHLLR
FT                   DGQQIVSLPGGTLFGLEKQLAPYGRQPHSVIGSSCIGASIMGGVCNNSGGALVQRGPAY
FT                   TELSLYAQITHEGQLELVNHLGINLGNSPEEILTRIDNGAFSDKDLSDDAGRASDAGYP
FT                   ERVSDVDADSPARFNADPRTLHEASGCAGKLAVFAVRLDTFPIATGEKVYYVGTNDPAQ
FT                   LTELRRRALTELPELPVSGEYLHRECFDIARKYGKDTLLMINWLGTDFLPRIFAMKGAM
FT                   DARFAKVPFLPANLVDRVMQVVSNILPEALPKRMMDFRARFEHHLILKVSADSIVGTES
FT                   ILNDTVGADGWFACDPKETKKAMLHRFAAAGAAIRYHAVHPGTTEDILALDIALKRNDR
FT                   NWVETLPPEIEDQLVAKMYYGHFFCHVFHQDYLVKKGCDPKALKEQMLALLDTRGAEYP
FT                   AEHNVGHLYAAKPALANHYKTLDPTNSFNPGIGKTSRERYYGAPCGCGVDHPAAAE"
FT   gene            78658..79296
FT                   /locus_tag="RD1_0075"
FT   CDS_pept        78658..79296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0075"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29811"
FT                   /db_xref="GOA:Q16DY2"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY2"
FT                   /protein_id="ABG29811.1"
FT                   /translation="MTDATKPAPRTDLIICPNCDAVFSLARPGHGEKAVCSRCETVLIT
FT                   PRRNAGLQIIALSLSIVILISTAAVFPFLSVDAIGIKNSVSILETALVFSDGPLAVLSL
FT                   TTAALILFIPLLRVMLCLYVIVPLVRDRAPAPYSADAFRVAEALRPWSMAEVFAIGCAV
FT                   ALIKVSALVHVTFGPAFWLFSVLVMLVVVQENIICRWSVWNALSRPRRS"
FT   gene            79254..79913
FT                   /locus_tag="RD1_0076"
FT   CDS_pept        79254..79913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0076"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29812"
FT                   /db_xref="GOA:Q16DY1"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY1"
FT                   /protein_id="ABG29812.1"
FT                   /translation="MVRMERIEPTQKIVTARELGLVGCVRCHQVWPEDTARCGRCGHAL
FT                   KSRDTKSLQRVWAFWLIGLMCYIPANIYPMLQTRMLFYVQDSTIIGGAVELIEYGSIGI
FT                   ALVILFASVAIPIGKFIAIAFLAISLHRPTTVSNHQRQRLLEIVEYIGRWSMIDIFVVA
FT                   ILSSLVQLQLIVTINPGAASIFFAAAVIFTMISAQSFDSRLIWDQINAQDEKPKNE"
FT   gene            79906..81987
FT                   /gene="pqiB"
FT                   /locus_tag="RD1_0077"
FT   CDS_pept        79906..81987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="RD1_0077"
FT                   /product="paraquat-inducible protein B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29813"
FT                   /db_xref="GOA:Q16DY0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DY0"
FT                   /protein_id="ABG29813.1"
FT                   /translation="MNDAPPVPIEKEPKSLISNLSIVWIIPALALVTALFVAWQSYNAR
FT                   GPVITVEFENAAGIVPRETEVRFRDVQVGLVEEVMFSEGLSSVVAKVRLDKSVAPYVDS
FT                   TASFWIVRPEFSASGISGLDTVLSGVFIQGSWDSTIGPPASAFKGLDRAPLYQTGSADL
FT                   QIALRSLPGGTLSADTPILYRGIEIGRVGPARISPEGNFAIAEAVIYEPHGRLITPSTR
FT                   FWDASGFSFTIGPAGAEIDFTSVASLLGGGITFDTFVSGGEQVGDGSVFEVFPSETDAR
FT                   NSVFNASEVDLLEVRVIFDENISGLTLGAPVELSGLRIGSVENLSGVVDPETYGDSRVR
FT                   LAAVLGIQPARLGLPEEVTPQSALMLLEEQVRNGLRARLASTSILTGGLKVELVQLPDA
FT                   PPALVEVFEGSIPRMPTAPSEISDAAASVEGVFTRINRLPIEEVLTSVTDFLRAAENLL
FT                   TSEDLRAAPQDLRGLLGDIRGVVTSQTVQDIPVTLNVALVRLDGILAQIEEQQGVARIL
FT                   ASIDAATSAATAVGTSIEGLPDLVTELAGVAAEAASLPLADLTQQVTDVLASADAVVSA
FT                   PAMQELPASLAGALDELNRTLAELREGGAVDNVNATLRSTRNAADAVALSAQDLPDLVD
FT                   RITQVFDEASATIAGYNRGEVLSRDAQAALRDISQASNAISSLARLLERNPSALIRGR"
FT   gene            81988..82548
FT                   /locus_tag="RD1_0078"
FT   CDS_pept        81988..82548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0078"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29814"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX9"
FT                   /protein_id="ABG29814.1"
FT                   /translation="MRPFPFLLSALICLSACGAASDRYTVTSPQVTQTQTIAFRAVEVR
FT                   DVSLPAYAADDEITVQTTDGRILSDGGVLWADTPDRAVALELSRYLTQITRARVASAPW
FT                   PFEALPDARLDVRFETLVAGDDGQYRASGQYFVAVPDGRRERAGLFDLSVPFDPLIGPP
FT                   AIASARGQIILDLAVFIARNGLR"
FT   gene            complement(82648..83775)
FT                   /locus_tag="RD1_0079"
FT   CDS_pept        complement(82648..83775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0079"
FT                   /product="aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29815"
FT                   /db_xref="GOA:Q16DX8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX8"
FT                   /protein_id="ABG29815.1"
FT                   /translation="MKVKIHRLFEYLLESTQSKPEAIVGFSLSASPTLGDFIPDIDPSL
FT                   SLDWNNRDFRGLPELRAHVLAQAGLNGVCTPSDVLITAGASEANYLAIMQLVEPGDDIV
FT                   IETPGWPQAEVLAKAKGANVVYVARSERDNWVLPLDTLRAAVTPRTRLIFLTNPNNPTG
FT                   QVLDVGALRDIVDIADRVGAWLLVDEVYAGLEWEGPRAPSIAGLYDRGITTGSVSKALG
FT                   LQGLRTGWLICRDPTLVMDAIILRENTSEIMNIMGEVIAEIALRPDRLAPRLQDARSAG
FT                   AANLARLTSWLETEPQLSWVAPKAGLIGLGRLPEGCDSDAFAKLLLADPYRTFVLPGSA
FT                   YGQPQHIRLGVGGGAGVNLEQGLARLSQALRDWSA"
FT   gene            83827..84579
FT                   /locus_tag="RD1_0080"
FT   CDS_pept        83827..84579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29816"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX7"
FT                   /protein_id="ABG29816.1"
FT                   /translation="MQPLLHGRPARLAILDYGLFQVHEDGRIIGICGYLIQTTAGENVL
FT                   IDTGFPAKYGVDHAAATEEDALGDFGQVLSLTETNLAPAQLALLGLARSDIDLMIQSHT
FT                   HIDHVGFIGGFPGVPILIAATERALPRPLYWSGKQALEWPDADYIELQSDTRLGPGFDV
FT                   LLVPGHAPGQLAFVLELPHTGAVVLTSDAISRPSELDTDFAGAWDAPLARQHANRLMRR
FT                   AQDDKAMVIYGHCPAQWSELRKAPNWYD"
FT   gene            complement(84576..84767)
FT                   /locus_tag="RD1_0081"
FT   CDS_pept        complement(84576..84767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29817"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX6"
FT                   /protein_id="ABG29817.1"
FT                   /translation="MEKFRHERGREVKKMAFFTSAAGGFGHVLHPAEIAAWPGFLVSPA
FT                   GDVSSGKVIILNQRRHLR"
FT   gene            complement(84780..84938)
FT                   /locus_tag="RD1_0082"
FT   CDS_pept        complement(84780..84938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29818"
FT                   /db_xref="GOA:Q16DX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX5"
FT                   /protein_id="ABG29818.1"
FT                   /translation="MHLVSPFSGIVMWLRIVFFYLIVFYCAQRRKPSRDRMNARAFHKA
FT                   SRFADPG"
FT   gene            84933..86558
FT                   /locus_tag="RD1_0083"
FT   CDS_pept        84933..86558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0083"
FT                   /product="glutamate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29819"
FT                   /db_xref="GOA:Q16DX4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX4"
FT                   /protein_id="ABG29819.1"
FT                   /translation="MHFLEPMLRFTTMAVVAALAVASALAAMIWSVWLIIPFVVFAALT
FT                   LLGIHDLRQPHHSILRNYPVLGHMRFLFEGIRPEIRQYLIESDQDEEPFSRDARSLVYQ
FT                   RAKGEEDKRPFGTRMRVYDAGYAWVTHSVNPIHITDTDFRVTIGGPKCAQPYCASIYNI
FT                   SAMSFGSLSGNAIEALNTGAKMGGFAHDTGEGSVSKYHKIGGGDLIFQVASGYFGCRHE
FT                   DGTFNPDKFRETASLDQIKMIEVKLSQGAKPGHGGMLPASKITEEIAEARGIPMGVDCV
FT                   SPAGHSSFSTPLEMMEFIGQLRSLSNGKPVGFKLCIGHRREFMCMVKAMLQTGIVPDFI
FT                   VVDGTEGGTGAAPVEFSNHVGMPMVEGLAFVHNTLRGAGLRDQIKIGAAGKIVSAFDVA
FT                   RALALGADWCNSARGFMFAIGCIQAQACHTNHCPVGVATQDPLRARALDVVSKSERVAR
FT                   YHRNTLKALGEMTGAAGLEHPGCFMPQHMMLRLGDKKMAEASDIFAYLPEGFLINNQEG
FT                   SPIMEDYRKRWNRADAASFAAPGF"
FT   gene            complement(86744..88468)
FT                   /locus_tag="RD1_0084"
FT   CDS_pept        complement(86744..88468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0084"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29820"
FT                   /db_xref="GOA:Q16DX3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX3"
FT                   /protein_id="ABG29820.1"
FT                   /translation="MTGGFLDGDVFRGLAFRILVFLTLALLPFGLIAVFQTREIARQAN
FT                   SNSELSLLALTDQAASAERSIFQEAFGAAEALSALAQLYASDARACSSFLSAYRRAVGL
FT                   YSFISYLPPDGIVRCSSAGGSYDFSNAPDFIKELANPRRQITANPSGEISAEPVLVLSQ
FT                   PFFTRAGFAGFMTMSVPLGVISANMADPLDGMPAHLVTFNADGKIIRSDRADDMTKADM
FT                   PADKSLRALVGQDSVVFQSTNTLGEARIYAVVPVVPDVAYAMSIWRPDEMEESLQQSIG
FT                   LSLALPVIMWLASLVVAFWSLNRLAVRHIRKLGRQMRHFAFNRRVPRTTLGQGVPRELV
FT                   EIQNAFVRMADSIVRDEAALEDTLRDKNILLKEVHHRVKNNLQLISSIMNMQIRRAESD
FT                   DARQVLKRLQERILSLATVHKNLYQTENLDRVDAGKLLEEIIGQLLTMGLSASAGVQVS
FT                   QHYASIQMDADDAAPLTLLVSEALTNALKYLGAPENGGSARLDITFEMAAEETACFRIA
FT                   NTTSGAQGSAGTGLGTQLISAFTRQLNGTVEVGYQQQEHWLEVTFPLRERVKGTYDF"
FT   gene            complement(88470..89027)
FT                   /locus_tag="RD1_0085"
FT   CDS_pept        complement(88470..89027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0085"
FT                   /product="RNA polymerase sigma factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29821"
FT                   /db_xref="GOA:Q16DX2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX2"
FT                   /protein_id="ABG29821.1"
FT                   /translation="MNDPDPRFALLDHLPAMRGFATSLTRDSVAADDVVQDAVIKAWTS
FT                   FDQFQPGTNLRAWLFTILRNTFYSSTRKSGREVADVDGVHFGALAEKPAHDGRLQMTDF
FT                   RSAFAQLPDEQREALLLVGASGFSYEEAAEMCGVAVGTIKSRTGRGRQRLAELMQLEDE
FT                   EALEMTDDATLSVLTAAKATTF"
FT   gene            complement(89024..89191)
FT                   /locus_tag="RD1_0086"
FT   CDS_pept        complement(89024..89191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29822"
FT                   /db_xref="InterPro:IPR041649"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX1"
FT                   /protein_id="ABG29822.1"
FT                   /translation="MISMAQSGAQRKRDSIIDQSLKQAYDQVADEGVPDRFRLLLDALK
FT                   EQEQQQGRSK"
FT   gene            89289..90098
FT                   /gene="tcrX"
FT                   /locus_tag="RD1_0087"
FT   CDS_pept        89289..90098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcrX"
FT                   /locus_tag="RD1_0087"
FT                   /product="two-component response regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29823"
FT                   /db_xref="GOA:Q16DX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DX0"
FT                   /protein_id="ABG29823.1"
FT                   /translation="MSNPSDTTDISSQLANYLPYLRRFARAMTGSQSSGDRFAAAALET
FT                   ILTDRSVLDGSDVKTGLFRVLYRIWSSAGAPVDDAESGLKARAQKHMAKLTDNSREALL
FT                   LHTLEGFSFDKIANIIGIEQTEAESLVSIARREIADAASGSVMIIEDEAIIAMDLESIV
FT                   SEMGHRVTGIATTRAEAVALGKADAPDLILADIQLADNSSGIDAVNDLIEALGERPVIF
FT                   ITAFPERLLTGEKHEPAFLISKPYAEDQVISSVSQAMFFSSTETLTT"
FT   gene            complement(90109..91029)
FT                   /locus_tag="RD1_0088"
FT   CDS_pept        complement(90109..91029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0088"
FT                   /product="ribonuclease BN, putative"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29824"
FT                   /db_xref="GOA:Q16DW9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW9"
FT                   /protein_id="ABG29824.1"
FT                   /translation="MTSRISIGLLGKALFAAFGLVGRSNLALIAAGVAFYSMLSIFPAL
FT                   AALIAVLSLIADPEVVVVQLAELQELMPEDVYDILNAQIVGLVSTSSDTLGWTGLVSVI
FT                   VALWSARAGVGAMMHGLNVVYATDSRGTWRHYLRAVLLTVSLVAIGIIALLALVVAPVI
FT                   LAFLALGGFTSVIIDLLRWGVGIAVIFAGIGLLYRFGPNRRPAITRFVTPGSVFAAVSW
FT                   AALSIAFSYYVAHFGNYNEVYGSIGAVIAMLVWLWISSFLVLFGAALNAEIEARTEPSD
FT                   AKPVADDPREDQEVPTDDAELAPTS"
FT   gene            91266..92525
FT                   /locus_tag="RD1_0089"
FT   CDS_pept        91266..92525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0089"
FT                   /product="aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29825"
FT                   /db_xref="GOA:Q16DW8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW8"
FT                   /protein_id="ABG29825.1"
FT                   /translation="MPEFAPDLMQDIRSRFAHVDACPFQGPRVFFENAGGALTLNSAVE
FT                   TSAKFAAIPDNQGRDNPAAQALVKIIDRAKSDMALFFSAHGGQFFVGESGTELTFRLIR
FT                   TAAMGSGAGSIIGSTVEHPASRSAARHWAEQAGKPYISVPHDDATGAVTPAAYAALMTP
FT                   DVRVATILHTSPVTGIANDVAGISAAIRAVAPDAFIIVDGIQHASHGRIDIAGYDIDGY
FT                   VISPYKVFSRHGYGVAWVSDRMTALPLEQLIDGPRASWEMGTRDTGAYATFSDVVQYFE
FT                   WLGTQHTDSDDREQRIRAAGGAIHAHEQVLTHAMLRGTGNLPGLAELPGVTILGGADNP
FT                   RREGLVCFALDHVPAVEIVEKLNAQGIRTHIRKADHYSGNILSPLGLTSAVRVSLCHYN
FT                   TLTEVSAFLAAMKDIAARAK"
FT   gene            92563..93852
FT                   /gene="dapE"
FT                   /locus_tag="RD1_0090"
FT   CDS_pept        92563..93852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="RD1_0090"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29826"
FT                   /db_xref="GOA:Q16DW7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW7"
FT                   /protein_id="ABG29826.1"
FT                   /translation="MQPDLAAAIENRRDDLIALTQALIRIPTLNPPGCEYHTICQLIAS
FT                   RLEARGFAIEMIRARGTPGDSDTYPRWNVVARHDGATQGECVHFNSHIDVVEVGQGWTH
FT                   DPFAGTLQDGRIYGRGACDMKGGLAASIIAVEAFIDTYPDYAGAIEISGTADEESGGYG
FT                   GVAYLAERGYFDPQRVQHAIIPEPLNKDRICLGHRGGWWAEIETHGEIAHGSMPFLGDC
FT                   AVRHMGAVLSEFEDKLFPAMALRRTDMPVVPDGARQSTMNINSIHGGQAEQDADFDGLP
FT                   AHCVPDSCRIVIDRRFLLEEPLDQVRAEVTGLLETLKQTRPDFEYTLTEINSVLPSMTD
FT                   RDAPIVRVVAQAIEEVIGNPPDYVASPGTYDQKHIDRIGKLKNCIAYGPGILELAHKPD
FT                   EYVGVDDMIDSAQVMAQSLVTLLTGKAQSV"
FT   gene            complement(93937..94791)
FT                   /gene="panC"
FT                   /locus_tag="RD1_0091"
FT   CDS_pept        complement(93937..94791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="RD1_0091"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29827"
FT                   /db_xref="GOA:Q16DW6"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DW6"
FT                   /protein_id="ABG29827.1"
FT                   /translation="MTVPVLRTLSALRSATREWHLAGETIGVVPTMGALHDGHLSLVAA
FT                   AKSACDRVIVTIFVNPKQFNKASDLASYPRTEEDDARKLARFDVDAVYAPDVSQIYPEG
FT                   FCTNVSVAGMTDVLCGAHRPGHFDGVATVVTKLFTQTSADKAFFGEKDFQQLMVVQRMA
FT                   RDLDIPIEVVGCPTIREEDGLAMSSRNLLLSDRARTMAPRMHEIMQEAATALGQGAPFD
FT                   ALQATALRQLTAAGFTDVDYFELRSCASLSLLDHASVPARLFAAAWLAGVRLIDNIDVP
FT                   VAR"
FT   gene            complement(94788..95627)
FT                   /gene="panB"
FT                   /locus_tag="RD1_0093"
FT   CDS_pept        complement(94788..95627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="RD1_0093"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29828"
FT                   /db_xref="GOA:Q16DW5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DW5"
FT                   /protein_id="ABG29828.1"
FT                   /translation="MSATARQTAPMPVDIKSRKGGEPIVSLTAYTTPMAQMMDAHCDIV
FT                   LVGDSLGMVLHGLPSTLEVTMEMMILHGRAVSRGLSRAMMVIDMPFGSYEQSPEQAFES
FT                   AARLMRETGAGAVKLEGGQHMAQTIEFLVQRGIPVMAHIGLTPQSINTLGGYKVQGRGP
FT                   QAEVLMQDAKAVAAAGAFSVVLEKTPQGLSDEITASIDIPTIGIGASAGCDGQILVVDD
FT                   MLGLFTAFKAKFVKRYAELGDLGAAAIAAYAADVRARRFPAPEHVFADAEPKANTKR"
FT   gene            95873..96634
FT                   /locus_tag="RD1_0094"
FT   CDS_pept        95873..96634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29829"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW4"
FT                   /protein_id="ABG29829.1"
FT                   /translation="MAGWPKSFTEKKRRARGICRAMLLGMSASMALSTPGLADDWDYTI
FT                   TPYIWAPALDLNLDVGPNPPIRGDVSMLGILDGALLLQGQARRGRWSFLGEFNYLNLSD
FT                   NFGVSSTDPRAEWRLKGTMVSLAAGYAVYDNADTRIEAIGGIRAWDLETSTEVSNLTAS
FT                   RTSTFVDPMIGMRVETPLGQGFNFHGLANIGGSNFGSDRQVEAIAQVNWPWTQRTSLSA
FT                   GYRYLSLDFDEDQVLIDATMEGPFIAVSFDF"
FT   gene            96769..97056
FT                   /locus_tag="RD1_0095"
FT   CDS_pept        96769..97056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29830"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW3"
FT                   /protein_id="ABG29830.1"
FT                   /translation="MSESVNRDANDSDARKGGDSAQWERAMTDLEIQASKLADRAEKAT
FT                   HAERMMLQPQIDRVLTTLAMRGAPVSGRLRRINNTLKDEALDDMFDNMPV"
FT   gene            complement(97134..98264)
FT                   /locus_tag="RD1_0096"
FT   CDS_pept        complement(97134..98264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0096"
FT                   /product="acetoin utilization protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29831"
FT                   /db_xref="GOA:Q16DW2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW2"
FT                   /protein_id="ABG29831.1"
FT                   /translation="MKAPRLIGAEIFRHSSYGRWHPLRVPRVSTVMDLSRAMGWLPPAQ
FT                   FITAPRAKPKALLAWHTADYIAALQRVEATQEATPHDTQRHDIGTVTNPVYPEIFRRPA
FT                   TAAGGSLLAGELLREGGIIYNPPGGTHHGMPDRANGFCYLNDPVLAMLSLRRNGVQRIA
FT                   YVDIDAHHCDGVAAGFHGDPQCLMISVHEEGLWPRTGLLEDTAGGAGLNLPVPRGLNDT
FT                   EMAYIRDRLILPQVEAFRPDAVVLLCGADGVEEDPLAHLCLSNNAHWAVTKALMGIAPR
FT                   MLVLGGGGYNPWSVGRLWTGVWATLNGHDIPDRLPPEAQAVLRALRFEGNRRGKNPPEH
FT                   WFTTLRDAPRPGPVRSDITDRVAELSRKAARLRLDH"
FT   gene            98445..98945
FT                   /locus_tag="RD1_0097"
FT   CDS_pept        98445..98945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0097"
FT                   /product="acetyltransferase, GNAT family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29832"
FT                   /db_xref="GOA:Q16DW1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW1"
FT                   /protein_id="ABG29832.1"
FT                   /translation="MRDDIILSPITQTQHREDALDLAMRATDYATLEVGHAPDGAYIRD
FT                   FFTAVPPGLGPDCLMHFGVMEGPAMVGMICIAEGYEFPDDWWIGLVLLDPAFRGQGVGH
FT                   KVVSDIKTRARNRRINLLKLAVLAANPRALKFWHREGFTHHRDAPATPQSDGHDRIVLK
FT                   YQL"
FT   gene            98961..99707
FT                   /gene="linX"
FT                   /locus_tag="RD1_0098"
FT   CDS_pept        98961..99707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linX"
FT                   /locus_tag="RD1_0098"
FT                   /product="2,5-dichloro-2,5-cyclohexadiene-1,4-diol
FT                   dehydrogenase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29833"
FT                   /db_xref="GOA:Q16DW0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DW0"
FT                   /protein_id="ABG29833.1"
FT                   /translation="MRLSGKTAIITGGASGFGAGIARRFIAEGCRVMVADINGDAAAQM
FT                   AIELGENAVAQKVDVSDGASVDAMAEAAQEVWGDVDILINNAGVTHLPAPMEDVSESDF
FT                   DRVLAVNVKAVYLTARAFVPRMKARGQGVILNVASTAGVSPRPNLNWYNASKGWMITAT
FT                   KTMAVELAPNGIRVNALNPVAGETPLLKTFLGEDTPEMREKFLSTIPLGRFSSPEDLGN
FT                   AACYLCSDEATMITGVALEVDGGRCI"
FT   gene            99704..100054
FT                   /locus_tag="RD1_0099"
FT   CDS_pept        99704..100054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29834"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DV9"
FT                   /protein_id="ABG29834.1"
FT                   /translation="MKPINLAEKLGQFTSHWDPHVVAQYNDNDVMVVRFQGEFPFHMHA
FT                   DTDDFFLVLQGEMTMDLEDASHVVKAGELFVVPRGVTHRPRAEAECHVLLIEPKGEPNT
FT                   GDPATAAAKPHI"
FT   gene            100056..101048
FT                   /locus_tag="RD1_0100"
FT   CDS_pept        100056..101048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0100"
FT                   /product="peptidase, T4 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29835"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DV8"
FT                   /protein_id="ABG29835.1"
FT                   /translation="MRPGPRNLITDVAGLRVGNAQDHKLKSGATVLTADAPFTASVHVM
FT                   GGAPGTRETDLLAPDKSVASVDALVLSGGSAFGLEACTGVVDGLRAMGRGFAVGSAIVP
FT                   IVPGAILFDLINGGVKDWSTNPYPALGRRALDTASDTFEIGTAGAGTGATTATLKGGLG
FT                   SSSLVLDNGITVGALVAANPFGAVTTPGSRHFFAAPYEMGNEFAGLGPDPTKGHGLPVR
FT                   TKVLHGTGAGANTTIAIVATDAALDKAQCQRMAIAAHDGMARAIVPSHTPMDGDLVFAL
FT                   STGGKALADLDMIGHGAALCLTRAIARAVYAATPQPGDLLPSWHDLPIS"
FT   gene            complement(101045..102982)
FT                   /gene="dxs"
FT                   /locus_tag="RD1_0101"
FT   CDS_pept        complement(101045..102982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="RD1_0101"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase,
FT                   putative"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29836"
FT                   /db_xref="GOA:Q16DV7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DV7"
FT                   /protein_id="ABG29836.1"
FT                   /translation="MTDTKTPTLDRVAGPADLRSMSDTELRNVADELRAEVVEAVSQTG
FT                   GHLGSSLGVVELSVAIHAVFDTPRDKLVWDVGHQCYPHKILTGRRKQMPTLRQGGGISG
FT                   FTKRSESEYDPFGAAHSSTSISAALGFTISRDMGQPTGDAVAVIGDGSISAGMAYEAMN
FT                   NAGHEGRRMFVILNDNEMSIAPPVGAMSSYLSSLSELSRAGPFGGLVAIAEGMEQLAPK
FT                   PVRDGARRARELVTGLENRGTFFEELGFDYIGPIDGHDMAQLLSVLRGAKARATGPVLI
FT                   HCCTVKGKGYAPAEGSADKYHGVSKFDVGTGVQAKAKANAPSYTAVFGDALTTLAEEDP
FT                   SVVAVTAAMPSGTGVDRMAKRFPNRVFDVGIAEQHGVTFAAAMAATGLKPFCAIYSTFL
FT                   QRGYDQIVHDVALQGLPVRFAIDRAGLVGADGATHAGSFDIGYLGALPGMVVMAAADEA
FT                   ELVHMVATAGAHNDGPIAFRYPRGNGTGVPLPETGRVLEIGKGRMIREGDGEVAILSLG
FT                   TLLSDCEAAARILEAEGINATIADARFAKPLDMALIANLVQTHKALITVEQGAMAGFGA
FT                   MVLQSMAAEGLLDLGCKVRTMCLPDRFIDQAAPAEMYRDAGLDTMGIVEQVTRVLGRDL
FT                   KVVTLNAKRR"
FT   gene            complement(103204..104319)
FT                   /gene="pufC"
FT                   /locus_tag="RD1_0102"
FT   CDS_pept        complement(103204..104319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufC"
FT                   /locus_tag="RD1_0102"
FT                   /product="photosynthetic reaction center cytochrome c
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29837"
FT                   /db_xref="GOA:P26278"
FT                   /db_xref="InterPro:IPR003158"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023119"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26278"
FT                   /protein_id="ABG29837.1"
FT                   /translation="MFPKWFDKWNADNPTNIFGPAILIGVLGVAVFGAAAIVSIGNPAQ
FT                   TASMQTGPRGTGMHVAEFNVTRFAPDPTIEEYYTEAPYIPEGGEELAKDIYENVQVLGD
FT                   LTDDNFNRVMTAMTQWIAPEEGCVYCHGEGDLETYGEDNLYTKVVARRMIQMTQNINEN
FT                   WDGHVNANAEVGVNCYTCHRGEHVPSEIWFNITPVTEATAGWASVQNRATPLSQSTSLP
FT                   SNALEIYLTEYEAVNVHDLESRVAGVPNDVEVASIQKTEMTFSLMNYFSNSLGVNCVFC
FT                   HNSRAFYDPGQHTPQWATALLGRQMVIEMNQEYLIPLEDEYPEDRLGPVYADAPKAACK
FT                   TCHKGYQKPMQGLNVIADWPELATTEAPVYE"
FT   gene            complement(104322..105317)
FT                   /gene="pufM"
FT                   /locus_tag="RD1_0103"
FT   CDS_pept        complement(104322..105317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufM"
FT                   /locus_tag="RD1_0103"
FT                   /product="photosynthetic reaction center M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29838"
FT                   /db_xref="GOA:P26279"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005781"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26279"
FT                   /protein_id="ABG29838.1"
FT                   /translation="MMYPEYQNIFTQVQVRGTPEMGMDDAGNNMMEERVGKPFFSTLAG
FT                   LFGNGQIGPYYFGWTSIVAFGTGIAWFVIVGFNMLAQVGWSIPQFIRQLFWLALEPPSP
FT                   EYGLSMPPLNDGGWYIIASFFLLVSVMTWLLRAYLLAEQHKMGKHIFWGFAAAVWLFLV
FT                   LGLFRPILMGSWSEAVPYGIFPHLDWTTAFSIRYGNLYYNPFHCLSIVFLYGSVLLFCM
FT                   HGGTILAVTRYGGDRELEQIYDRGTATERAALFWRWTMGFNATMEGIHRWAWWFAVLTP
FT                   ITGGIGILLTGTVVDNWFIWAQEHHFAPMYDGSYGYEDYGSYEAFIGKEN"
FT   gene            complement(105319..106170)
FT                   /gene="pufL"
FT                   /locus_tag="RD1_0104"
FT   CDS_pept        complement(105319..106170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufL"
FT                   /locus_tag="RD1_0104"
FT                   /product="photosynthetic reaction center L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29839"
FT                   /db_xref="GOA:P26280"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005871"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26280"
FT                   /protein_id="ABG29839.1"
FT                   /translation="MALLSFERKYRVRGGTLVGGDLFDFWVGPFYVGFFGVTTAFFALL
FT                   GTILIFWGASQQGTFNPWLINIAPPDLSYGLGLAPLLEGGLWQIITICATGAFISWALR
FT                   EVEICRKLGMGYHVPFGFAAAIIAYMTLVIFRPLLMGAWGHGFPYGIFSHLDWVSNVGY
FT                   AYLHFHYNPAHMLAVTLFFTTTLALALHGGLILSACNPEKGEEAKTPDHEDTFFRDFIG
FT                   YSVGTLGIHRLGYLLAINAGLWSAICIIISGPVWTAGWPEWWNWWLDMPIWGEPIAVIG
FT                   GM"
FT   gene            106185..106316
FT                   /locus_tag="RD1_0105"
FT   CDS_pept        106185..106316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29840"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DV3"
FT                   /protein_id="ABG29840.1"
FT                   /translation="MCGTPVSNRSDKGLREMRNWPLCRHASKAEAVDKLSYEFAAGV"
FT   gene            complement(106396..106554)
FT                   /gene="pufA"
FT                   /locus_tag="RD1_0106"
FT   CDS_pept        complement(106396..106554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufA"
FT                   /locus_tag="RD1_0106"
FT                   /product="light-harvesting protein B-875, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29841"
FT                   /db_xref="GOA:P26273"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002361"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26273"
FT                   /protein_id="ABG29841.1"
FT                   /translation="MAKFYKIWLIFDPRRVFVAQGVFLFLLAAMIHLVVLSSGLNWFEA
FT                   AAAVGGQ"
FT   gene            complement(106567..106719)
FT                   /gene="pufB"
FT                   /locus_tag="RD1_0107"
FT   CDS_pept        complement(106567..106719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufB"
FT                   /locus_tag="RD1_0107"
FT                   /product="light-harvesting protein B-875, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29842"
FT                   /db_xref="GOA:P26274"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002362"
FT                   /db_xref="InterPro:IPR023623"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26274"
FT                   /protein_id="ABG29842.1"
FT                   /translation="MADNTDLSFTGLTDEQAQELHSVYMSGLFLFAAVAVVAHLATYIW
FT                   RPWFG"
FT   gene            complement(106901..107134)
FT                   /gene="pufQ"
FT                   /locus_tag="RD1_0108"
FT   CDS_pept        complement(106901..107134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pufQ"
FT                   /locus_tag="RD1_0108"
FT                   /product="protein pufQ"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29843"
FT                   /db_xref="GOA:Q16DV0"
FT                   /db_xref="InterPro:IPR008800"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DV0"
FT                   /protein_id="ABG29843.1"
FT                   /translation="MMDTTVQAPAHSREHVKRKNGVEFSVYFAIIFVATLPLATLTWAM
FT                   HAIKSRSFTDKGPMARAWSQARIITPMIFSAY"
FT   gene            complement(107152..108627)
FT                   /gene="bchZ"
FT                   /locus_tag="RD1_0109"
FT   CDS_pept        complement(107152..108627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchZ"
FT                   /locus_tag="RD1_0109"
FT                   /product="chlorophyllide reductase subunit Z"
FT                   /EC_number="1.18.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29844"
FT                   /db_xref="GOA:P26277"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010244"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26277"
FT                   /protein_id="ABG29844.1"
FT                   /translation="MLVTDHDRAGGYWGAVYAFCAVKGLQVVIDGPVGCENLPVTSVLH
FT                   YTDALPPHELPIVVTGLGEGEMGSGTEESMKRAWDTLDPALPAVVVTGSIAEMIGGGVT
FT                   PQGTNIQRFLPRTIDEDQWEAADRAMTWIFTEFGMTKGRMPPEKKRGEGARPRVNILGP
FT                   MYGTFNMPSDLAEIRRLVEGIGCEVNMVLPLGAHVAEMRNLVNADVNICMYREFGRGLS
FT                   ELLAKPYLQAPIGVESTTKFLRALGNLVGLDPEPFITQEKHSTIKPVWDLWRSVTQDFF
FT                   ATASFGIVANETYARGIRQFLENDLGFPCAFAVARIAGKKTNNEEVRAMIGQKKPLIVL
FT                   GSINEKMYLAEQKAGFGPAPAFIPASFPGAAIRRHTGTPFMGYAGATYLLQEICNGLFD
FT                   ALFHILPLGTDMDATDATLTPLRRDFPWDEDAQAMLDRIVETHPILTRISAAKSLRDAA
FT                   EKAALAAGDERVVLSTVRALDPASAGPDLEDQT"
FT   gene            complement(108716..110245)
FT                   /gene="bchY"
FT                   /locus_tag="RD1_0110"
FT   CDS_pept        complement(108716..110245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchY"
FT                   /locus_tag="RD1_0110"
FT                   /product="chlorophyllide reductase subunit Y"
FT                   /EC_number="1.18.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29845"
FT                   /db_xref="GOA:Q16DU8"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010245"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU8"
FT                   /protein_id="ABG29845.1"
FT                   /translation="MIKGHPHGDVSRVASDAPADAMGCHSGADMAEAARNAGQSELLDK
FT                   FKADYPVGPHDKPQSMCPAFGSLRVGLRMKRVATVLSGSACCVYGLTFVSHFYGARRSV
FT                   GYVPFNSESLVTGKLYEDIRDSVHELADPDRYDAIVVTNLCVPTASGVPLRLLPKEING
FT                   VRIVGIDVPGFGVPTHAEAKDVLAGAMLNYARAEAMAGPVAAPVGGKSARPTVAMLGEM
FT                   FPADPMMIGQMLAPMGLAAGPVLPCREWRELYAALDCAVVAAIHPFYVDTVREFKAAGR
FT                   PVVGSAPVGYDGTAAWLKAIGETHGVSAEDIAAAQNAVLPAIRGALGATPINGTITLSG
FT                   YEGSELLVARLLIESGANVPYVGTACANSPWSADDAAWLEAKGVKVKYRASLEDDCAAM
FT                   EAIQPDLAIGTTPVVQKAKQLGIPGLYFTNLISARPLMGVAGAGSLATVINAAIGNKER
FT                   MAHMQEFFEGVGAGDTAGVWEGAPNLRPDFRAQHQKKLDKLARAAKAQEMI"
FT   gene            complement(110444..111448)
FT                   /gene="bchX"
FT                   /locus_tag="RD1_0111"
FT   CDS_pept        complement(110444..111448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchX"
FT                   /locus_tag="RD1_0111"
FT                   /product="chlorophyllide reductase subunit X"
FT                   /EC_number="1.18.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29846"
FT                   /db_xref="GOA:Q16DU7"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR010246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU7"
FT                   /protein_id="ABG29846.1"
FT                   /translation="MKDEVPNLKDFDKRLRDEAQAEPTLEVPQGEPASKTQIIAIYGKG
FT                   GIGKSFTLANLSHMMAEQGKRVLLIGCDPKSDTTSLLFGGKACPTIIETSTRKKLAGEE
FT                   VKIGDVCFKRGGVFAMELGGPEVGRGCGGRGIIHGFELLEKLGFHDWDFDYVLLDFLGD
FT                   VVCGGFGLPIARDMAQKVILVASNDLQSLYVANNVCSAVEYFRKLGGNVGVAGLVINKD
FT                   DGTGEAAAFAEAVDIPVLASIPQDDDLRKKSANYQIVGTQESQWGDLFAMLGDNVAVAP
FT                   PQRPTPLDQDGLLGLFDASETGGDYVLVPATDVDMRGKNAEPKPSLEVVYDDA"
FT   gene            complement(111445..112386)
FT                   /gene="bchC"
FT                   /locus_tag="RD1_0112"
FT   CDS_pept        complement(111445..112386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchC"
FT                   /locus_tag="RD1_0112"
FT                   /product="2-desacetyl-2-hydroxyethyl bacteriochlorophyllide
FT                   A dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29847"
FT                   /db_xref="GOA:Q16DU6"
FT                   /db_xref="InterPro:IPR005903"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU6"
FT                   /protein_id="ABG29847.1"
FT                   /translation="MDTTAVLLKGPKDLDVDTLQLHVPGDGDLVVEIEHSGISTGTEKL
FT                   FWSGEMPPFPGMGYPLVPGYEAVGEVVEADRATGFKVGERVFVPGANCYDGAFGLFGGA
FT                   ASRVVTASDRVTRIDAGHGASGALLALAATARHSMAGLNKSVPDLIVGHGVLGRLLARL
FT                   TIAAGAPAPMVWEIDESRRKGAQGYEVIAPEDDPRRDYTSVYDASGSVEVLNDLVGRLA
FT                   KGGEIVLAGFYTTAISFAFPPAFMKEARFRVAAEWTHDDLAATRALVEGGSLSLENLIT
FT                   HQASHLNARAAYAQAFTDPDCLKMILNWKDVA"
FT   gene            complement(112514..113620)
FT                   /gene="crtF"
FT                   /locus_tag="RD1_0113"
FT   CDS_pept        complement(112514..113620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtF"
FT                   /locus_tag="RD1_0113"
FT                   /product="hydroxyneurosporene methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29848"
FT                   /db_xref="GOA:Q16DU5"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU5"
FT                   /protein_id="ABG29848.1"
FT                   /translation="MPEWRGGWLNRLVARPGFQSWASRFLLTRGQARRDGAILFDVVQG
FT                   FVQSQVLMAVVELDLLRRLRGGPQSAEMLGRATAIPPERMQVLLQAAAALKLLKRTRSG
FT                   QYGLARKGAALMGVPGLEAMIRHHRAFYTDLKDPVDLLRGPERTELSEFWPYVFGARGE
FT                   IDPQVAEAYSDLMAQSQLLVAQDTLRTVSLKGVQHLLDIGGGTGAFLKAVGDAYPNLKM
FT                   TLFDLPQVTPGATARFEQAGMMDRVTLHPGSFRDDLLPDGADAISLIRVLYDHADDTVA
FT                   TLLEDVFDALPDGGRLIISEPMGGGAQPDRAGDVYFAFYTMAMQTGRTRSAEEITALCQ
FT                   AAGFTDIRCPRPARNYVTRVISARKPNQ"
FT   gene            complement(113634..114518)
FT                   /gene="crtE"
FT                   /locus_tag="RD1_0114"
FT   CDS_pept        complement(113634..114518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtE"
FT                   /locus_tag="RD1_0114"
FT                   /product="geranylgeranyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29849"
FT                   /db_xref="GOA:Q16DU4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU4"
FT                   /protein_id="ABG29849.1"
FT                   /translation="MGMNSRIEAAIAQAVAVGQGRGAVPQRLSSALGYATAPGGARIRP
FT                   TILTSVALACGDDQPKLTDAAASALELIHCASLVHDDLPCFDDADTRRGKPSVHKAYSE
FT                   PLAVLTGDSLIVLAFEILARQSGLAPDRVAQMILILSQRTGMPGGICAGQGWESEAEID
FT                   LSAYHQAKTGALFIAATQMGAVAAGQEAEPWFELGARIGEAFQVADDLRDALYDADTLG
FT                   KPVGQDDLHGRPNAVTLLGVQGAISRLKDILGGAIASIPSCRGEAQLADMVRRYAERLT
FT                   PVAPNVAASRSNV"
FT   gene            114612..116162
FT                   /gene="crtD"
FT                   /locus_tag="RD1_0115"
FT   CDS_pept        114612..116162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtD"
FT                   /locus_tag="RD1_0115"
FT                   /product="methoxyneurosporene dehydrogenase"
FT                   /EC_number="1.14.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29850"
FT                   /db_xref="GOA:Q16DU3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR008150"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU3"
FT                   /protein_id="ABG29850.1"
FT                   /translation="MHVSTAPLIPDRPRAIVIGAGIAGLAAALRLATSGMQVTLLERHN
FT                   HPGGKIRTLSSAAGPVDAGPTVLTMRHVFDDLFACAGTRLKDHVTLVPQSILARHFWPD
FT                   GSKLDLHADPLLSRDAIAAFAGNTSADEFMQFNRRTQQLFDAFDAPMMQAPNPRMRDLV
FT                   PHVLKQPQLIAAMAPLSTLKTSLGRAFSDPRLAQLFGRYATYVGGAPHLSPAILSLIWQ
FT                   AEAAGVWVVEGGMHKLAHAIAKLARHAGVDIRYNTHVDRIKTVGGRAVGVEIDGTYLLE
FT                   AEAILYAGDPRALATGSMGADLRVVAPQTVKLPRSFSARVHSFAATPQGRDLTHHNVFF
FT                   AADPDCEFKELMAGRMPADPTLYLCAEDRGHGADIPTLERFEMISNAPATETHTPPQEI
FT                   EKWHQQIMQRMADMGVTFTPMPTTETLTTPQDFAMLFPETLGALYGQTPHGLTAALQRP
FT                   TAQTPIAGLWLAGGGTHPGAGVPMATLSARHAAEAILRAQTSTSLSAPTATPGGMSTG"
FT   gene            116012..117031
FT                   /gene="crtC"
FT                   /locus_tag="RD1_0116"
FT   CDS_pept        116012..117031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtC"
FT                   /locus_tag="RD1_0116"
FT                   /product="hydroxyneurosporene dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29851"
FT                   /db_xref="GOA:Q16DU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU2"
FT                   /protein_id="ABG29851.1"
FT                   /translation="MARGGRHPSGGGGPDGDTLRPARGRGDLARPNFNVAVGPNGYAWW
FT                   YVDGLSDCGSRAVSVIGFIGSVFSPWYRWSGRKCPQDHVCINVATYGPGGRFTMTDRGQ
FT                   SALRQTASRLQVGPSMMRWDGNDLVIEINEVSSPPLINRIRGEIRVTPSAITNVELPLT
FT                   PDGAHVWRPFAPRARISVNIDRPGWQWQGEGYFDANFGSRALEEDFSYWTWGRFPTSGG
FT                   ATCFYDATRLDGTELSAGFAFDHDGTARKIEMPPKTGFRRTLWAVKRETRSDAGYKPHQ
FT                   VMSMLDAPFYSRSAVRTRIDGEETTGVHEALDLTRFRSPLLKPMLAVRVPRRKNWSWD"
FT   gene            117165..117887
FT                   /locus_tag="RD1_0117"
FT   CDS_pept        117165..117887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29852"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU1"
FT                   /protein_id="ABG29852.1"
FT                   /translation="MYHIKTGTLAGLLALSAGPVVAQGGAWTYEGSFYLFAAETTLNVG
FT                   GIEGELSFSDALDNLEFAGMGAFTASNGQWTFIADLMYFNLGFENSTPGDAFSRLDTSS
FT                   KTTVFNALALYKMRDASSYSFHLGGGFRYFNTDTTLRLRPGTQPGTTVGDDNSWTDPIV
FT                   AAMGRFELSDTWSTTISADYGNFVNDRETYQFTVTFDYEFAENWTARAGYRYLNVDNDD
FT                   DDFRLEQSGPVLGVSYRF"
FT   gene            complement(117907..118389)
FT                   /gene="crtK"
FT                   /locus_tag="RD1_0118"
FT   CDS_pept        complement(117907..118389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtK"
FT                   /locus_tag="RD1_0118"
FT                   /product="CrtK protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29853"
FT                   /db_xref="GOA:Q16DU0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DU0"
FT                   /protein_id="ABG29853.1"
FT                   /translation="MFWLLFSLFLVACVGAGLTGGLFPPGPWYRKLQKPWFTPPDWVFP
FT                   VTWSVLYVCIAVAGARIAMAENNAVAMAFWTLQIAFNGLWTPVFFGIRNIRLGMAVVCM
FT                   LWVIVLGGIIVMWPVDQIAALLFVPYLIWVTIAASLNAGVWWLNPEVARNPPHVAT"
FT   gene            complement(118413..119432)
FT                   /gene="crtB"
FT                   /locus_tag="RD1_0119"
FT   CDS_pept        complement(118413..119432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /locus_tag="RD1_0119"
FT                   /product="phytoene synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29854"
FT                   /db_xref="GOA:Q16DT9"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT9"
FT                   /protein_id="ABG29854.1"
FT                   /translation="MIAPADMEHCREAIRHGSLSFHAASKLLPAHVRDPALALYAFCRL
FT                   ADDEVDLKQDKVASVLRLRDRLDQVYAGRPKDAPTDRAFAAIVEEFEMPRALPDALLEG
FT                   LAWDAAERRYDTLSGVKDYSARVASAVGAMMCVLMRVRDADALARACDLGVAMQLTNIA
FT                   RDVGEDALERRIYLPLEWLEDAGIEVEVFFADPRATKAVRGMVKRLVMEANRLYMRSEA
FT                   GVGALPRGCRPGIYGARFIYAGIGGQLTRMGYDSISARARTNKWQKIGWLGQSMLLSGA
FT                   SMIMPKSSVLYARPLPEVQFLVDATAIGAPQRSRSDALMSVLSTLEARRQAQRAELTG"
FT   gene            complement(119429..120976)
FT                   /gene="ctrI"
FT                   /locus_tag="RD1_0120"
FT   CDS_pept        complement(119429..120976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctrI"
FT                   /locus_tag="RD1_0120"
FT                   /product="phytoene dehydrogenase"
FT                   /EC_number="1.14.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29855"
FT                   /db_xref="GOA:Q16DT8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT8"
FT                   /protein_id="ABG29855.1"
FT                   /translation="MMTRIETIESVETGDRAGARAIVIGAGLGGLAAAMRLGAKGYRVT
FT                   VIDKLDVPGGRGSAIWQDGHRFDLGPTIVTVPQLYRELWQACGRDFDADVTLKPLDPFY
FT                   EIRWPDGTKFVAQQDTEKLRAEVAKLAPGDLAGFDKFLVDSSKRYWFGFEDLGRRSMHK
FT                   LWDLVKVLPTFALLRADKSVYAHAASRVKDEKLRMALSFHPLFIGGDPLHVTSMYILVA
FT                   YLEKEFGVHYAMGGLAGMAQAMGRVIEDQGGTLLMNTQADEIVVRDGTVTGVRLESGLE
FT                   MGADVVVSNADAGHTYTRLMRNHKKKRWTPAKLKKTRYSMSLFVWYFGTKGTRGDWKDV
FT                   GHHTILNGPRYAGLLKDIFIKGKLCDDMSLYVHRPSVTDPSVAPEGDDTFYVLSPVPHL
FT                   GHDNGVDWAVEEPKYKAKMLKVLEDQLLPGLTAKISTEVVFTPETFRDRYLSPLGAGFS
FT                   IEPRILQSAWFRPHNVSEEAKGLYLVGAGTHPGAGVPGVISTAEVLGKLVPDAETVK"
FT   gene            121082..121798
FT                   /gene="crtA"
FT                   /locus_tag="RD1_0121"
FT   CDS_pept        121082..121798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtA"
FT                   /locus_tag="RD1_0121"
FT                   /product="spheroidene monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29856"
FT                   /db_xref="GOA:Q16DT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT7"
FT                   /protein_id="ABG29856.1"
FT                   /translation="MTERPVVSISFFRFSRIPARIWALYMMGRARLSLPSVPGIGFWKL
FT                   CGSGSGEGFTPLPNTAVFAILATWPDEQTARQQIDTAPIFAKYHRKASESWTIFLETAS
FT                   VRGVWSGDTPFHPTGQKITGPLAALTRATVKPSLALKFWRRVPDISQMIGSDENVAFKI
FT                   GIGEVPLLHQVTFSLWPDANAMAAFARMNGPHAAAIRAVRDEDWFAEELYARFAILGDT
FT                   GSWEGASPLEKLELHA"
FT   gene            121795..122799
FT                   /gene="bchI"
FT                   /locus_tag="RD1_0122"
FT   CDS_pept        121795..122799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchI"
FT                   /locus_tag="RD1_0122"
FT                   /product="magnesium-chelatase 38 kDa subunit"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29857"
FT                   /db_xref="GOA:Q16DT6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT6"
FT                   /protein_id="ABG29857.1"
FT                   /translation="MKTPFPFSAIVGQREMKQAMVLTAVDPGIGGVLVFGDRGTGKSTA
FT                   VRALAALLPPIRAVESCPVNSSRAADCPEWAELGSKKLVSRPTPVIDLPLGATEDRVVG
FT                   ALDIERALTRGEKAFEPGLLARANRGYLYIDEVNLLEDHIVDLLLDVAQSGENVVEREG
FT                   LSIRHPARFVLVGSGNPEEGELRPQLLDRFGLSVEVRSPNDVAERVEVIKRRDAFESDF
FT                   DAFMAHYSAEDTKVRDTILKARKRLAKIKTPDDILHDCAALCIALGSDGLRGELTLLRT
FT                   ARALAAYQGDKVLSRAHLRDIAPSALSHRLRRDPLDEAGSGARVARIVAEVLG"
FT   gene            122796..124454
FT                   /gene="bchD"
FT                   /locus_tag="RD1_0123"
FT   CDS_pept        122796..124454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchD"
FT                   /locus_tag="RD1_0123"
FT                   /product="magnesium-chelatase 60 kDa subunit"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29858"
FT                   /db_xref="GOA:Q16DT5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT5"
FT                   /protein_id="ABG29858.1"
FT                   /translation="MSHESDSWDRAALALRLLTVENADLGGAVIRMRASPARDHVLAAL
FT                   RGLKLRKIHPTISDDQLFGGLDLAATLESSHLVENTSFFDDKTNALLVMAERCGTGLAA
FT                   KLAQILDRDAGHMLIALDEGAEADEHAPPALADRLALHIEPEGRMPEGWQPAPAGTSAL
FT                   DPRHVTVSAGDIQTLAEIAAVFGIDSLRAPLLALRVARAHAALNGRDKVTDSDLNVAAE
FT                   LTYPHRATRLPQEPDAAEDPPAPPEDSPEDDAAGDSDTLSLPEGDMLVEAVKALLPPDL
FT                   LAGLAPAGTSRGASGAGAGQKRKGNRRGRPLPSRPGRLDGRARIDLVATLRAAAPWQPL
FT                   RQRAVPTRTGLHIRPSDIRLKRYQEQSDRLLIFTVDASGSAAMSRLNEAKGAVELLLAQ
FT                   AYAARDHVALVAFRGEGAELLLPPTRSLVQTKRRLASLPGGGGTPLAAGLQQAALLAQQ
FT                   SRSKGLTPTVVVLTDGRANIALDGTPDRTAAQADSEQMAQIIQTQNIAALVIDMSKRPQ
FT                   EPLRALSARLGAPYLALPRADAERLTGAVNAALDA"
FT   gene            124455..125327
FT                   /gene="bchO"
FT                   /locus_tag="RD1_0124"
FT   CDS_pept        124455..125327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchO"
FT                   /locus_tag="RD1_0124"
FT                   /product="magnesium-chelatase 30 kDa subunit"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29859"
FT                   /db_xref="GOA:Q16DT4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT4"
FT                   /protein_id="ABG29859.1"
FT                   /translation="MRWPPPKDWPHADHSRQVFCHPHRWHVQEFGAGPTVLLLHGAGGS
FT                   THSFRDLATALSKNHHVVAIDLPGQGYTQLGARHRSGLASTTEDIVALCAQEGWQPVAI
FT                   IGHSAGGALALRLSERVFSPQEQTPRVIGINPALDNFKGLAGVLFPVLAKLLAAVPFTA
FT                   QIFASATSSPARIAALIRSTGSELDAQGLSYYQRLISNRNHADATLMMMAQWSLDDLLR
FT                   DLPTIPAQTLFIVGDKDATVPPSVSDKAAQKLQNARVIHLEHLGHLAHEEAPEEIARLI
FT                   LAFLSDHGA"
FT   gene            complement(125483..125716)
FT                   /locus_tag="RD1_0125"
FT   CDS_pept        complement(125483..125716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29860"
FT                   /db_xref="GOA:Q16DT3"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT3"
FT                   /protein_id="ABG29860.1"
FT                   /translation="MDNRKLTSLFEITGSLSAMVYAVLIASNTGNEILGFSLLLISASL
FT                   FAAWAVIDRRWTFLMLQAFYGGSAILGLVRWG"
FT   gene            complement(125920..126339)
FT                   /gene="cycA"
FT                   /locus_tag="RD1_0126"
FT   CDS_pept        complement(125920..126339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycA"
FT                   /locus_tag="RD1_0126"
FT                   /product="cytochrome c-551"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29861"
FT                   /db_xref="GOA:P07625"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07625"
FT                   /protein_id="ABG29861.1"
FT                   /translation="MTRTLAVVLAMTFSAAPVFAEGDIEAGEKAFNKCKSCHQIVSDAG
FT                   EEIVKGGRTGPNLYGVLGRQAGTADFRYGDDLVAAGEAGLVWDADNFVEYVTDPRAFLR
FT                   AYLDDSKAKSKMAYKLRSGGEDIAAYLASVSGSSS"
FT   gene            complement(126413..127627)
FT                   /gene="hemA"
FT                   /locus_tag="RD1_0127"
FT   CDS_pept        complement(126413..127627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="RD1_0127"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /EC_number="2.3.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29862"
FT                   /db_xref="GOA:Q16DT1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT1"
FT                   /protein_id="ABG29862.1"
FT                   /translation="MDFDALFQAQLDTLKEDGNYRIFAELERQAGKFPQAKCHNEDSPD
FT                   QVTVWCSNDYLGMGQHPTVINAMKGAIDAYGAGAGGTRNISGTNHAHKLLEAELADLHH
FT                   KDDALLFTSGYVSNWAALSTLGSRLHDAVILSDELNHASMIEGIRHSRANKVLWKHNDP
FT                   EDLDRKLSALPANCPKIVAFESVYSMDGDICPMKEIVEVAEKHGAMTYLDEVHAVGLYG
FT                   PRGGGISEREGLQDRITLIEGTLGKAYGVVGGYITGSEAMCDFIRSFASGFIFTTALPP
FT                   AVATAAQASIRHLKQSDQERKLQQERVAYLRKRLDMEGIPHLENPSHIIPVMIGDPVKC
FT                   RMIADYLMQQYGIYVQPINYPTVPKGTERLRFTPGPLHSIEDIEHLVLALKELWKQCAI
FT                   SHAVA"
FT   gene            complement(127617..128438)
FT                   /gene="puhE"
FT                   /locus_tag="RD1_0128"
FT   CDS_pept        complement(127617..128438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puhE"
FT                   /locus_tag="RD1_0128"
FT                   /product="PuhE protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29863"
FT                   /db_xref="GOA:Q16DT0"
FT                   /db_xref="InterPro:IPR017496"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DT0"
FT                   /protein_id="ABG29863.1"
FT                   /translation="MSIWSASLLALFVWWFSTGAILWVVKVADRRGGNAGTLATLWGLP
FT                   MLALGIFGFWSTLDDMSAQGAVLAFLSALAIWGWIELAFLTGVITGPNTYPLPPNTPEW
FT                   ERFIRAWGTLAYHEMLLVFTLISMFLVEWNMMAGNKFATWTFAVLFFARISAKLNLFWG
FT                   VPRINVDFLPNALAHLATYFRIRPLNWLFPISVSALTFAAACWLERMHGAETQGQIIGF
FT                   ALLSVITALALLEHWVMVLPIPDEKLWRWMLPAPKQPTPKATTLKGGHHGL"
FT   gene            complement(128440..129477)
FT                   /gene="acsF"
FT                   /locus_tag="RD1_0129"
FT   CDS_pept        complement(128440..129477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsF"
FT                   /locus_tag="RD1_0129"
FT                   /product="magnesium-protoporphyrin IX monomethyl ester
FT                   aerobic oxidative cyclase"
FT                   /EC_number="1.14.13.81"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29864"
FT                   /db_xref="GOA:Q16DS9"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008434"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS9"
FT                   /protein_id="ABG29864.1"
FT                   /translation="MDSESATEVAMQNTLLTPRFYTTDFDELDAIDVSSVREDWDKLIA
FT                   QMVSDPNKGHFKKNEDWDHVDWENMEPTLKKEFLDFLISSCTAEFSGCVLYKEMKRRGN
FT                   NKDITQLFQLMARDEARHAGFINDALREAGVAVNLGFLTQKKKYTYFRPKFIYYATYLS
FT                   EKIGYARYITIFRHLEKHPEHRFHPIFKWFEEWCNDEFSHGEAFALLMKTDPKLTSGKN
FT                   VLWIKFFLTAVYSTMYVRDHQRPAFHKALGVDPDWYAHEVFTKTSELTKQIYPITLDIE
FT                   HPRWQRGLEKMQKANADLAEATQNGKFFAKIGAQARAVSAFISLITIPAKKHKVPTETL
FT                   MRPAY"
FT   gene            complement(129552..129848)
FT                   /locus_tag="RD1_0130"
FT   CDS_pept        complement(129552..129848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29865"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS8"
FT                   /protein_id="ABG29865.1"
FT                   /translation="MGLLTKDFERAPCTVEISHKFESLHAHVRFNNGAVIYPGDEVQVH
FT                   GGEIMAPFGEVISEDREATIIRASKLERLWTRLTGDFEVMELCEFSFSEEVKL"
FT   gene            complement(129869..130336)
FT                   /gene="puhC"
FT                   /locus_tag="RD1_0131"
FT   CDS_pept        complement(129869..130336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puhC"
FT                   /locus_tag="RD1_0131"
FT                   /product="PuhC protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29866"
FT                   /db_xref="GOA:Q16DS7"
FT                   /db_xref="InterPro:IPR017495"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS7"
FT                   /protein_id="ABG29866.1"
FT                   /translation="MATHTQPRIHAKEEDLVPRIMVRIMFGLVLTILGIVTVATLTGRA
FT                   PDSQPPVGALLSERAIYLSGDASGAARVLDEHGTLLADFTPQNGGFVAGIERVIARERG
FT                   KSGIDMSAPILLQLREGNRLSITDPVTGWSAELMGFGATNSRTFARLLDKP"
FT   gene            complement(130342..130980)
FT                   /gene="puhB"
FT                   /locus_tag="RD1_0132"
FT   CDS_pept        complement(130342..130980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puhB"
FT                   /locus_tag="RD1_0132"
FT                   /product="possible photosynthetic co"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29867"
FT                   /db_xref="GOA:Q16DS6"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS6"
FT                   /protein_id="ABG29867.1"
FT                   /translation="MSHDDFEIEPVEGLPAKPPKGENILWQGRPDWWRLAVESLNVKWV
FT                   AGYFILLALWRFVSQLDLLPLGQAIGAAVPFLLLGLVTCGMLTLVAVAQARATVYTVTD
FT                   ARVAMRIGAALNVTLNIPYTQVGNAMLDLRPGKTGTIALETIGETRLSYLTCWPHVRPW
FT                   HFREAQPALRCIPDAERVARLLSEAAEARVSVPTVTRARPQAAQAVAAE"
FT   gene            complement(131068..131835)
FT                   /gene="puhA"
FT                   /locus_tag="RD1_0133"
FT   CDS_pept        complement(131068..131835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puhA"
FT                   /locus_tag="RD1_0133"
FT                   /product="photosynthetic reaction center H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29868"
FT                   /db_xref="GOA:Q16DS5"
FT                   /db_xref="InterPro:IPR005652"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="InterPro:IPR015810"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR037097"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS5"
FT                   /protein_id="ABG29868.1"
FT                   /translation="MTAAFFGEFDLASLSLWLFYIFFAGLIIYIQRENMREGYPLEDDE
FT                   GNPSSNPSMWPVPSDKTFKLPHGRGEVTVPSGQTPERADIALKRTGPGNGFPLEPTGDP
FT                   MLDGVGPASWAPRRDAPELDGHGHPKIVPMSAAEGFIVSAGRDPRGLPVMSGDKEIVGK
FT                   ITDMWIDEPEQLVRFLEFELEGKWGSGTRLVPMTFANIKSNRVNIAALYGEHFANVPTI
FT                   ASPRQITLLEEDKIAGYYGGGKLYAGTRQEPKL"
FT   gene            complement(131858..133291)
FT                   /gene="lhaA"
FT                   /locus_tag="RD1_0134"
FT   CDS_pept        complement(131858..133291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhaA"
FT                   /locus_tag="RD1_0134"
FT                   /product="LhaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29869"
FT                   /db_xref="GOA:Q16DS4"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS4"
FT                   /protein_id="ABG29869.1"
FT                   /translation="MNVAGLKRLSLKAMPFADAASDGLPLPQLLRLSLFQISVGMAAVM
FT                   LLGTLNRVMIVELTVPAMVVAVMIALPVLIAPFRTLLGFRSDTHRSAIGWKRVPYIWFG
FT                   TLWQFGGLAIMPSALLVLGGDVYIDVPFAGEILAALAFVMTGLGMHMTQTAGLALASDR
FT                   ATDETRPRVVALLYVMFLVGMGISSLIIGFLLRDFTPLKLIQVVQATAVITAVLNLIAL
FT                   WKQESLQPMSRTEREAPRPRFKDAWDDFIKGGQAGRLLACIFVGTMAFNMQDVLLEPYG
FT                   GEILGLSVSSTTLLTAMWSLGALLGFALAGKRLAEGSDAFRLAAGGILAGVGAFCMVIF
FT                   AAPLNSPALFFSGAGMIGFGGGLFAVATLTACMTLPETGMAGRGLALGAWGAAQATAAG
FT                   LSIAIGGSLRDWTGSIAMSGAWGEGLVSPATGYSVVYHLEIVLLFVTLVILGPLVRRRV
FT                   YHTTRESGSRPMGLADFPT"
FT   gene            complement(133288..134016)
FT                   /gene="bchM"
FT                   /locus_tag="RD1_0135"
FT   CDS_pept        complement(133288..134016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchM"
FT                   /locus_tag="RD1_0135"
FT                   /product="magnesium protoporphyrin IX methyltransferase"
FT                   /EC_number="2.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29870"
FT                   /db_xref="GOA:Q16DS3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS3"
FT                   /protein_id="ABG29870.1"
FT                   /translation="MRDEVTLSTGATPAAQQRYSATLGRVETYFDKTATRTWERLTSDA
FT                   PVSKIRQTVRQGRDRMRDLMLSRLPADLTGHRVLDAGCGAGQMTIELAARGAEVLATDI
FT                   SPSLVQIAEARLPEDLRKQVTFTSGDMLCHTLGQFDHVIAMDSLIYYDETDIGRALAAL
FT                   EARTGGSIVFTVAPRTKALMAMWYAGKLFPRSDRSPVMIPHDAGRLARAALAQGVSGQV
FT                   APVERVTSGFYISQLMEVRV"
FT   gene            complement(134016..134915)
FT                   /gene="bchL"
FT                   /locus_tag="RD1_0136"
FT   CDS_pept        complement(134016..134915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchL"
FT                   /locus_tag="RD1_0136"
FT                   /product="light-independent protochlorophyllide reductase
FT                   iron-sulfur ATP-binding protein"
FT                   /EC_number="1.18.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29871"
FT                   /db_xref="GOA:Q16DS2"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DS2"
FT                   /protein_id="ABG29871.1"
FT                   /translation="MSPLDRTPPSLRGQDGEGSVQVHQDETAKIEGAKVFSVYGKGGIG
FT                   KSTTSSNLSAAFSMLGKRVLQIGCDPKHDSTFTLTGSLVPTVIDILKEVDFHPEELRAE
FT                   DFVFDGFNGVKCVEAGGPPAGTGCGGYVVGQTVKLLKQHHMLEDTDVVIFDVLGDVVCG
FT                   GFAAPLQHADRALIVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRSRETDEVD
FT                   RYCDTVGFNRIAHMPDLDAIRRSRLKKKTLFEMPDDEEIVQVRKEYIRLAETLWNGTEP
FT                   LAPAPLPDRDIFELLGFD"
FT   gene            complement(134968..138540)
FT                   /gene="bchH"
FT                   /locus_tag="RD1_0137"
FT   CDS_pept        complement(134968..138540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchH"
FT                   /locus_tag="RD1_0137"
FT                   /product="magnesium-chelatase, subunit H"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29872"
FT                   /db_xref="GOA:Q16DS1"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DS1"
FT                   /protein_id="ABG29872.1"
FT                   /translation="MRDEVGINGQLPGYRVVVVTLDSHAAGPAMRAAERLSADYPGLDV
FT                   SIHAAAEWGETPGTFEAAKAAVETGDIIIANLLFLEEHYARILPSLEARRPHCDAMIGV
FT                   IADASIVKLTKMGALDMMAPKSGAMKLMKKLRGSSKPSSSSGADKMALLRRLPKILKFI
FT                   PGKSQDLRAWFMSMQYWLGGSDDNVEAMMRFLLNRYARNPGWAKAPEAPAPIEYPDAGL
FT                   YHPDLPTRITTDLNDLPRPEGATATVGLLLMRSYVLSSDTAHYDAVIRSFEARGIAVRA
FT                   AFAGGLDGRPAIDAYFRDQSGTQIDAMVSLTGFSLVGGPAYNDNDAAIAVLKDLDVPYL
FT                   AAHPLEFQTLEQWACSTQGLGPIETTMLIALPELDGATNPTVFAGRHGTAGCHGCNHDC
FT                   EMKSDHKAMAPCIERVDSLVEKTIRMTTLRRKTNAEKTLGIVLFGFPPNAGAVGTAAYL
FT                   SVFESLFNTLHRLKADGYDVEVPETVDALRDKVLAGNARQYGQEANVADHVTADTIVKT
FT                   TPPLAAIEAVWGPAPGRIQSDGRGVFILGAHFGKVFVGVQPAFGYEGDPMRLLFEKGFA
FT                   PTHAFTTFYLWLRNTLKADAILHFGMHGALEFMPGKQAGLGARDWPDRLIGEMPNIYLY
FT                   ASNNPSEASLAKRRSGAVTITHLTPPLAASGLYKGLLDLKDSLTRWRAMDQDSDERDEL
FT                   QALIAQQADAVDMGDVTPDQLWLKLLETEDALIPDGLHILGKPLSDAARAEYLSIMDHA
FT                   DDATRARVDALLQQETELDAICRALSARYIAPVPGGDLIRSTDILPTGRNIHAFDPFRM
FT                   PTAFACQDGAKQAQLLLDTHQTLPRTVALVLWGSDNIKSDGGPIAQALALMGCVPRFDS
FT                   FGRLAGADLISLEDLGRPRIDVIMTLSGIFRDLLPLQTRMLAEAAQKCAMADEPVELNY
FT                   IRAHALAYAEKTGCDMAEASLRVFSNAEGAYGSNVNQLVDSSAFGDEDELADAYQARKS
FT                   FAYGTDGKASSNAALLQSQLAEVDVAYQNLESVELGVTTVDHYFDTLGGIARAVKRAKG
FT                   SEAAVYIGDQTRGSGKVRTLKEQVALETRSRSLNPKFFEGLLKHGAEGVRQIEAQVTNT
FT                   MGWSATTGQVDPWVYQRLSETFVLDEDMRQRLADLNPTASSRMANRLLEAHDRNYWSPD
FT                   AETLAALQDAADALEDQLEGIAAQ"
FT   gene            complement(138530..140071)
FT                   /gene="bchB"
FT                   /locus_tag="RD1_0138"
FT   CDS_pept        complement(138530..140071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchB"
FT                   /locus_tag="RD1_0138"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   B subunit"
FT                   /EC_number="1.18.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29873"
FT                   /db_xref="GOA:Q16DS0"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DS0"
FT                   /protein_id="ABG29873.1"
FT                   /translation="MKLTVWTYEGPPHVGAMRVATGMKGLHYVLHAPQGDTYADLLFTM
FT                   IERRDHRPPVTYTTFQARDLGSDTADLFKQTLQDAYDRFQPEALIVGASCTAELIQDDP
FT                   GGMSETMGIPIPVIPLELPSYQRKENFGADETFFQIVRTLAKPMARTKQITCNLIGPTA
FT                   LGFRHRDDITELTGLLSDMGISVNVVAPMDATPTDIARIGAAHFNVLMYPETAETAARW
FT                   MERELGQPYTKTVPIGVGATRDFIAEVAQIAGVAPYLDDSRLRLPWYSRSVDSTYLTGK
FT                   RVFLFGDGTHVIAAARIARDEMGFEVVGLGCYNREMARPVRALARDFGIEALITDDYLE
FT                   VESRIEALQPEMILGTQMERHIGKRLGIPCAVISAPVHVQDFPARYSPQMGVEGANVIF
FT                   DTWVHPLVMGLEEHLLHMFRDDFEFHDAAGPSHHGGHSPKPQAAEPAPQAAPQPENTGT
FT                   SVEVVWLADAERELKKIPFFVRGKARRNTETFASERGVGEISVDTLYEAKAHYAR"
FT   gene            complement(140068..141354)
FT                   /gene="bchN"
FT                   /locus_tag="RD1_0139"
FT   CDS_pept        complement(140068..141354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchN"
FT                   /locus_tag="RD1_0139"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   N subunit"
FT                   /EC_number="1.18.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29874"
FT                   /db_xref="GOA:Q16DR9"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DR9"
FT                   /protein_id="ABG29874.1"
FT                   /translation="MTELPRLPAQGGCSNAPILKQRGQREVFCGLTGIIWLHRKMQDAF
FT                   FLVVGSRTCAHLLQSAAGVMIFAEPRFGTAILEETDLAGLADAQAELDKVVDQLLARRT
FT                   DIKQLFLVGSCPSEVIKLDLSRAAERMTEKYAPSVRVLNFSGSGIETTFTQGEDACLAS
FT                   MVPVLPKTDTRQLLLVGALPDVVEEQAVSLLEQMGIGPIKVLPAPRADTDLGIGENTVF
FT                   ALTQPFLGDTHGALERRGARHLPAPFPFGEEGTTAWLRVIADEFGVDADTFERVTAAPR
FT                   ARARKAISQASEALRGKTIFFFPDSQLEIPLARFLTRECGMEAIEVGSPFVHKGIIGSD
FT                   LEMLAQGPVISEGQDVDLQLDRCRAARPDLTVCGLGLANPLEAEGLATKWAIELVFTPV
FT                   HFYEQAGDLAGLFSRPVRRAGLLKVEAAE"
FT   gene            complement(141351..141875)
FT                   /gene="bchF"
FT                   /locus_tag="RD1_0140"
FT   CDS_pept        complement(141351..141875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchF"
FT                   /locus_tag="RD1_0140"
FT                   /product="2-vinyl bacteriochlorophyllide hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29875"
FT                   /db_xref="GOA:Q16DR8"
FT                   /db_xref="InterPro:IPR009905"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR8"
FT                   /protein_id="ABG29875.1"
FT                   /translation="MNGHASRTSAPTGLYSAEERARRDETVWTTIQGVLAPLQFAVFLV
FT                   SLVLVVRYLWNGEGYVIATWSIVLKTMLLYLIMVTGAIWEKIVFGQYLFAPAFFWEDVF
FT                   SFAVIALHTAYIWALFSDAMSTTNLMILALTAYGAYVINAIQFILKLRAARLQAAAASD
FT                   TTSDTTPEVAA"
FT   gene            142189..142971
FT                   /gene="ppa"
FT                   /locus_tag="RD1_0142"
FT   CDS_pept        142189..142971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="RD1_0142"
FT                   /product="regulatory protein Ppa"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29876"
FT                   /db_xref="GOA:Q16DR7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR7"
FT                   /protein_id="ABG29876.1"
FT                   /translation="MSTDDQTDPRGVMRNRPDSVDVLASTVISVLRDRQAVSCEGLRQF
FT                   VLDQISSRVLSKKHFAPDVVLAELRGYRLSVDAIIDLYVPAAARMLGEQWVDDKISFAD
FT                   VTIGTMRLQALLADASGASCVDHKVGAVRLNALVVIPQNEQHFLGASVVAAQLRRLGCE
FT                   VAMSYDEDHGALTARLINDVPDLVLVTCGRLETLPSVANTIQVVRKAVGNDPTLAVGGA
FT                   CQVNKQRVMEITGADIVTSVAEEAVAHCLKYVNSPSTS"
FT   gene            142968..144395
FT                   /gene="ppsR"
FT                   /locus_tag="RD1_0143"
FT   CDS_pept        142968..144395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsR"
FT                   /locus_tag="RD1_0143"
FT                   /product="transcriptional regulator PpsR"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29877"
FT                   /db_xref="GOA:Q16DR6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011785"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR6"
FT                   /protein_id="ABG29877.1"
FT                   /translation="MTTGGNTFWSSGAVPLIEPEFLSSIIAAASDIALVVSAEGIILSV
FT                   VVNSHSESFGNLKHWEDRPVSEFLTRESIPKFEKAHAAYLLGEVPKKQLELNHSDNAVW
FT                   QYPVRYTFHRFGHENAALLLGRDLRPIAETQQQLVQAQIALEQGYEARREFDARYRVLL
FT                   ANTKQAVVFVSVQSGRVEDANEAAAALLGLNADALRSSSFAQHFMDRSNVELTESLMNA
FT                   TLAEEEGQVTLTATRTQATVIAHPVVFRAGGQRVLMCRLETKESKAATPDAAADHALAM
FT                   FRAGSDAMLFMGPNGVIISVNESFLDLVGAAHLSDVVGRSFGDFLGRGQIDLAVLTEQP
FT                   QRSGHMRIYATKLVNDLGTRLAVEISATHLADADVAAIGCMIRDVSRTETARGGSGGTI
FT                   SNAAPAEPARNVMDLVGSAALKDIVAETTDVVEKMCIETAVELTNNNRVAAAEMLGLSR
FT                   QSLYVKLRKYGLLNKNG"
FT   gene            144450..145349
FT                   /gene="bchG"
FT                   /locus_tag="RD1_0144"
FT   CDS_pept        144450..145349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchG"
FT                   /locus_tag="RD1_0144"
FT                   /product="bacteriochlorophyll synthase 33 kDa chain"
FT                   /EC_number="6.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29878"
FT                   /db_xref="GOA:Q16DR5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR5"
FT                   /protein_id="ABG29878.1"
FT                   /translation="MAVTDSIHTRRFPEPAAALRLIKPITWFPPMWAYLCGVVSSGVSP
FT                   VGNWTLVLLGVVLAGPIVCGMSQAANDWCDRHVDAINEPHRPIPSGRIPGRWGLWIALA
FT                   MSVLSLGVGWQLGPWGFGATVVGVLAAWAYSAEPVRLKRSGWWGPGLVGLSYETLPWFT
FT                   GAAVLSAGAPSLPVIVIAVLYGIGAHGIMTLNDFKALEGDRQMGVNSLPVTLGPQRAAQ
FT                   VACAVMSAPQVVVVFLLFSWGKPLHAAGVCAVLFVQFWAMTIMFKDPKAKAPWYNGTGV
FT                   LLYISGMMIAAFALRGLA"
FT   gene            145349..146647
FT                   /locus_tag="RD1_0145"
FT   CDS_pept        145349..146647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0145"
FT                   /product="PucC family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29879"
FT                   /db_xref="GOA:Q16DR4"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR4"
FT                   /protein_id="ABG29879.1"
FT                   /translation="MLSWFGIMRLGLVQMSLGAIVVLTTATMNRVMVVELAMPAILPGL
FT                   LVSIYYGTQFLRPRFGHSADQGGQRTPWVIGGVALLAAGAIGAALSVGLMERIAWAGIA
FT                   TAIPSFLLIGLGIGAAGTNLLALLSTRVSAQRQAPAGSLVWIMMIFGLAVTGITAGQLL
FT                   DPYSHGRLVAVTLGVSAVALTLTCLGIWGQERGEKRVVEKRNGNFRAILRELWVDPRVR
FT                   IFTIFVFASMLAYNLQDLILEPFAGHVFGLTVGESTKLGGMHHAGALMGMIAVLLGGTV
FT                   LARWFIVPTRVWVVGGCLLSGVSLVGLAYGGLHAASWPIGANIFVLGLANGAFAVAAIG
FT                   AMMGLAREGGGGSEGVRMGLFGAAQAIAFGLGSFAGTAMVDLMRWITSQDAVAYGSVFA
FT                   IEGLVFLVAAVLALRLTSPHADARARPAMMPGE"
FT   gene            146652..147830
FT                   /gene="bchP"
FT                   /locus_tag="RD1_0146"
FT   CDS_pept        146652..147830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bchP"
FT                   /locus_tag="RD1_0146"
FT                   /product="geranylgeranyl hydrogenase"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29880"
FT                   /db_xref="GOA:Q16DR3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR3"
FT                   /protein_id="ABG29880.1"
FT                   /translation="MYDVVVIGGGPSGATAALDLVHSGHRVALLDRKGRIKPCGGAIPP
FT                   RLMQDFHIGDDQLLAKVNTARMISPTGRKVDIPIENGFVGMVDRKDFDPFLRQRAADAG
FT                   ADYFTGTFVRIERPEGTPVVIYRDKATQEERELPCKLVIGADGAKSRVGLAEVKDADKV
FT                   PLVFAYHEIIKAPPKSAIYDPERCDVIYDGAISPDFYGWVFPHGNSASVGMGTELSSVN
FT                   LKEATAALRDAAGLSDCETIRKEGAPIPLRPLDRWDNGKDVLLAGDAAGVVAPSSGEGI
FT                   YYAMVGGRVAATACAATLASGRVKDLRLARQLFMKEHKMVFRVLGSMQNAYYRSDERRE
FT                   RFVSLCHDVDVQRLTFEAYMNKKLVRARPMAHLKIGIKNLAHLTGLVATTRV"
FT   gene            147827..148357
FT                   /gene="idi"
FT                   /locus_tag="RD1_0147"
FT   CDS_pept        147827..148357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idi"
FT                   /locus_tag="RD1_0147"
FT                   /product="isopentyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29881"
FT                   /db_xref="GOA:Q16DR2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DR2"
FT                   /protein_id="ABG29881.1"
FT                   /translation="MTIMIPAWVNGTLTSVEKLEAHVKGLRHKAVSVFVLKGDAVLMQQ
FT                   RAMCKYHTPGLWTNTCCTHPEWDEAPEVCAIRRLDEELGVRGLIPQHRHHLEYRADVGG
FT                   GLIEHEVVDVFVAEADETLVVLPNPDEVMAVEWVHFDDLVDQVAQHPDRYTPWLRIYLR
FT                   DHAATIFGELALL"
FT   gene            148820..149530
FT                   /locus_tag="RD1_0148"
FT   CDS_pept        148820..149530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0148"
FT                   /product="transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29882"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR1"
FT                   /protein_id="ABG29882.1"
FT                   /translation="MHNCKRFVYLFWVFLSSGFAFEAEASTQNSAARHVCDQAAVQAAR
FT                   SSDVPLSVLKAIARTESGITVDDQFAPWPWTVNSEGRGVRFSSAEEAIEYVGLNRQRGV
FT                   SNIDIGCFQINYKWHGANFSSVQEMFNPYKNALYAANFLTSLYNEFEDWTKAAGAYHSR
FT                   NTEHSDLYLAKYIPILEQLDQTGRLSGAQKQSVTKANSFPLLIGQPADSTRGSLFPLAA
FT                   SSRGNLLVSSGRKN"
FT   gene            149533..151617
FT                   /gene="flhA"
FT                   /locus_tag="RD1_0149"
FT   CDS_pept        149533..151617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="RD1_0149"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29883"
FT                   /db_xref="GOA:Q16DR0"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DR0"
FT                   /protein_id="ABG29883.1"
FT                   /translation="MENLTVKALFNPTILLAIALMTVIVMMILPVPSWVLDAGLAASFA
FT                   LAILIFTVTLFIERPLDFSAFPTILLASLMLRLSLNVSSTKLIIGQGHTGTDAAGEVIE
FT                   GFAQFVMGGSVFLGLVVFSVLLIVNFMVITKGATRMAEVGARFALDGMPGKQLAIDSDM
FT                   AAGAITHTEAKERREREQQETTFFGSLDGASKFVKGDAIAGLLITLLNLVAGLIMGIAV
FT                   HGMPLGQAFETYAILTVGDGLVSQIPAVVISIASALLLARGGAQGATDLAVFAQLGRHP
FT                   SALATVGVLMALFAFFPGLPFVPFIVGSLALGFVAYRLHVKQKAEPQEVLALQDESETP
FT                   KEAVLGDILEIDDIHVEFSQDLVNMVLDPGTGLDARISNMRTHVATVYGLILPEIRLTD
FT                   NAGLPVGTYVLKIQGVEQARAQLNPDQVLALVPENPVNLPSGTDTNEPVYGAPARWINR
FT                   KDQESAALDGLTLVTPAEILATHLLETVKRNFSRLLTLKSLRRLLTEMTNISNPARAEA
FT                   NRKLLDEMIPDKVPIDVLHSVLRLLLDEQVSIRNLPLILEATAEARGRNSQVEAICEHV
FT                   RQRLGFQLVAEMRREDGTLPLIQLAPEWEDTFTMYQVEADRGLDIALPPDLFNKLAENV
FT                   SEKLQTANQNGINAALVTNTKRRRFLKTVMRAKGINNPVFSFEEIGLDARPSLVGVVAQ
FT                   "
FT   gene            151614..152384
FT                   /gene="fliR"
FT                   /locus_tag="RD1_0150"
FT   CDS_pept        151614..152384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="RD1_0150"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29884"
FT                   /db_xref="GOA:Q16DQ9"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ9"
FT                   /protein_id="ABG29884.1"
FT                   /translation="MIALQEFFPFLNSAIWHGFVVFCRVAALAAVLPAFGEQTLSARVK
FT                   LAAALAFTVIVAPALPIIPAPGSIGAVSFVILTEVVAGLAIGIGLRLFVLALQTAGSIA
FT                   AQSTSLSQVLGGAAVDPLPAMGYILVIAGLALAVMAGLHVKVAQLIILSYDFMPVGRFA
FT                   NAADLSEWGTSQVAHAFSLAFTLAAPFVILSVLYNFALGAINRAMPQLMVAFVGAPVIT
FT                   LGGLALLLISAPYMLTVWLGAMDRYLADPFGVLP"
FT   gene            152381..153469
FT                   /gene="flhB"
FT                   /locus_tag="RD1_0151"
FT   CDS_pept        152381..153469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="RD1_0151"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29885"
FT                   /db_xref="GOA:Q16DQ8"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ8"
FT                   /protein_id="ABG29885.1"
FT                   /translation="MSAPDEEADKSFEATPQKLLEARKKGEIARSTELLTAASYAGFLL
FT                   ALLLFGESGLLELGSTMAVIIGQSAQIAPLFFEGAGTVPARGIIQSTGSALLPIFVYPA
FT                   LAVMLVLFATRGIVFAPTKVQPKLSKISVISNAKNKFGRTGLFQFVLSFSKLIIYSAIL
FT                   AVFLYHRTNEMVAALQTTPQYTVILLAKICIEFLIYVVIVSAIIGGIDAIWQHFEHLRK
FT                   NKMSRKEVMDETKNSEGDPYMKQERRQRAQSLAGTQVAVEVAAADVVIVNPTHFAVALK
FT                   WDRTPGQAPVCVAKGVDETALRIREIATENAVPIHSDPPAARALHATTNIGDQIAPEHY
FT                   KAVAAAIRFAENMRKQSKGKVT"
FT   gene            153466..153861
FT                   /locus_tag="RD1_0153"
FT   CDS_pept        153466..153861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29886"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ7"
FT                   /protein_id="ABG29886.1"
FT                   /translation="MSKQQLQTIQQVFELKFKKKQGAFLAVLQQEQQLRAQLKKLDTQL
FT                   RNSQMDQHQNMQAIGADVIWQSWVERSKKSLNLELAQVLAQKETLLVNVKKDYGRLLVS
FT                   RELYSTLKNTERTQTQARLLAAAIKGS"
FT   gene            complement(154208..154609)
FT                   /locus_tag="RD1_0154"
FT   CDS_pept        complement(154208..154609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0154"
FT                   /product="integrase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29887"
FT                   /db_xref="GOA:Q16DQ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ6"
FT                   /protein_id="ABG29887.1"
FT                   /translation="MRCKIACRAMGSLDFVFDAFADGQRFRVLCIVDDCTREALATVVD
FT                   RSLSGARMTRELENPIRRRGQPDMIVSDNGTEMTSHAVLRCCKDTGVGWQYIARGKPMQ
FT                   NAFVESFNAMLRNERLNEHTLGNLAEEDY"
FT   gene            complement(155014..155277)
FT                   /locus_tag="RD1_0155"
FT   CDS_pept        complement(155014..155277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0155"
FT                   /product="inverted repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29888"
FT                   /db_xref="GOA:Q16DQ5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ5"
FT                   /protein_id="ABG29888.1"
FT                   /translation="MKCRFSDEQIICMINEFETGMKAQELCRKYRISDATFYRCKAKGG
FT                   GINMSGAKKLRALEDENNRLKRMLADAILDNAVLKYLATKNY"
FT   gene            complement(155374..156426)
FT                   /locus_tag="RD1_0156"
FT   CDS_pept        complement(155374..156426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29889"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ4"
FT                   /protein_id="ABG29889.1"
FT                   /translation="MLFQNANDLLFAETASLHRLSPQLENRLTKIRGLFRGAGHNPAIG
FT                   SGLSLGAGYLFQLSPEADTSFIGLGTMRSDNGSEAYGAAANLSFGNGWGFNIALARAEM
FT                   RYDLFFDATKLPIEQDGELVSGGLSYAVSRQSTIGINARYLNTTIGLRTSDTPIPDDLL
FT                   PDLELELGTLGLTYEWDLRDDGDYPTDGSLLTLAFSRGFSLADTSRSYDFASANFDVYR
FT                   TVGSEKVVAGRVSACSASSNAPFFDQCSIGFTDGFRGFTPTQFYDTRLISLQAEYRQRL
FT                   GSRFGFVAFGGVGWTGETFNALTDNGDRIAGGVGLRYRVSKQFPVDLSVDVSTNNDDEE
FT                   YLYIYVGQRF"
FT   gene            156373..156639
FT                   /locus_tag="RD1_0157"
FT   CDS_pept        156373..156639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0157"
FT                   /product="inverted repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29890"
FT                   /db_xref="GOA:Q163A3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q163A3"
FT                   /protein_id="ABG29890.1"
FT                   /translation="MKRSRFSEEQIIGILKEHQAGLGAKELCRKHGISDATFYKWRSKY
FT                   GGMEVSDARRLKTLESENTKLKKMLAEQMMDVATLKEMLGKNF"
FT   gene            156663..157487
FT                   /locus_tag="RD1_0158"
FT   CDS_pept        156663..157487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0158"
FT                   /product="integrase, catalytic domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29891"
FT                   /db_xref="GOA:Q163A4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q163A4"
FT                   /protein_id="ABG29891.1"
FT                   /translation="MNWAMKTKGYNQKRACSLAGIDPRVYRRRSKRPADTELRARMKEL
FT                   ASERRRFGYRRLHILLKREGWQVNWKKLYRLYREEGLTVRKRGGRKRAVGTRTPMAIPQ
FT                   GPNQRWSLDFMSDALEDGRRFRVLNVIDDFSRECLAAVVDTSIGGTRVARELDRIAELR
FT                   GYPCMVVSDNGTELTSNAMLKWQENRKVGWHYIAPGKPMQNGLVESFNGRMREECLNEH
FT                   LFPSLRHARRMIAAWRGDYNHYRPHSSLDGLTPWEYHQRSKEDQNLNSANLK"
FT   gene            complement(159558..159929)
FT                   /gene="flaF"
FT                   /locus_tag="RD1_0159"
FT   CDS_pept        complement(159558..159929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="RD1_0159"
FT                   /product="flagellar protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29892"
FT                   /db_xref="GOA:Q16DQ1"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ1"
FT                   /protein_id="ABG29892.1"
FT                   /translation="MNSFAQAQRAYAPTQAPIKTARSTEYEVIARISHRMKRAMQQDDF
FT                   PALAEALHENNKLWTTLAIDVGNPDNLLPDELRARIVYLADFTRQHSHKVMRKTETAVP
FT                   LLEINAAILKGLKHEVSGK"
FT   gene            complement(160000..161250)
FT                   /locus_tag="RD1_0160"
FT   CDS_pept        complement(160000..161250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29893"
FT                   /db_xref="GOA:Q16DQ0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DQ0"
FT                   /protein_id="ABG29893.1"
FT                   /translation="MSSILTNNSAMVALQTLKSINSDLGKIQSEISTGKTVESAKDNAA
FT                   TWAISKVMSSDVEGFRAISDSLSLGQSTVGVALDAAEGITDLLTEIKGKIVNSQEENVD
FT                   RGKIQTDIVALRDQISSIAGAAQFNGLNLLSNTDNTEGSGTASILSSLDRAGDGTISPS
FT                   NIDVSKQDLGTGAAEFGATAVASAGDLIAVSAASAVGPAGATPVISFTADGAAGGASYR
FT                   ITLTGAAANEWGTTAVNFEYVARDGDTEMDVSNNLLKQMNDYATANEFTNTTFTQDATT
FT                   GAITVANTGAAADTLGVAVAENLDGTAAGGLAALADIDVSDADGAAAALASIEGLIQTS
FT                   IDAAASLGSDGKRIETQNEFVGKLMDGLKSGIGSLVDADMEAASAKLQALQTQQQLGVQ
FT                   ALSIANQAPQTILSLFR"
FT   gene            complement(161459..161818)
FT                   /locus_tag="RD1_0161"
FT   CDS_pept        complement(161459..161818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29894"
FT                   /db_xref="GOA:Q16DP9"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP9"
FT                   /protein_id="ABG29894.1"
FT                   /translation="MSNVVGSDVIGALDDVLEKEREALLSGNLEAIGRLLEQKEALIEE
FT                   LSVLEEIEAKALHDLTGKMKRNQDLLDHALAGIRSVAGRLAAMRRVRSSLDTYDANGTK
FT                   RSVDMTNDTSLEKRA"
FT   gene            complement(161811..162113)
FT                   /gene="cheL"
FT                   /locus_tag="RD1_0162"
FT   CDS_pept        complement(161811..162113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheL"
FT                   /locus_tag="RD1_0162"
FT                   /product="chemotactic signal-response protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29895"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP8"
FT                   /protein_id="ABG29895.1"
FT                   /translation="MQLELVRMTELSSVAGKPSNPAARNDKALREAANKMEASFLAEML
FT                   KSAGLGKSSSEFGGGAGEDQFASFLVQEQAMMMVKAGGIGLSEALFESLKEKSNE"
FT   gene            162209..163546
FT                   /locus_tag="RD1_0163"
FT   CDS_pept        162209..163546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0163"
FT                   /product="flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29896"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP7"
FT                   /protein_id="ABG29896.1"
FT                   /translation="MLDILTTQTAPQQMGKTAQNKKIENADSKEQAFDEEYAATGDDVE
FT                   GTEQQQTDESQAADQQSADEAETKSSDDTSPDTAPEPNAQNSDVTVEEQPAFAIAQGSK
FT                   AAKTPEAESKTSPTDLSSAKRANMQESAPTMPADAAQPAQKPGVTKTAVSATSAAEAFV
FT                   TAKAAENAALSASPGMAGNAEKSAVVDPQPPRTSVLKQANTATALVSAPISGEQPSEKL
FT                   KSLKLSDELAARAVSLRSDSQAQPAPPMVSSPAQTAKLMPLTALSKIDIGKEKMALDST
FT                   SALSIEALSAAETRSASSTSTTPLNQLLARAETPTAIARQMAEALQKLPDRPVEISLNP
FT                   KELGRVRMNISAAEAGITVTIVTERPETLDLMRRNIDQLVREFQAIGYNDINFAFSEGE
FT                   TQQGFAETSDERNGAAATQLELLQAEETAESNDTTLNAQTGVDIRL"
FT   gene            163556..164236
FT                   /gene="flgD"
FT                   /locus_tag="RD1_0164"
FT   CDS_pept        163556..164236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="RD1_0164"
FT                   /product="flagellar basal-body rod modification protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29897"
FT                   /db_xref="GOA:Q16DP6"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP6"
FT                   /protein_id="ABG29897.1"
FT                   /translation="MDILNAQATQPTRQLGTAQASNSAALSSDFETFLKMLTAQARFQD
FT                   PLEPIDSSEYAAQLAQFSMVEQQVLSNDLLTELGAQLGSNSIGQMAAWIGMEARTTAPV
FT                   AFDGSPITVLPKSEAGADEAYLIAYGPDGSEVQRQQVTPGTDPIEWLGLDDNGAALPIG
FT                   NYSFVVESRAVGQTIGTSPAETYSRITEARREGSDTVFILNGGSPVSAADVSALREASL
FT                   QSST"
FT   gene            complement(164233..165567)
FT                   /locus_tag="RD1_0165"
FT   CDS_pept        complement(164233..165567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0165"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29898"
FT                   /db_xref="GOA:Q16DP5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP5"
FT                   /protein_id="ABG29898.1"
FT                   /translation="MQRILSAYAYGAGPRAGCWWDETCDLPKLNALQGDLSVDVAIIGG
FT                   GFTGLSAALHLATQGVKVTLLEAQDIGWGASGRNGGFCCLGGGIAGDDALDSRYGRDAR
FT                   LGFRNAEKAAVLFVEETINRLGLDVDRHSKGETEFACRPKDMAGLAKMAKRTHENYGVE
FT                   ATVIDQSDLAGLGMTGGPAFFGALSIPIGFGLNPRKLLAGFALAAIDAGADLFAASPVL
FT                   GVARNGHGHALKCPQGVVNAQQVIVATNGYSSEDIPIWLASRFMPVQSTVLVTRPLSNA
FT                   ELDAQGWTTEQMGYDSQNLLHYFRLMPDRRFLFGMRGAIRSGPRAEMKARQRTQADFRK
FT                   MFPAWSTVEISNMWSGMVSLARKKLPFVGEIPASNGIWTAMCYHGNGVAMGSYAGKLVA
FT                   DMVLGRATGECPEVMTKPLTKFPLGRVRRMLLPPVYGQLMLQDRF"
FT   gene            complement(165567..166385)
FT                   /gene="potI"
FT                   /locus_tag="RD1_0167"
FT   CDS_pept        complement(165567..166385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="RD1_0167"
FT                   /product="putrescine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29899"
FT                   /db_xref="GOA:Q16DP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP4"
FT                   /protein_id="ABG29899.1"
FT                   /translation="MNRLSWFNVTSLTLGFAFLYLPMLILIIFSFNESKLVTVWAGFST
FT                   KWYGELLQNEAFLDAAWVTIKVAVLSSTLATILGTMAAYVLVRGGRFLGRTLFSGMIYA
FT                   PLVMPEVITGLSLLLLFIGIGLDRGVLTIVLAHTTFSMCFVSVVVSSRLLTFDRSLEEA
FT                   ALDLGCSPFDAFRLVTLPIIAPAVISGWLLAFTLSLDDLVIASFTAGPSATTLPIKIFS
FT                   AVRLGVSPEINALSTIMIAIVTVGVVVASLVSKRNMVRQQNDERAAAAQT"
FT   gene            complement(166382..167257)
FT                   /gene="potH"
FT                   /locus_tag="RD1_0168"
FT   CDS_pept        complement(166382..167257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="RD1_0168"
FT                   /product="putrescine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29900"
FT                   /db_xref="GOA:Q16DP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP3"
FT                   /protein_id="ABG29900.1"
FT                   /translation="MQRLFLIAIPYAWLFALFLVPFGIVFKISLSDIALAIPPYTPTLK
FT                   DGFSAFIAGLDFENFAFLASDDLYWKAYLSSLQIAVLSTFMTLCVGYPIAYGMARAPAE
FT                   WRATLMMLVILPFWTSFLIRVYAWMGILSQEGFLNQFLLWTGMIGQPLTILNTNTAVYI
FT                   GIVYTYLPFMILPIYAALDRLDGSLIEAAEDLGCSRLQAFWLVTIPLSKNGIIAGSFLV
FT                   FIPALGEFVIPSLLGGSGTLMIGKVLWEEFFNNRDWPVASAVAIVLLLILIIPIVLFQR
FT                   NQQRQAEEES"
FT   gene            complement(167295..168422)
FT                   /gene="potG"
FT                   /locus_tag="RD1_0169"
FT   CDS_pept        complement(167295..168422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="RD1_0169"
FT                   /product="putrescine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29901"
FT                   /db_xref="GOA:Q16DP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP2"
FT                   /protein_id="ABG29901.1"
FT                   /translation="MNQAVFEPWSDPTQKPLIRFKSVTKQFGSFTAIDDLTLDIFEKEF
FT                   FALLGPSGCGKTTMMRMLAGFETPTSGVIELAGADIAPLPPNKRAVNMMFQSYALFPHL
FT                   SVYENIAFGLRRDKVSGDALDARVSEMLKLTRLEKFARRKPHQISGGQRQRVALARSLA
FT                   KAPKLLLLDEPLGALDAKLRQATQFELMDIQEKTGTTFVIVTHDQEEAMTVASRVAVMD
FT                   EGRIMQVETPERIYEAPNSLYVADFIGEVNIISGTARAIGDEQFHIDWAEGNAPFLATS
FT                   SRPFSEGQPCHLALRPEKVGIHAERPEAAENAVQGKILDIAYLGNLSTYHVALPGGQII
FT                   KAQTANTRRVSRRSYTWEDTVWLSWTSTAGVLLPE"
FT   gene            complement(168502..169584)
FT                   /gene="potF"
FT                   /locus_tag="RD1_0170"
FT   CDS_pept        complement(168502..169584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF"
FT                   /locus_tag="RD1_0170"
FT                   /product="putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29902"
FT                   /db_xref="GOA:Q16DP1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP1"
FT                   /protein_id="ABG29902.1"
FT                   /translation="MNKLMITSAVVALCATTVLADEVRVYNWSDYIDESLLEKFEEETG
FT                   INLIYDVFDSNEVLETKMLAGGSGYDVVVPTGTFLQRQISAGAFQKLDQSKLPNLENMW
FT                   DVVKARTEQYDPGNAYSINYMWGTTGIGANINKVQEILGADAPVASLSLIFDPASMEKL
FT                   SECGVHFLDAPTEMIPAALKYIGEDPDSHDPDVIAKAEAVLAAIRPYVQKFHSSEYINA
FT                   LANGDICVAFGWSGDILQSRDRAAEADNGVEIVYNAPTEGALMWFDQMAIPTDAPNPEG
FT                   AHAFLNFIMDAENIAAASNYVYYANGNAASKPFLVDDVINDTAVYPDEATLENLFTVTP
FT                   YPAKVQRVVTRMWTRVKSGT"
FT   gene            169773..170432
FT                   /locus_tag="RD1_0171"
FT   CDS_pept        169773..170432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0171"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29903"
FT                   /db_xref="GOA:Q16DP0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DP0"
FT                   /protein_id="ABG29903.1"
FT                   /translation="MEYVKLPAHQSVYEDIRDQILFGDMAPGQPVTIQGLADTLKAGMT
FT                   PVREAIRRLTSDGALNMTGNRRVSVPVITHTCLEELEFMRKTLEPELAFRAVSKITDAA
FT                   KEMLHAHDDALNSAISQGDIKGYLTHNYHFHAILYQAAQAPIMTATVDRLWLRFGPSLR
FT                   VVCGRHGTMNLPDKHADLLAALDSKDARCVREAMAEDVHQGIIQIREALDATMKPD"
FT   gene            170510..171907
FT                   /locus_tag="RD1_0172"
FT   CDS_pept        170510..171907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0172"
FT                   /product="aminotransferase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29904"
FT                   /db_xref="GOA:Q16DN9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN9"
FT                   /protein_id="ABG29904.1"
FT                   /translation="MSAISNHMPTAELQALDAAHHMHPFTSNEVLATKGARVITRADGV
FT                   YLTDSDGNRILDGMAGLWCVNIGYGRPELAEVAARQMKELPYYNTFFMTTHVPAIALAQ
FT                   EVTKLAPAGMNNIFFASSGSEANDTNIRLVRTYWAQKGKPQKSHIISRKNAYHGSSVGS
FT                   GSLGGMTYMHEQGGMPIAGIHHINQPDWWSEGGDMTPEEFGVARAKELEAKINELGEDN
FT                   VAAFIAEPVQGAGGVIVPPETYWPEIQRICDEYEILLIADEVICGFGRLGAWFGSEVMG
FT                   IKPHIMTVAKGLSSGYQPIGGSIVCDEVAEVIGQTEFNHGYTYSGHPVAAAVALENLRI
FT                   LQEENIVEHVRTVAAPALKAGLETLADHPLVGDVSCKGLMASLALTPHKESRAKFASER
FT                   GTIGTICRERAFANNLVMRHVGDRMVVSPPLIIQQNDIDTLVERAGKALDEAYSEIKSE
FT                   GLLKAAS"
FT   gene            172145..173260
FT                   /locus_tag="RD1_0173"
FT   CDS_pept        172145..173260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0173"
FT                   /product="polyamine ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29905"
FT                   /db_xref="GOA:Q16DN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN8"
FT                   /protein_id="ABG29905.1"
FT                   /translation="MGSQTLAEKSSNDSFVEFDRVQKSYDGENLVVKDLNLFMPKGEFL
FT                   TMLGPSGSGKTTCLMMLAGFETATHGDIRLDGVSINNIPPHKRGIGMVFQNYALFPHMT
FT                   VAENLSFPLEVRKMGKSDREAKVKRALDMVQMGDFAGRRPAQLSGGQQQRIALARALVF
FT                   EPELVLMDEPLGALDKQLRETLQFEITNLAHALGITVVYVTHDQTEALTMSDRVAVFDD
FT                   GRIQQLAPPDKLYEEPENSFVAQFIGENNTLEGVVKEIKGDHCLIQLDDGGLIDAKPIN
FT                   VSAVGERTRVSIRPERVEYNKDRLSPDAHTLHAEVLEFIYMGDIFRTRLRVAGIDEFVI
FT                   KTRNAPDVDRLKPGQSIEIGWLPEDCRALDA"
FT   gene            173380..174486
FT                   /locus_tag="RD1_0175"
FT   CDS_pept        173380..174486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0175"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29906"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN7"
FT                   /protein_id="ABG29906.1"
FT                   /translation="MKLTKLLLASTALTLAAGSAFAEVEMANEMTIVSWGGAYSNSQQQ
FT                   AYHNPYMEKTGVTIINDESSAEAVSKLRAMNEAGNITWDVVDVVAADALRLCDEGLAME
FT                   IDADEMLAPAPDGTPASEDFGDLLVGDCFIPQIVYSTTVGYRTDMVGDTPPTSICALFD
FT                   TEGYPGKRALEKRPINNMEWALLCDGVAKDDVYDVLETDEGQQQALDKLATIKDDVIWW
FT                   SAGADTPQLLADGEIVMGSTYNGRLFSVIEEQKQPVGMLWDAQVFDLDGWIIPAGLPED
FT                   RLARALDYVYFATDTQRLADQSKWISYGPARASSAPLVSTHAELGIEMAPHMPTDPENA
FT                   KNTFLYNYEFWADYRDDIDAKFQAWLAQ"
FT   gene            174559..174846
FT                   /locus_tag="RD1_0178"
FT   CDS_pept        174559..174846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29907"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN6"
FT                   /protein_id="ABG29907.1"
FT                   /translation="MPKGYIIGNISLRDADAYKPYSLRNDEIVPRHGGKFLARGGRSQI
FT                   LEGDSHDRQVIIEFPSYEDALAFYNDPDYQENMKIRQANADGSILVVEGV"
FT   gene            174850..176490
FT                   /locus_tag="RD1_0179"
FT   CDS_pept        174850..176490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0179"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29908"
FT                   /db_xref="GOA:Q16DN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN5"
FT                   /protein_id="ABG29908.1"
FT                   /translation="MTDTAEHSGPMLAADGRPLKASLNRALRRQKMRALLLIAPLLLFV
FT                   LVTFIAPIADMLFRSVENQIVSDTLPRTTTELATWDADSGEIPSQETFNALFKDVFIAA
FT                   ERKAHTRLGSRLNYELTGVSSLFRKSGRSVDDMAEVYQDQFEDLNDFWKEGENWSQLMG
FT                   SASWLTAMNGWNEDSGQAQPVFEVRDDIAAALPETTAIYEEFATFVQIEEEERLTTEDP
FT                   WAVVYAALYEDMAGGADLSGISGAGSAELLAAAEAAATFETVDYTAAFYEVDEDWHDID
FT                   VWQTIQTYTPDFTSGYFLNAVDMKKSPDGPEMRPENEQLHIMLFMRTLFMSLVITGSCI
FT                   LLGYPVAWILANLPARTANLLMILVLLPFWTSLLVRTSAWKVMLQQQGVVNDTLVWLGI
FT                   VADDSRLALINNQTGTIIAMTHILLPFMILPLYSVMKTIPPSYLRAAKSLGATNWTAFW
FT                   RVYFPQSVPGIGAGSILVFILSIGYYITPEIVGGTTGTFISNRIAYHISSSLNWGLAAA
FT                   LGAILLAVVLALYWAYDRIVGIDNVKLGG"
FT   gene            176830..177672
FT                   /locus_tag="RD1_0180"
FT   CDS_pept        176830..177672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0180"
FT                   /product="ABC transporter permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29909"
FT                   /db_xref="GOA:Q16DN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN4"
FT                   /protein_id="ABG29909.1"
FT                   /translation="MPYLTPGQVLWHYTFRVICGAILVFLITPILVVMPLSFNAENFFT
FT                   FTPEMLRFDPAGYSLKHYEDFFTNSDWQGALANSIKIAPAATLLSVTFGTLAAIGLSQP
FT                   HVPFRRAIMAILISPMIVPLIISAAGMYFFYSRIGLQGTYMGVVLAHAALGIPFVIITV
FT                   TATLVGFDNSLTRAAANMGANPVTTFFRVQMPLILPGVISGGLFAFITSFDEVVVVLFV
FT                   GSAGQKTLPWQMFTGLREQISPTILAVATILVLVSIALLTVVELLRRRSERLRGMSPT"
FT   gene            complement(177764..179119)
FT                   /locus_tag="RD1_0181"
FT   CDS_pept        complement(177764..179119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0181"
FT                   /product="transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29910"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN3"
FT                   /protein_id="ABG29910.1"
FT                   /translation="MKRMIFWSGMLGLVLGVNGAYAQTSGQSLRPVVRPAVAPPVNLVD
FT                   VAASGTAIERAIRPKLRTDAIKGEAEMALALATSAAEFDAWVAGFKDRAARQGIRSATL
FT                   ESAFQGVRFDSDVIRRDRNQSEFTKTIWQYLASAASDRRIANGKAALAKHRTTLEAIER
FT                   RYGVEKEVVVAVWGLESGYGAYRGSNDVIRSLATLAYEGRRGAFFEEQLIAALKILQNG
FT                   DTAPRNMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRDIWSEDPTDALASTAAYLKNA
FT                   GWKTGQPWGVEVQLPQGFDYAQANRITRKTPGAWARLGVRDMSGRKVANHGRAAILLPA
FT                   GAEGAAFMIFDNFAAIERYNAADAYVIGVGHLSDRIKGGGPIRSSWPTDERALTFAERK
FT                   EIQQRLTHAGFNTQGVDGRIGPKTTDAIRAFQRNRGLVADGYASSALLQKLR"
FT   gene            179316..180008
FT                   /locus_tag="RD1_0182"
FT   CDS_pept        179316..180008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29911"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN2"
FT                   /protein_id="ABG29911.1"
FT                   /translation="MIKLLTFPPAFGLFAASPFCVKAAYLLNMSGQKWEREDMLDPRKM
FT                   PYGKLPAIRAGERLIADSDRIQTYLESEGADFNKGLSDLDKANARAFIRMSEEHLYFHL
FT                   VLDRWADDAIWPKVRDVYFSQVPPGLRHVIAAGVRRKTLSGLHSQGLGRLSQEERLARI
FT                   EPDIDAITMRLRHSHFLFGDQPTAADASVAPMLAAATASPGVTLMGRMIEGNEVLMAYI
FT                   ARVDESCG"
FT   gene            complement(180005..182260)
FT                   /gene="rnr"
FT                   /locus_tag="RD1_0183"
FT   CDS_pept        complement(180005..182260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="RD1_0183"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29912"
FT                   /db_xref="GOA:Q16DN1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN1"
FT                   /protein_id="ABG29912.1"
FT                   /translation="MSSLPTKNDILEWIEQNPTLTAKRDIAKAFGIKGAARIDLKRVLK
FT                   ELEADGHLEKRNRSYQDPERLPPVSVLLVTGPDDDGDLYAKPMEWHGTGQEPVVLLIPR
FT                   ASDPAMGAGDRILARLTLVKNDTHHYEARLIRRIGTNPRRVVGVFRQTAEGGRIQPIDK
FT                   GSDKEWQVASGATHGAKDGELVEAEQAGPKARLGLPRARVVERLGDPSAPKAVSLIAIH
FT                   QHGIPDSFPDDVIAAADAAKPVGPEGRKDLRDLPLITIDPSDARDHDDACFARADHDPK
FT                   NEGGHVVWVAIADVAAYVTPGSALDREARKRGNSTYFPDRVVPMLPDRLSGDLCSLHEG
FT                   VPRACIAVEMVLDADGNKLRHRFYRALMQSPASLHYEEVQAAIDGTANDRTQPLLELVL
FT                   KPLYAAYAALVSARARRQPLELDLPERRIELAEDGTVTSVSFKERLDAHRLIEEFMVLA
FT                   NVAAAETLIEKKSPLLFRVHEEPSPEKLDALRETARASGYNLAKGQVLKTAHLNRLLNE
FT                   AAGTEEAELINISTLRSMTQAYYGPINLGHFGLALPRYAHFTSPIRRYADLIVHRALIS
FT                   AHGWGKDGLRPEDADGLDDTGTHISDTERRSMVAERDTTDRYLASYLSERVGSEFTGRV
FT                   SGIARFGIFVKLDETGADGLVPMRSIGNEYFHFDAETMTLMGADSGQIIGLGQRATVRL
FT                   AEAAPITGGIALELLELEGAKLARGRRSPAGRTPRKRGVKAKRKADKIKRKVKRSRR"
FT   gene            complement(182266..182865)
FT                   /locus_tag="RD1_0184"
FT   CDS_pept        complement(182266..182865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29913"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DN0"
FT                   /protein_id="ABG29913.1"
FT                   /translation="MRRTLAIMLKEPRPGRVKTRLGHEIGMTNAAWWFRHQATALIRRL
FT                   QDPRWDVVLMVSPDGEGLKSRVWPRGLRRIPQGHGDLGIRMKRALRGQIPGPVCVIGAD
FT                   IPGIERRHIARAFKALGHADAVLGPAYDGGYWLIGLKNARPARRQLFQSVRWSTEFALA
FT                   DTVRSLGDFSVAYVDKLQDVDTTADLRMTARGQRAT"
FT   gene            complement(182862..184007)
FT                   /gene="dapE"
FT                   /locus_tag="RD1_0185"
FT   CDS_pept        complement(182862..184007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="RD1_0185"
FT                   /product="putative succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29914"
FT                   /db_xref="GOA:Q16DM9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DM9"
FT                   /protein_id="ABG29914.1"
FT                   /translation="MPAVDPVRLTADLVRCASVTPADEGALDILHDVLSDAGFDCAWAD
FT                   RGGIRNLFARWGRKGHPKTFGFNGHTDVVPIGNADDWSMPPFGAEVKDGIMYGRGTTDM
FT                   KSGVAAFAAAAVDFVRDTPPDGAIVLAITGDEEGDATDGTTALLAYMAAQGEQMSACLV
FT                   GEPTCPDRMGEMIKIGRRGSMTAWITFIGKQGHAAYPHRACNPLPALMRLMDRLASHKL
FT                   DEGTEFFDPSTLAIVTVDTGNPATNVIPASCSGTVNIRFNDAHSGASLTEWIKTELSRI
FT                   EGEFGVQIDLRIKISGESFLTPPGPLSALVSKAVKAQTGIEPVLSTTGGTSDARFVKDH
FT                   CPVVEFGLVGQSMHQVDEHVKTDHIVELKAIYSRILTDYFA"
FT   gene            complement(184075..184428)
FT                   /locus_tag="RD1_0186"
FT   CDS_pept        complement(184075..184428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29915"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM8"
FT                   /protein_id="ABG29915.1"
FT                   /translation="MTKEKKPSRQQVYTLVVQIGRKEGDGLPKKATGAALVIYASGIDE
FT                   AEAVRETVAILKQADTAPLDVTGYGTLQERLAEGHEISDEERMLMQRALDENAVIVAQM
FT                   EPFYGTFQSEEAQ"
FT   gene            complement(184438..185316)
FT                   /locus_tag="RD1_0187"
FT   CDS_pept        complement(184438..185316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29916"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM7"
FT                   /protein_id="ABG29916.1"
FT                   /translation="MLQVLSDLQSAAVAGCSELALQLSPRLREDLKRVVFDQECKMTAA
FT                   DVEALHAELMMVASMPNQNHPAFMTATIILLADRLNYGAGEDDLFWNWSAFRDRFREAP
FT                   SPVRAALMNGFRRADMLGLVALDQRPKGTDLRTYEETDLTRLLKIIARSMTEDMRDAVC
FT                   TLAPEELRDVHRKALDNCLKSSCILSEFGGWFPSEVVEQVSLDPVHPSYAAATALMILD
FT                   AIATRDASGKMAARYEEQADDYILLPTDVRVPLMAGLRHLHEMEEDWEPYADWPVEQRL
FT                   DKAIVMPFAKP"
FT   gene            185318..185413
FT                   /locus_tag="RD1_0188"
FT   CDS_pept        185318..185413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29917"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM6"
FT                   /protein_id="ABG29917.1"
FT                   /translation="MKFFGAAIFLMASDYTAIRAGLYRNLDNTLE"
FT   gene            complement(185454..186281)
FT                   /gene="dapD"
FT                   /locus_tag="RD1_0189"
FT   CDS_pept        complement(185454..186281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="RD1_0189"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29918"
FT                   /db_xref="GOA:Q16DM5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DM5"
FT                   /protein_id="ABG29918.1"
FT                   /translation="MSNAELETAIEAAWEARDSISPATKGAERDAIEATLAALDGGGLR
FT                   VAERQADGNWHVNQWAKKAVLLGFRIKDMEMQSGGAQGGGWWDKVDSKFAGWGEADWKD
FT                   AGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLS
FT                   GGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRE
FT                   TGEFTYGEVPAGSVVVAGSMPSKNGVNLYCAVIVKKVDAQTRSKTSINELLRD"
FT   gene            186453..187289
FT                   /locus_tag="RD1_0190"
FT   CDS_pept        186453..187289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29919"
FT                   /db_xref="GOA:Q16DM4"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM4"
FT                   /protein_id="ABG29919.1"
FT                   /translation="MNRRHPLRHASADRKAIREVPDTPQTRAPEYRLAFADDDFLCREE
FT                   LRPVRLQLELLKPQMHLDALGINSTIVLFGGARIPSPSNKDSAATRTLADLSHFYDEAR
FT                   EFARLMTLKSMEAEGKENVIVTGGGPGVMEAGNRGALDAGGRSIGLNIVLPHEQAPNSY
FT                   VTPELCFNFHYFAIRKMHFLMRASAICVFPGGFGTLDELFEALTLIQTGRMQPVPVLLF
FT                   GRKFWDSIINWDALADAGTISAEDLELFSFVESAAEAMEIIDRWQDMPTREAMPGR"
FT   gene            complement(187382..188122)
FT                   /locus_tag="RD1_0191"
FT   CDS_pept        complement(187382..188122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0191"
FT                   /product="protein-disulfide isomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29920"
FT                   /db_xref="GOA:Q16DM3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM3"
FT                   /protein_id="ABG29920.1"
FT                   /translation="MRRRDLLVGGGIVAVAVAIPPILRRIPTDFEFEPLPGFAGFRRIT
FT                   GGSVSAASNPFLGLEPPDPSTPAPQRAGSPCVALFGPEGWQTGVVPIAIFSDFNCPYCK
FT                   VLENRLMERRDAGAPVRLIWHEMPLLGAASRRSAQAVLAARFFDAEEAARAYLSQRFLR
FT                   PGPVALRAMAHELGLPPDAFAQEVSGPRVAQALATSLDLGRRLGIPGTPGTVIGRTLVI
FT                   GATNDADLTKLIEIESAQPQMVCA"
FT   gene            complement(188122..189306)
FT                   /locus_tag="RD1_0192"
FT   CDS_pept        complement(188122..189306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29921"
FT                   /db_xref="GOA:Q16DM2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DM2"
FT                   /protein_id="ABG29921.1"
FT                   /translation="MPANAPITQDVHTIPRKLPDGPVNLVGLTRAAMRDALIAEGTPEK
FT                   QAKMRVGQIWQWIYQWGVRDFDLMTNLSKAYRAQLKEKFVVEVPEVVTRQVSEDGTRKY
FT                   LVRIAGGHEVEVVYIPDEGRGTLCVSSQVGCTLTCSFCHTGTQKLVRNLTAAEIIGQVM
FT                   VARDDLGEWPEIGAPKDETRLLSNIVLMGMGEPLYNFENVRDAMKIAMDPEGIQLSRRR
FT                   ITLSTSGVVPEIARTAVEIGCQLAVSFHATTDDVRDTLVPINKRWNIEVLLEALRAYPK
FT                   VSNSERITFEYVMLHGVNDSDEDARRLVKLIDGIPAKINLIPFNEWPGAPYKRSSNNRI
FT                   RAFADIIYKAGYASPIRTPRGEDIMAACGQLKSATERARKSRKQIAAETGLAGA"
FT   gene            complement(189417..189947)
FT                   /locus_tag="RD1_0193"
FT   CDS_pept        complement(189417..189947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29922"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM1"
FT                   /protein_id="ABG29922.1"
FT                   /translation="MRISKSFLGLVGALSLVGSLAAAQEVSNNRVAAKTDWSVFVEDNP
FT                   KECWSVSVPTETVNTRDGRVVAANRGEILLMVFFRPSANANGQVAFTGGYPFRDGSQVS
FT                   VEIGGTEYSLFTDGDWAWPATAADDAKLVAAMKRGADAVVTGISSRGTTTKDTFSLLGF
FT                   TAATEDAEKRCAG"
FT   gene            190121..191101
FT                   /gene="ansA"
FT                   /locus_tag="RD1_0194"
FT   CDS_pept        190121..191101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="RD1_0194"
FT                   /product="L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29923"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DM0"
FT                   /protein_id="ABG29923.1"
FT                   /translation="MSQPVPMVEIWRGPFLESMHTGHAVICDAAGGIIEAWGNPDQVVL
FT                   SRSSSKMIQALPLIDSGAADAMGLTPQHLALACASHGGAPMHTQRVQAWLETLDLTDDA
FT                   LRCGAHMPYDPVTHDQMLIAGEKPCQRHNNCSGKHAGFLTLSKHLGGDSGYIDTDHPVQ
FT                   KAVLEAFERLTSETSPGFGIDGCSAPNFASSLHGMARAMARFAASPEDSAEARLHQAMR
FT                   LHPELVAGENRACTDLMRATDGKVAIKTGAEGFFNVIIPEQKIGIALKITDGTTRASEC
FT                   AIAAILVKLGVLAPDHPATMKYVNAPILNRRGVTTGHMRAAPALL"
FT   gene            complement(191109..191984)
FT                   /gene="serB"
FT                   /locus_tag="RD1_0195"
FT   CDS_pept        complement(191109..191984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="RD1_0195"
FT                   /product="phosphoserine phosphatase, putative"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29924"
FT                   /db_xref="GOA:Q16DL9"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL9"
FT                   /protein_id="ABG29924.1"
FT                   /translation="MFSITLIAKPGTLAPALADSLRNAWGGGDVVWLSPGGAAEFQVAQ
FT                   KPENLWEVWAEMQGLGVDLVAQPAAGRRKKMLLADMDSTMIEQECIDELADEAGVGEHV
FT                   KGITARAMNGELDFDAALRERVGLLKGLPVATIEHVLSSRITLMPGGPVLLATMKANGA
FT                   HAALVSGGFTAFTQAIASKLGFDENRANTLLAKDGILTGEVGTPILGQQAKVDALHDIT
FT                   QRLSLAPTDVLAVGDGANDLGMLKAAGTGVALHAKPSVAAQCDIRINHGDLTALLYLQG
FT                   YAEQDFVHPA"
FT   gene            192308..193471
FT                   /gene="serC"
FT                   /locus_tag="RD1_0196"
FT   CDS_pept        192308..193471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="RD1_0196"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29925"
FT                   /db_xref="GOA:Q16DL8"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL8"
FT                   /protein_id="ABG29925.1"
FT                   /translation="MAIQQPATRPAPKPVAVPANPRFSSGPCAKPPTFDLKKLADAPLG
FT                   RSHRASEGKAKLLKAIETTREVLGVPDDYRIGIVPASDTGAYEMAMWSLLGERHAEMVA
FT                   WESFGAGWVTDVVKQLKIAHTVHTADYGDIVDMAALNYDHDVCFTWNGTTSGVRMPSGD
FT                   AIPADRAGLTLCDATSAAFAMDLPWDKLDVTTFSWQKVLGGEAAHGMLILSPRAVERLE
FT                   SYTPPWPLPKIFRLTKGGKLIEGIFTGATINTPSMLCVEDYLQALDWAKSVGGLQGLIA
FT                   RADANAGAIADFVAAHDWIDFLAKDPATRSNTSVCLRFTDARITDGAAFAKAVAKRLAD
FT                   ENVALDIGAYREAPAGLRIWCGGTVETSDITAMLPWLAWAFEAEINA"
FT   gene            193514..195109
FT                   /gene="serA"
FT                   /locus_tag="RD1_0197"
FT   CDS_pept        193514..195109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="RD1_0197"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29926"
FT                   /db_xref="GOA:Q16DL7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL7"
FT                   /protein_id="ABG29926.1"
FT                   /translation="MAPKVLISDKLSPAAVQIFKDRGIDVDFQPDVGKDKDKLAEIIGD
FT                   YDGLAIRSATKATAKIIAAATNLKVIGRAGIGTDNIDKDAASKKGIIVMNTPFGNMITT
FT                   AEHAIAMMFAVARQIPEASASTHAGKWEKSKFMGVELTGKTLGVIGAGNIGGIVCDRAK
FT                   GLKMKVVAYDPFLGEEKAKKMGVEKVELDALLARADFITLHVPFTDQTANILSAEAIAK
FT                   MRPGVRIINCARGGLVDEEALAAALKSGHVAGAAFDVFSQEPATENPLFNLPNVVCTPH
FT                   LGAATSEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAEEAKVMGPWLKLSGHLGAF
FT                   IGQMTDEPIKAINILYDGSVAEMNLSALNCGVIAGIMKKANPDVNMVSAPVIAQERGIT
FT                   ISTTNQSKSGVFDGYIKVTVVTDKRERSIAGTVFSDGKPRFIQIKGIQIDAEVGAHMLY
FT                   TTNEDVPGIIGTLGQTMGENGVNIANFTLGRAEAKGEAIALLYVDDQVPAPVIKKLEKT
FT                   GMFTQVKPLIFDVA"
FT   gene            complement(195174..196205)
FT                   /gene="tdh"
FT                   /locus_tag="RD1_0198"
FT   CDS_pept        complement(195174..196205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="RD1_0198"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29927"
FT                   /db_xref="GOA:Q16DL6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL6"
FT                   /protein_id="ABG29927.1"
FT                   /translation="MKALAKLHAREGIWMTQAPVPEIGPDDVLIKINKTGICGTDIHIW
FT                   NWDEWAAGTVPVPMITGHEFAGEIVEVGRNVTDLSIGQRCSGEGHLIGKTSRQSRAGKF
FT                   HLDPATRGIGVNEQGAFAQFLKLPAFNVVPLPDDISDDIGAILDPLGNAVHTALSFDLI
FT                   GEDVLVTGAGPIGIMAAAVARHAGARHVVITDVNADRLALASRVADVVPVNVAQDDLKQ
FT                   TIADLGMKQGFDVGLEMSGNQQALDQMVDAMTMGGRIAMLGIPPGKSPVDWSQIVFKAI
FT                   TIKGVYGREIFETWYKMIAMLQNGLDVSQVITHRFAADEYEAGFAAMKSGKSGKVVLDW
FT                   TTA"
FT   gene            complement(196214..197401)
FT                   /gene="kbl"
FT                   /locus_tag="RD1_0199"
FT   CDS_pept        complement(196214..197401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="RD1_0199"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29928"
FT                   /db_xref="GOA:Q16DL5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL5"
FT                   /protein_id="ABG29928.1"
FT                   /translation="MTQAYLTHISATLDQIANDGMMKKERAITSPQAGNIDVGPKSVIN
FT                   LCANNYLGLADHPELISAARCAMEPRGFGMASVRFICGTQDLHRQLEARLAQFLQMDDA
FT                   ILFAACFDANGGLFEPLLGPEDAVISDALNHASIIDGIRLCKARRYRYANSDMRDLEGQ
FT                   LQLARDEGARFIMIATDGVFSMDGYLAKLSDIKALADKYDALLMVDDCHATGFMGPQGR
FT                   GTPAHAGVSADILTGTLGKALGGAIGGYIAGPQPIVDLLRQRARPYLFSNSLPPSIVAA
FT                   GLKALDLVEAGDDLRAQLFENTAYWRNGLEALNFDLLPGAHPIVPIMLGEAQLAQDMAA
FT                   QLFDEGVFVSGFFYPVVPRGQARIRTQMNAALSKDDLDKALEAFAVVGRRLGVIK"
FT   gene            complement(197496..198059)
FT                   /locus_tag="RD1_0200"
FT   CDS_pept        complement(197496..198059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0200"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29929"
FT                   /db_xref="GOA:Q16DL4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL4"
FT                   /protein_id="ABG29929.1"
FT                   /translation="MADDRDDILGQLPARLKDARRVQGLSLDAVAKLSGVSRSMVSQIE
FT                   RGESSPTISTLWNLTRALQVDFAGLLDVASTQSKIETLRSADVPTIENLGKGLRIRILS
FT                   PPEEAGNHEVYELVFSLDGVLDSQPHTRGAREHLTVIEGVVDVTSADNTSRLEAGDTAR
FT                   YSADVPHQIRAIGAARAFLVVQNA"
FT   gene            198181..199359
FT                   /gene="bktB"
FT                   /locus_tag="RD1_0201"
FT   CDS_pept        198181..199359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bktB"
FT                   /locus_tag="RD1_0201"
FT                   /product="beta-ketothiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29930"
FT                   /db_xref="GOA:Q16DL3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL3"
FT                   /protein_id="ABG29930.1"
FT                   /translation="MTKEIVILDGARTAIGTFGGALAATSPIDLATVASKAALERSGVE
FT                   GAQIGHVAFGHVINTEPKDMYLSRVAAMQAGVPETVPAMNVNRLCGSGAQAIVSVIQSL
FT                   MLGDADFALAGGAENMSRSPFIIPQQRWGAKMGDVKTLDMMLGALNCPFGTGHMGVTAE
FT                   NVAAEHDITRAQQDAFALQSQQRAADAIAAGYFKSQITPVEVRVKRDMVAFEVDEHPKA
FT                   TTLEALSGLRAVFQKDGSVTAGNASGINDGAAAIVLATGDAAQKAGLKPKARVLGYAHA
FT                   GVRPEVMGIGPVPAVQNLLARTGLSVADFDVVESNEAFAAQALAVSQELGLGAAKVNPN
FT                   GGAIALGHPVGATGAIITLKAMYELERIGGKRALITMCIGGGQGIALAIERL"
FT   gene            complement(199369..200916)
FT                   /gene="ubiB"
FT                   /locus_tag="RD1_0202"
FT   CDS_pept        complement(199369..200916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="RD1_0202"
FT                   /product="ubiquinone biosynthesis protein UbiB"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29931"
FT                   /db_xref="GOA:Q16DL2"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DL2"
FT                   /protein_id="ABG29931.1"
FT                   /translation="MRGPHNIWRLIRTGATLERTGAMKVVLDAFEAPRAVRFVARALGI
FT                   PFKFLGYYGDPSMPPATRALTALGPAYIKFGQILSTRPDVVGDELAVQLRVLQDKLPPF
FT                   SVAVAKAEVSKELGVPVDQVFSEFSEPVAAASIAQVHRARIASTGEDVAVKVLRPGIER
FT                   AFNKDVDAFYLAARMVELFAPGARRLRPMDVIEHFDGVVQGELDLRLESSAASEFAATT
FT                   KDDEGFQLPEIKWDLSARRVMTLGWAAGVPLGDNDAIDAAGHNRVELGNRVLQLFLNHA
FT                   LRDGYFHGDMHQGNLKVAPNGDIVAYDFGIMGHIDEYTRRVYAEILFGFIRRDYKRVAE
FT                   VHFEAGYVPADKDVDEFARALRAVGEPIFGMDASKISMGRLLNYLFEVTERFGMETRTE
FT                   LILLQRTMVVVEGVARSLNPQINIWEVASPVVSNYISQSIGPRATLKDLAKTARVLARF
FT                   GPRLPVMVENALIRTSNPQPVRRENSWGKWIVGGLILGVTIGVSGSLTLIAVDLMFF"
FT   gene            complement(200917..201669)
FT                   /gene="ubiE"
FT                   /locus_tag="RD1_0203"
FT   CDS_pept        complement(200917..201669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="RD1_0203"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29932"
FT                   /db_xref="GOA:Q16DL1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DL1"
FT                   /protein_id="ABG29932.1"
FT                   /translation="MTDDSNKTTHFGFETVPEGEKAGRVQGVFSSVASKYDIMNDVMSV
FT                   GIHRLWKEAMMDWLAPRAGQKLLDVAGGTGDISFRFLKRAGYGHATVLDLTESMLVEGR
FT                   KRAEAAAMADQLDWVTGDAMALPFADNTFDVYTISFGIRNVTRPQEALNEAFRVLRPGG
FT                   RLMVLEFSQLPNPAMQKAYDLYSFNVIPRMGQAIAGDRDSYQYLVESIRKFPDQDTFLK
FT                   MVRDAGFENAKFRNLSMGIACLHSGWKL"
FT   gene            201887..202738
FT                   /gene="mutM"
FT                   /locus_tag="RD1_0204"
FT   CDS_pept        201887..202738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="RD1_0204"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29933"
FT                   /db_xref="GOA:Q16DL0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DL0"
FT                   /protein_id="ABG29933.1"
FT                   /translation="MPELPEVETVRRGLTPAMEGVVIARADVNRPDLRWPFPADMAARL
FT                   TGKRVERLRRRSKYILMDLDSGETLLVHLGMSGRMLVSGDPLGQFVHSHPAPEKHDHVV
FT                   FHMANNARITFNDPRRFGAMDLMETASADTHKLLSVLGPEPLGNDFHESHLIEAFKNRN
FT                   SPVKSVLLDQRIVSGLGNIYVCEALFRAKIHPIRKAGKISGARVATLVPIIREVLAEAI
FT                   EAGGSSLRDFKQADGELGYFQHSFDVYGREGAPCKGEGCTGQIKRIVQSGRSSFYCAQC
FT                   QR"
FT   gene            202803..203579
FT                   /locus_tag="RD1_0205"
FT   CDS_pept        202803..203579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0205"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29934"
FT                   /db_xref="GOA:Q16DK9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK9"
FT                   /protein_id="ABG29934.1"
FT                   /translation="MAYETIIVDVEDHVAQITLNRPDALNALNDELMSELANALTAAQN
FT                   NDKVRCIILTGSEKAFAAGADISMMKDKSFVEVFSGDLFTAETEEIMRVRKPIIAAVSG
FT                   YALGGGCELAMMCDFIICSETAKFGQPEINLGVVAGLGGTQRLTRLVGKSKAMDMNLTG
FT                   RFMDAEEAERSGLVSRVVPCKKLMDEAHGAAQRIAEKSMVSVMVVKEAVNRAYETTLRE
FT                   GLLFERRMFHSLFATEDQKEGMSAFVEKREAQFRDR"
FT   gene            203608..204015
FT                   /locus_tag="RD1_0206"
FT   CDS_pept        203608..204015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29935"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK8"
FT                   /protein_id="ABG29935.1"
FT                   /translation="MAHPIKHAMAATLLALGGAAQAEMLPGSEWEPTKMQAQPFESARD
FT                   VFIRFEQDGRYFGNGGCNSIRGRFVTNGDAILLGPAAATMMACPEEIMQQEFGFLQTLD
FT                   SVRQFDRSGTELTLSDAAARVVMRLRQRDWD"
FT   gene            204187..204450
FT                   /gene="rpsT"
FT                   /locus_tag="RD1_0207"
FT   CDS_pept        204187..204450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="RD1_0207"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29936"
FT                   /db_xref="GOA:Q16DK7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DK7"
FT                   /protein_id="ABG29936.1"
FT                   /translation="MANSPQAKKRARQNEARFQINKARRSRIRTFLRRVEEAIASGDKE
FT                   AATAALRAAQPELMRGVTKGVFHKNTAARKMSRLAARVKVLG"
FT   gene            204958..206322
FT                   /gene="dnaA"
FT                   /locus_tag="RD1_0208"
FT   CDS_pept        204958..206322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RD1_0208"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29937"
FT                   /db_xref="GOA:Q16DK6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DK6"
FT                   /protein_id="ABG29937.1"
FT                   /translation="MTKEQWGQLQQRLLKTVGQNNYKNWIEPIEFGSTQDGVATFEVPT
FT                   NFLGNYVSQNFADLILHEVRQEDPAVRRLRFAVPSHVNATTKPARPAQATAPRAPAEKT
FT                   PRSTLSTAPLDARFTFDNFIVGKPNELAHAAAKRVAEGGPVTFNPLFLYGGVGLGKTHL
FT                   MHAIAHELRLRRPEMNVLYLSAEQFMYRFVQALRDRKMMDFKEIFRSVDVLMVDDVQFI
FT                   AGKGSTQEEFFHTFNALVDQNKQIIISGDRAPGEIKDMEERVKSRLQCGLVVDLHPTDY
FT                   ELRLGILQSKVEQQRKNYPGLDISDGVLEFLAHRISTNVRVLEGALTRLCAFASLVGRE
FT                   IDMELTQDCLSDVLRASERKITVEEIQRKVSDHYNIRLSDMIGPKRLRSYARPRQVAMY
FT                   LSKKMTSRSLPEIGRRFGGRDHTTVMHGVKRIEELKIQDGQIAEDLELLRRALEE"
FT   gene            206464..207582
FT                   /gene="dnaN"
FT                   /locus_tag="RD1_0209"
FT   CDS_pept        206464..207582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RD1_0209"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29938"
FT                   /db_xref="GOA:Q16DK5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK5"
FT                   /protein_id="ABG29938.1"
FT                   /translation="MKISIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDVTFR
FT                   ATDLDIEVVDKAPAQVERAGATTVSATTLHEIVRKLPDGALVTLTADSAIGRLTVEAGR
FT                   SNFSLATLPKEDFPVMATSEYQSNFSVKAPVLRRLFDKSKFAISTEETRYYLNGVYMHV
FT                   ADADGGHVLRCVATDGHRLARIDADLPEAANDMPGVIVPRKTVGELRKLLDNDEMTIAV
FT                   SVSETKVRFATPDITLTSKVIDGTFPDYTRVIPQGNTRKLEVDAADFARAVDRVATVSS
FT                   ERSRAVKLQLDEDRLVLSVNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEIASQVDRE
FT                   NAVFLFNSSGDPTLMREGNDLSAVYVVMPMRV"
FT   gene            207640..208740
FT                   /gene="recF"
FT                   /locus_tag="RD1_0210"
FT   CDS_pept        207640..208740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RD1_0210"
FT                   /product="DNA replication and repair protein RecF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29939"
FT                   /db_xref="GOA:Q16DK4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK4"
FT                   /protein_id="ABG29939.1"
FT                   /translation="MALHLTDLMVSHFRSHRVARFALDQRPVALFGPNGAGKTNILEAV
FT                   SLLSPGRGLRRASAQDMTRRPEALGWKITAQVMSLGQHQEVETWSQEGAARQVRINGKT
FT                   AAQTALGRVSRVLWLIPSMDRLWIEGAEGRRRFLDRMTLSFEPGHADATLAYEKAMRER
FT                   NRLLKNMVREPSWYQALELQMAQAGVVVDQNRRMALRQLAAAQSDATTAFPAAELELIH
FT                   NDAPLPDGETALRDAFADSRSRDLAAGRTLVGPHRADLIGTYRAKGVAARDCSTGEQKA
FT                   LLVSLILANARALAQDSGAAPLLLLDEVAAHLDADRRAALYDEITALGAQAWMTGTEKS
FT                   LFDTLGDGAQYFEITETDGASTVQDG"
FT   gene            208737..209357
FT                   /locus_tag="RD1_0211"
FT   CDS_pept        208737..209357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0211"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29940"
FT                   /db_xref="GOA:Q16DK3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK3"
FT                   /protein_id="ABG29940.1"
FT                   /translation="MTISTADLLLYAGALIILFLTPGPVWLALMARALSGGFAAAWPLA
FT                   FGVAVGDILWPLVAVLGISWIVSVFDVFMLVLRWVACGVFIVMGIALIRHARHSISADS
FT                   RLTRPGVSAGFAAGVIAILGNPKAVLFYMGVLPGFFDLRDVTGVDVTVIIAASVCIPLI
FT                   GNLMIAACVGRIRSVITRPQTLARINVISGCSLILVGVLIPVL"
FT   gene            209436..211850
FT                   /gene="gyrB"
FT                   /locus_tag="RD1_0212"
FT   CDS_pept        209436..211850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="RD1_0212"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29941"
FT                   /db_xref="GOA:Q16DK2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK2"
FT                   /protein_id="ABG29941.1"
FT                   /translation="MSENDQTPEEYGANSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VYEVVDNGIDEALAGHADAVTVKIHADSSVSVSDNGRGIPVGIHEEEGVSAAEVIMTQL
FT                   HAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIWREGKEHVARFEGGFTTRHLEVV
FT                   GDTDRTGTEVRFMASTETFSNLDYSFETLEKRLRELAFLNSGVRIILIDERPAEELRSD
FT                   LFYEGGVKEFVKYLDRSKSSVMPEPIFITGEKDDIGVEVAMWWNDSYHENVLPFTNNIP
FT                   QRDGGTHMAGFRGALTRTINNYAQSSGIARKEKVSFTGDDAREGLTCVLSVKVPDPKFS
FT                   SQTKDKLVSSEVRPAVEGLVNEKLAEWFEENPAEAKIVVGKIIEAAHAREAARKARDLT
FT                   RRKTAMDVNFLAGKLKDCSEKDPSKTEVFLVEGDSAGGSAQTGRDRQTQAILPLKGKIL
FT                   NVERARFDRMLGSQEIGNLVMALGTGIGRDEFNIDKLRYHKIVIMTDADVDGAHIRTLL
FT                   LTFFYRQMPQLIEQGHLYIAQPPLYKVSRGKSEVYLKDEAAMEEYLIQQGIDGAMLRQG
FT                   NNEEISGADLARVVELARQMRRVLDAFPTHYPRHILEQAAIAGAFTPGAVDADLQGVAD
FT                   KVAARLNLIALEYERGWQGRITQDHGIRLARILRGVEEVRTLDGRILRGGEASRSGSFT
FT                   EHLQEVYNLPATLVRKDRTQLIHGPMDLLNAILQEGEKGLSLQRYKGLGEMNPDQLWET
FT                   TLDPDARTLLQVKVDDMAEADDLFTKLMGDVVEPRREFIQQNALSVENLDF"
FT   gene            complement(211946..212263)
FT                   /locus_tag="RD1_0213"
FT   CDS_pept        complement(211946..212263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0213"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29942"
FT                   /db_xref="GOA:Q16DK1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK1"
FT                   /protein_id="ABG29942.1"
FT                   /translation="MEKHLKAGDTVFLDFKASWCSTCAAQERVINALKAENPEYEAKIT
FT                   FIDVDWDDHGKSDLVKRMNIPRRSTLVVLKGDQELGRIVAQTGKSQIKALMDSALGAAS
FT                   A"
FT   gene            complement(212378..213091)
FT                   /gene="ccdA"
FT                   /locus_tag="RD1_0214"
FT   CDS_pept        complement(212378..213091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="RD1_0214"
FT                   /product="cytochrome c biogenesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29943"
FT                   /db_xref="GOA:Q16DK0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DK0"
FT                   /protein_id="ABG29943.1"
FT                   /translation="MELLFAYGAGLLTLINPCVVPVLPIVIASAFQSSRFGPVALSGGL
FT                   SLSFVTLGVGVTAFGQALGVDIDTISKIGAGLMVLFGLALLVPQAGAVMAGATAGLSSQ
FT                   ADARIDTLDRGGLRGQFLGGLLLGAVWSPCIGPTLGGAISLASQGEGLLRATTIMVFFA
FT                   AGVSTLILGLAYGTRGAVGRYNTQLRALALRSRPILGVAFVAVGLGLLFNLHHMIEAWM
FT                   IGVLPAWLIDLSVSL"
FT   gene            213264..214499
FT                   /locus_tag="RD1_0215"
FT   CDS_pept        213264..214499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29944"
FT                   /db_xref="GOA:Q16DJ9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ9"
FT                   /protein_id="ABG29944.1"
FT                   /translation="MARLSLEQKLAILSDAAKYDASCASSGSTKRDSRGGKSLGSNEGS
FT                   GICHAYAPDGRCISLLKILMTNFCIYDCTYCINRASSNVARARFSVDEVVKLTIEFYRR
FT                   NYIEGLFLSSGIIRSPDATMSDMVQIARKLRKEENFRGYIHLKTIPDAAPELIEEAGLL
FT                   ADRLSINVEMPTDAAVKQHAPEKSPEQIRRAMADVRLRKEVAKDRTHTGRRPPRFAPAG
FT                   QSTQMIIGADDATDSTVLGQSTRLYSSYKLKRVYYSAFSPIPDASAKLPLISPPLQREH
FT                   RLYQADWLLRFYGFDLEEITGHRKDGNLDLDIDPKLAWALAHRGLFPLDVNTASRDMLL
FT                   RVPGFGTKTVGRILSTRRHRTLRYEDLARMGASMKKAQPFITALGWTPRNLTDSDTLRA
FT                   RFAPPPQQMSLF"
FT   gene            214501..215940
FT                   /locus_tag="RD1_0216"
FT   CDS_pept        214501..215940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0216"
FT                   /product="uracil-DNA glycosylase, putative"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29945"
FT                   /db_xref="GOA:Q16DJ8"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ8"
FT                   /protein_id="ABG29945.1"
FT                   /translation="MPHVSLPRIGTAEAWRDAARGFLSAAVPPAQITWGDSTTEPGLFE
FT                   TPAPLVAPGRVTVPRSFVSMANTVVWHSDPSRFARLYAFLWRLKDAPHLMTDRGDAQLA
FT                   KLRSMEKNVRRCQHKMKAFVRFREIGAPGDNRRSFAAWFEPTHHTIEPTAQFFVRRFAD
FT                   MDWRILTPDVSVFFENGALRFLEDHPKPDLPEDASETLWVTYFRNIFNPARLKVQAMQS
FT                   EMPKKYWKNMPEAAAIPDLIASAPERARQMALAAPTLPPTRISAIQAQQAAHESVWDGP
FT                   PGSLPKAIAGCTRCPLHKTATQAVPGEGPLDARLMIVGEQPGDQEDLIGRPFVGPAGQL
FT                   FDSIAADAGLDRGKVFITNAVKHFKFTPRGRKRIHQRPNQGEVAHCKWWLDAELREVAP
FT                   DLVVAMGATAAAALTGSGKAISARRGRIETGEAGIPVLITWHPSYLLRLRDDTQRMAAT
FT                   QELACDLRMALEYKGKALAAR"
FT   gene            complement(215980..216975)
FT                   /gene="idhA"
FT                   /locus_tag="RD1_0217"
FT   CDS_pept        complement(215980..216975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="RD1_0217"
FT                   /product="myo-inositol dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29946"
FT                   /db_xref="GOA:Q16DJ7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ7"
FT                   /protein_id="ABG29946.1"
FT                   /translation="MISIGLLGCGRIGQVHAGSIARMGNARLTAVADAVPEAAQKLAET
FT                   SGAQTRTAEDIIAATDIDAVIVATPTSLHYDQIHALAAAGKAIFCEKPIDLSSDRAAEC
FT                   MAAVTKAGVPFMTAFNRRFDPHFAHLQAQVADGVIGDAELLVITSRDPAPPPLSYIRQS
FT                   GGLFRDMMIHDFDMARFILGEDPVDIYAAGACLVDPGIATAGDIDSAMVTLKTASGKLC
FT                   QINNSRRATYGYDQRLEVHGSKGMLQVSNQVENLVTHAATAGFASAPNQHFFLERYQAA
FT                   YLAELRSFVDALTKGAAPQPSVADGVAAQRMADAAAESLATGKPVKLAMS"
FT   gene            complement(216979..217827)
FT                   /gene="fba"
FT                   /locus_tag="RD1_0218"
FT   CDS_pept        complement(216979..217827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="RD1_0218"
FT                   /product="fructose-bisphosphate aldolase, putative"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29947"
FT                   /db_xref="GOA:Q16DJ6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ6"
FT                   /protein_id="ABG29947.1"
FT                   /translation="MTLATLTDVLRPALRDGYAVGGLVTLGWEDMRAYVRAAEAEGLPV
FT                   ILQAGPSCRKHTPLPVLGKMFRHLADSVSVPVVAHLDHGYTFDECREALDSGFTSLMFD
FT                   GSRLGLSENIDQTARIAEMAHAAGISCEGEIGFVGYAEGENSQGTDPAEAVKFAKDSGV
FT                   DAMAISVGNVHLQQNQEGGLDEARIRAIEAVTDVPLVIHGGSGVPPEQRSALARNSSIC
FT                   KFNIGTELRMVFGQALRAAVAVDPDRFDRVQILSDVEAPIEAAARTALRAIGPAQDTNK
FT                   G"
FT   gene            complement(217824..218666)
FT                   /locus_tag="RD1_0219"
FT   CDS_pept        complement(217824..218666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29948"
FT                   /db_xref="GOA:Q16DJ5"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ5"
FT                   /protein_id="ABG29948.1"
FT                   /translation="MHIAPFDNQNKPIVDAGDSLVPLNYFNIVKLKKGESFGYAVPGYE
FT                   TCIAPATGLLDVATGGFEAKNLGGRGVDVWDGEPEGVYVPSGQEARFTCLSDSAEVFVA
FT                   GAKFDEVLEPFAVRADEIDLVQYGSDDTKTHRKIKHILGANQHERVGRLLVSELFTVGA
FT                   GGWSGFPSHKHDTDRLPDETRHDETYNFRFKPNYGSGLQMLQREDNEPGDAYHIVDGST
FT                   ICIDKGYHPCCVLPGYEMYYFTILGGLSQRSLKQYFQPTHAEQLHTIPGIMDMVAKFK"
FT   gene            complement(218671..219645)
FT                   /locus_tag="RD1_0220"
FT   CDS_pept        complement(218671..219645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0220"
FT                   /product="pfkB family kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29949"
FT                   /db_xref="GOA:Q16DJ4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ4"
FT                   /protein_id="ABG29949.1"
FT                   /translation="MREGIAQKNFVILGRAGMDMFAHPPGVKSEEAEVFHADLGGSSAN
FT                   IAAGLCKLGCAASLVTSVSDDAVGRFCINRMKHYGVGTEYVRSVAGEFRNSLAIYESCI
FT                   EDFQNVIYRNGAADFQVTTDDMAAVDFSPFGALVTAGTVFAAEPSRSATFAAFETARAR
FT                   KLPVIFDIDYRPYSWPSPEVAADVLSRAGAASDMIVGNDEEFGFMAGDIAKGLEKAQSL
FT                   AENGVAIVIYKMGEKGAVTFAGGQEIHTGIYPVTAVKPNGAGDSFMAGLLSGIAEGLDL
FT                   QDAVLRGSACASIVVAKPGCAPAMPTHDQLAAFLAEHPGPTKG"
FT   gene            complement(219669..221534)
FT                   /gene="iolD"
FT                   /locus_tag="RD1_0221"
FT   CDS_pept        complement(219669..221534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="RD1_0221"
FT                   /product="acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29950"
FT                   /db_xref="GOA:Q16DJ3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ3"
FT                   /protein_id="ABG29950.1"
FT                   /translation="MTDKTIRLTTAQAIIRYLNAQFIEIDGERVRLCGGGFGIFGHGNV
FT                   TCLGEALFDVKDTLPLYRGQNEQGMGFAAAAYAKYHLRQRFMFCTASAGPGTSNLMTAA
FT                   ALAHTNRLPMLMLCGDTFLTRLPDPVLQQIEHYGNPAYGLNDGFRAVSRYWDRITHPAQ
FT                   VIQSLPAAIATMLDPADCGPAFIALPQDVQGWAYDYPEALFEEKTHRIRRQTPDPDEIA
FT                   DAAALLRAAERPVIIAGGGVQYSRAVAELTAFAEAHDIPVIETIAGRANLHDTHPLNIG
FT                   PVGVTGSDSANAVAEAADVILSVGSRLQDFTTGSWTAFAKDARIVSLNAARHDAGKHMS
FT                   LPVVGDAKLGIAALGTALAGYRAPESWTGFAKEERQKWNAYVAENVKPGNRPNSYAQAV
FT                   GVVNALCDKRDRVVAAAGGLPAEVTANWRTLDIGTVDVEFGFSCMGYEISGGWGARIAQ
FT                   SEKEPDQDTIVFCGDGSYLLMNSDIYSSVLTQKKMILLVLDNGGFAVINKLQNNTGNQS
FT                   FNNLFEDTPTIPEAFAVDFVAHAASMGAHAMRADNAAELGAAFKAAKAADKTTVIVMNV
FT                   DAYDGWTTQGHTWWEVGTPEVSDHQSVREKHAEIEASRAKQRRGV"
FT   gene            221652..222755
FT                   /locus_tag="RD1_0222"
FT   CDS_pept        221652..222755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0222"
FT                   /product="oxidoreductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29951"
FT                   /db_xref="GOA:Q16DJ2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ2"
FT                   /protein_id="ABG29951.1"
FT                   /translation="MAEIGIGIIGGGYMGKAHAVAFSAVGAVFDTTLRPRLEMVAASTE
FT                   SSAASYAKSYGFARSTGDWRVLVADADVQAIVIASPPETHLEITRAAAALGKPVFCEKP
FT                   LGRSVEDGKEMVQAVEAARAVNMIGFNYIRTPASQYARALIAEGEIGDITWFRGEHTED
FT                   FYADPDAPATWRAQGDSNGCMGDLAPHMINAALALIGPIGSVMAEIETVHKTRGGAPVT
FT                   NDDQGQIMCRFTNGAMGHLFFSRTATGRKMGYIYEVTGTRGAIRFDQEDQNALWLYKAE
FT                   GPEAQRGFRKILTGPAHPDYEPFCQGPGHGTGYQDQIIIEARDFLAAIEAGKSRWPTFR
FT                   DGLEVSNIVEAARRSHAARAWQDVNHG"
FT   gene            222774..223670
FT                   /locus_tag="RD1_0223"
FT   CDS_pept        222774..223670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29952"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ1"
FT                   /protein_id="ABG29952.1"
FT                   /translation="MTIKIGNAPCSWGVEFADDPRNPAWRDVLRENAEAGYKGIELGPV
FT                   GYVPEDPAILADALAEYDLSLIGGVVFRPFHDPAAWDDVLDAAVRTCKALKAHGAEHLV
FT                   LIDSTSPRRAGTAGRANDAEQMDKAEWSAFRDRIAAVARIGAEDYGLTVGMHAHAAGFL
FT                   DFEPELERLMNEIDENTLKICFDTGHHSYAGFDPVAFMEKHIGRISYMHFKDIDPVVKA
FT                   DVIAKSTGFYDACGQGIFCNLGDGDVDFPRVREILLESGFDGWCTVEQDCDPTLPDTDS
FT                   LRDAKLNRAYLETIGFS"
FT   gene            223684..224817
FT                   /locus_tag="RD1_0224"
FT   CDS_pept        223684..224817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0224"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29953"
FT                   /db_xref="GOA:Q16DJ0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DJ0"
FT                   /protein_id="ABG29953.1"
FT                   /translation="MTRLNWGMIGGGEGSQIGPAHRLGAQADGNFVLAAGALDVDAEKG
FT                   KAYAQSLGVSAQRSYANWQDMLEGEKNHPDRLDLITVATPNSTHFEITKAFLEAGFNVL
FT                   CEKPMTMTVDQGEEIVRVAKASGKICAVNYCYSAYPMVRQMRQMVAAGEIGKVRLIVTN
FT                   FSHGHHGDATDADNPRVRWRYDPAMAGVSGQFADCGIHALHMASFIAGDEVRSLSADFA
FT                   STIDSRVLEDDAMVNFRMEGGTVGRLWSSSVAIGRQHGFDIQVFGETGGMRWASEQPNQ
FT                   VFYTPVGGRTQIMEKGEAGLSDEAARLSRVAIAHPEGFPLAVANIYVDLAAAIRGQRRD
FT                   SLPTAEDGLRSMAAVYAAVDSAVQDGKWVDARPPSLR"
FT   gene            224950..225585
FT                   /locus_tag="RD1_0225"
FT   CDS_pept        224950..225585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0225"
FT                   /product="putative cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29954"
FT                   /db_xref="GOA:Q16DI9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR020137"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI9"
FT                   /protein_id="ABG29954.1"
FT                   /translation="MDHFANLHWIEAVGWLASILTVASYSVATMLPLRLLAIASSVCFA
FT                   AYAFTLQLWPLLAMELILLPINIYRLWQVLALRGKLSRATVSTESDFSIIKAYGKRKTI
FT                   KAGEVVFQRGDPVDQLYFIAKGRVSIEEMQVDLCAGDIFGEIAFFTNTATRIATARCTE
FT                   DTQVYSIDEKHFMRLQFEDPSFGIAVMRIITHRLIENVGKTVEPAPGA"
FT   gene            225804..226409
FT                   /gene="leuD"
FT                   /locus_tag="RD1_0226"
FT   CDS_pept        225804..226409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="RD1_0226"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29955"
FT                   /db_xref="GOA:Q16DI8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DI8"
FT                   /protein_id="ABG29955.1"
FT                   /translation="MDKFTTLTGIAAPLPLINVDTDMIIPKQFLKTIKRSGLGVNLFDE
FT                   MRYDDDGNEIPDFVLNQDAYRKAEIIVAGDNFGCGSSREHAPWAIKDFGIRCVIAPSFA
FT                   DIFYNNCFKNGILPIALPQEQVDVLMKDAEKGANARMTVDLETQTVTTSDGEVFSFDLD
FT                   PFKKRCLMEGLDDIGLTMEKISAIDSFEQSAAQARPWV"
FT   gene            226454..227707
FT                   /locus_tag="RD1_0227"
FT   CDS_pept        226454..227707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29956"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI7"
FT                   /protein_id="ABG29956.1"
FT                   /translation="MAFMVNDMMFLRHAARLRSGWFQKTRDLPDAYPESRGISKRALSK
FT                   QENPHLGRARRRSRVRIAVSARSLLLTAAISLNAACAWSETLRVATFNTGLERKGPALL
FT                   LRDIVRGEDAQIEAVASVLTTIAPDIVALQSFDYDLTGAALSAFSKVLRDVGLDYPYQF
FT                   AALPNTGMRTDLDMDGNRRRAEARDAQGYGFFSGQGGMAILSKYPIVTDEVQDFSSMLW
FT                   RDFPGALLPQTAAGPFPSEQAQAIQRLSTTGHWVVPVDVPGLGRVTLMTLHASPPVFDG
FT                   PEDRNGKRNHDEIVFWQRYLDGSFGPAPDRQFVLLGDFNQDPVDGEGLKNAIRSLISDP
FT                   RLQDVEPTSTGSAEATGDPFDTADWDDPVPGNMRVDYVFPSSDWRVQEAGVYWPSGPAG
FT                   VVAQTASRHRLVWVDLAR"
FT   gene            227780..228886
FT                   /gene="leuB"
FT                   /locus_tag="RD1_0228"
FT   CDS_pept        227780..228886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="RD1_0228"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29957"
FT                   /db_xref="GOA:Q16DI6"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI6"
FT                   /protein_id="ABG29957.1"
FT                   /translation="MANPSLLILPGDGIGPEVMEQVKRVIAWFGDKRDLAFDVSEDLVG
FT                   GAAYDAHGTPLHDETMARALQVDAVLLGAVGGPKYDDLDFSVKPERGLLRLRKEMDLFS
FT                   NLRPAQCFDALADFSSLKKDVVAGLDIMIVRELTSGVYFGEPRGIFEEGNERVGVNTQR
FT                   YTESEIDRVARSAFELARRRNNKVCSMEKANVMESGILWREVVQKVHDEDYPDVELSHM
FT                   YADNGAMQLVRAPKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPAANGRPKA
FT                   LYEPVHGSAPDITGQGKANPIACILSFAMALRYSFDQGDEAARLEAAIETVLANGARTA
FT                   DLMGEEGGTPISTTEMGDAILKALDASL"
FT   gene            228998..230002
FT                   /locus_tag="RD1_0229"
FT   CDS_pept        228998..230002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0229"
FT                   /product="integral membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29958"
FT                   /db_xref="GOA:Q16DI5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI5"
FT                   /protein_id="ABG29958.1"
FT                   /translation="MARGPMNPNVKGASFALIAFAVFALHDVIIKVLGSSYSPIQIVFF
FT                   GVVFSFPLAMLYLLRDTTSGTLLPVHPWWMAARTVAAVITGFCAFYAFSVLPLAQVYAI
FT                   LFAAPLLITILAIPILGEQVRWQRWLAVFIGLCGVLIVLRPGQQELALGHLAALVSAIC
FT                   GSFASIIVRKIGREERTVVIMLYPMMANFVVMAALLPLVYQPMPLADLGKLGVIAVLAW
FT                   VAGRFLIAAYNSGEAVIVAPMQYSQILWATFYGVLFFDEVPDLPTIAGSAVIIASGLFI
FT                   VLRESSAPGSERPVQRTRSRAETGTSPRVSTFLSPDRKWGRSRKKDTSKPDDL"
FT   gene            complement(230261..231901)
FT                   /locus_tag="RD1_0231"
FT   CDS_pept        complement(230261..231901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0231"
FT                   /product="oligopeptide ABC transporter, periplasmic binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29959"
FT                   /db_xref="GOA:Q16DI4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI4"
FT                   /protein_id="ABG29959.1"
FT                   /translation="MKFSDTIHPAARTYSQEVAAGTLSRREFLTRATSLGVSAAAAYGL
FT                   LGLSKPAKAASPALSGGTLRIESLVKALKDPRTYDWPQMSNYTRGYLEFLVEYQIDGSF
FT                   EPMLLEGWEVNADATEYTLSVRQGVTWNNGDAFTAEDVAFNITRWCDKGVEGNSMASRM
FT                   DALVDPDTGVAREGAIVVEDAATVRLVLEKPDITLIAGFSDYPAAIVHQSFNGDPLDNP
FT                   IGTGPYMPAEFEVGVRAALVRNEAHNWWGEGAYLDRIEYLDYGTDQASIVAAVDADEVD
FT                   MVYESLGDFIFIMDDIGLAKSEAVTANTVVIRPNQAAEVDGIKPYADARVRRALAMAVD
FT                   NAVLLELGFSDNGRLAENHHVSPIHPEYAELPAPVFDPAGAMALMEEAGMADYEHDLIS
FT                   IDDTWRKDTTDAAAAMLRDAGMNVKRTVLPGSTFWNDWSKYPLSSTDWAQRPLGVQVLA
FT                   LAYRSGEPWNESAFANAEFDALLSDAMAIADADQRREVMAKLQKIMQDEGVIIQPYWRS
FT                   IYRHHKENVVGAEMHPTFEIHVTKLGLAA"
FT   gene            232120..233331
FT                   /locus_tag="RD1_0232"
FT   CDS_pept        232120..233331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0232"
FT                   /product="HAMP domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29960"
FT                   /db_xref="GOA:Q16DI3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI3"
FT                   /protein_id="ABG29960.1"
FT                   /translation="MIDQNNPSIGRFDKSFLVHMIRDFFIVLVIVTVVEFSLKAALVFY
FT                   SYYVDGVEQAQLVAEDLADNVRSIMRNEGGPVAARTMYPILEENWSDLGYVIAIEPAPV
FT                   TVESIEEGFGFTPKGIPAENWPDGRFQVHQIDITAETFCLACHTQASVGDVLGTVTVRN
FT                   YLYRDFSIWFKDVRLTAILSAGKIVLHSLLLFLILRARLEPLMELRSVISNLARAYGRL
FT                   DHRAEIRTSDEFGVLARDLNLFLDRITGIVSELDLVLAKVVRANDDIISVQGSLRETVD
FT                   DVVSGIRRLERDAMLSAKREPRLSNEWFDAVKGSINALDAALDGAQDATAATDLLNALR
FT                   QVVANAEGQTETSEKIYKNLADLGDQSETLKSSTLEMTRLEERLKSIIETCGGLVRRLK
FT                   PEGK"
FT   gene            233441..233517
FT                   /locus_tag="RD1_0233"
FT   tRNA            233441..233517
FT                   /locus_tag="RD1_0233"
FT                   /product="tRNA-Arg"
FT   gene            233606..234763
FT                   /locus_tag="RD1_0234"
FT   CDS_pept        233606..234763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0234"
FT                   /product="transcriptional regulator, LacI family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29961"
FT                   /db_xref="GOA:Q16DI2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI2"
FT                   /protein_id="ABG29961.1"
FT                   /translation="MPARRFTVLLAHELAWFRQCLIGRPFVGYQCATGQELAVTRPKHR
FT                   PLTLRDVSEACGVSEMTVSRVLRNRGDVSAATREKVLAAAKALGYVPNQIAGSLASQRV
FT                   NLVAVVIPSLSNMVFPEVLTGINRTLDDTPLQPVVGVTDYLPEKEEQVLYEMLSWRPSG
FT                   VIIAGLEHSDATRAMLTNAGIPVVEIMDTDGTPVDSMVGISHRRAGRKMAEAILKQGFS
FT                   RIGFLGTKMPLDHRARKRFEGFTEGLTKAGIEIEDREFYNGGSALAKGREMTQTMLERS
FT                   PDLDFLYYSNDMIGAGGMLWLMDQGVDIPGEVGLAGFNGVELLEGLPRQLATMDACRAE
FT                   IGEKAAQIILDRSAALDTEDSFEPEHITLAPKISYGQTLRRHGQG"
FT   gene            234760..235971
FT                   /locus_tag="RD1_0235"
FT   CDS_pept        234760..235971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29962"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI1"
FT                   /protein_id="ABG29962.1"
FT                   /translation="MNTLTLSNTDARQLFLDRHALAETPAGAAQGDALLDLIRRLGFVQ
FT                   LDSINTVARAHDLILFARRPRYRPEALKSLYETDHALFEHWTHDAAVIPMEFYSWWQLR
FT                   RQRDAEKLRKQWKNGRRGGFEAQFQTILDQIREQGPVSSSDVGAGEKRGSGGWWDWHPS
FT                   KTALEYLWRSGALCVVGRDGFRKRYDLTERVVDAALRDAPLSQDRQKATIDWCCTGALD
FT                   RLGFATPTELAAFWDHITLAEAKEWCAAQLAKGCLQPVQITCADGGARHSFARPDLAAD
FT                   PALERRASKRLRVLSPFDPALRDRKRAERLFGFTYRIEVFVPEAKRTYGYYVFPILQGD
FT                   KIIARVDMKAFRNEDVLRVKALWPEPGLRWGKGRQSAFEGELTRLTRLAGVSKVGFEDG
FT                   WLRA"
FT   gene            complement(236071..236796)
FT                   /locus_tag="RD1_0236"
FT   CDS_pept        complement(236071..236796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29963"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DI0"
FT                   /protein_id="ABG29963.1"
FT                   /translation="MLHGQTDTMSNKGADKLGILMLDTRFPRIPGDIGNPQTWDFPVQY
FT                   AVVPGASPQAVVCDDTAPFVRAFVREGQRLVAEGCTGIATTCGFLALIRPQLAQALGVP
FT                   VAASALEQAAQIQATLAPDKNLGIITISKASLSPSHLRVAAVPEDCAIVGMEGSDFARS
FT                   ILENRADLDVARARHELVAAGQTLVETAPQTGAILLECTNMVPYAADLRRATGLPVYSI
FT                   YTYLNWFHQSLNPKVFPPG"
FT   gene            complement(236804..237319)
FT                   /locus_tag="RD1_0237"
FT   CDS_pept        complement(236804..237319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29964"
FT                   /db_xref="GOA:Q16DH9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH9"
FT                   /protein_id="ABG29964.1"
FT                   /translation="MSDSFPGPVVSSAHLASGSFAEISELEFGLTLAGNAFHRWMVRAI
FT                   AMAGYPELGALDVLVLHSVYHRERPKKLADICLVLNVEDTHTVNYAIKKLIKAGLVKDG
FT                   RQGKEKTVVATKKGAETCERYRDIREGLLLRAVGDLGLEPEQVSRAATLLRLMSGQYDQ
FT                   AARAATTY"
FT   gene            237454..238695
FT                   /locus_tag="RD1_0238"
FT   CDS_pept        237454..238695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0238"
FT                   /product="oxidoreductase, FAD-binding, putative"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29965"
FT                   /db_xref="GOA:Q16DH8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH8"
FT                   /protein_id="ABG29965.1"
FT                   /translation="MTKNVVVIGAGIVGVSTAIWLKRAGAQVTIIDRAGPGKGTSHGNA
FT                   GVLAAAAMVPVTTPGLIRKAPGMLFNPDFPLYLRWSYLPKIAPWLVKYLSNANDADTRR
FT                   IARDLAPIVTDSVSQHKSLVRELGLDAWVTESDYCFAYTDEAAFKSEAYVWALRRDAGF
FT                   EPELIRGGDVQDYEPNISPSVGLIAALKDHGFIRDPGGYVQALAKAFDGMGGTVITAEV
FT                   KDFDLSGGRISGLETTAGRINCDDAVLATGVWSKPLMKKLGLNIPLESERGYHIVYEDA
FT                   TGGPARPTMIASGKFVATPMAQGVRCAGIVELGGLHAGPSDAPLKFLRKKTKETFPNLN
FT                   ATAEVEWLGHRPAPTDSLPLIGQIGKTGVFTAFGHHHIGLTGGPKTGRLVAGLVMEHPA
FT                   NQDLTAYAPQRFQN"
FT   gene            238716..239705
FT                   /locus_tag="RD1_0239"
FT   CDS_pept        238716..239705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0239"
FT                   /product="peptide ABC transporter, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29966"
FT                   /db_xref="GOA:Q16DH7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH7"
FT                   /protein_id="ABG29966.1"
FT                   /translation="MKMKRKLMASVATVALTVTSAVPAFAAEKWDMPMAYSASNFHSEN
FT                   GVAFAECVGAGTNGEITIEVHAGGSLFAGADIKRAIQTGQVQIGERLLSGHQNESAVFG
FT                   FDSVPFLAPSFEDSEKLYAAAKPSIEALLDEQNLELLYAVPWPPQGLYFKKEVNSVADM
FT                   AGVKFRSYNNTTSRLAELTGMLPVTVEAAEISQAFATGVAEAMVSSGATGYDRKVWESL
FT                   THFYEVDAWLPRNYVMVNQDVWADVSDANKDAIRACATEAEARGLEASKAYTQFTMDGL
FT                   AAGGMTVQPAGDALMAELRAIGETMTTEWLEAAGETGAALVDAYKAAQ"
FT   gene            239769..240293
FT                   /locus_tag="RD1_0240"
FT   CDS_pept        239769..240293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0240"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29967"
FT                   /db_xref="GOA:Q16DH6"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH6"
FT                   /protein_id="ABG29967.1"
FT                   /translation="MTALRKTLDFLYHAAGVLAAICLISILLLIVAQMVARWTGEIFPG
FT                   APDYAGYAMAAASFLAFANALNHGAHIRVSIVLNALPAGPKRLLEIWCFGIGAAIAWYF
FT                   TYYAYWFVYWSWKFNEVSQGQDATALWIPQSVMVIGGGLLAISLTDNLFHVIFKGDHRI
FT                   VRDTVDDHFEV"
FT   gene            240274..241608
FT                   /locus_tag="RD1_0241"
FT   CDS_pept        240274..241608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0241"
FT                   /product="putative TRAP dicarboxylate family transporter,
FT                   DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29968"
FT                   /db_xref="GOA:Q16DH5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH5"
FT                   /protein_id="ABG29968.1"
FT                   /translation="MIISRCEAMTELYAIAIFLAVLFLLLGTGVWVGLALMGVAWVGME
FT                   LFTTRPVGDTMITTIWASSSSWTLTALPLFIWMGEILYRTRLSEDMFKGLSPWLARLPG
FT                   GLVHTNIVSCTVFAAVSGSSAATLTTVGKMAIPELRARKYPEKMVIGTLAGAATLGLMI
FT                   PPSLALIVYGVTVNESITKLFFAGVFPGLILASMFMAYVAIVSFTSKDWNPTVERGMSF
FT                   GEKVRNSKFLAPVFALIAVVIGSMYLGYATATEAAAIGVIGSLLLALTQGSLTMASFQA
FT                   SLMGAMRTSAMIALILAGAAFLKLSMGFTGLPRALADGIAAMELGRFQLLMALLVFYII
FT                   LGMFLDGISAVVLTMAIVEPMVREAGIDLIWFGIFVVVVVEMAQITPPIGFNLFVLQGM
FT                   TRHEMGYITKAALPMFLIMVLMVFVLIWFPQIATWLPENLRQNAS"
FT   gene            241608..242537
FT                   /locus_tag="RD1_0242"
FT   CDS_pept        241608..242537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0242"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29969"
FT                   /db_xref="GOA:Q16DH4"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH4"
FT                   /protein_id="ABG29969.1"
FT                   /translation="MLKVLLWRISENGRLALIVGLVAGLTLPGLAAALQPWLPQMVAVL
FT                   LAITALRIGHRAASGALADLRWGIGSVVVLQLLLPFCLFALCWSLGLAGTPIALAAVLA
FT                   TAAPAISGAPNLALMLGQNGGRMMQILVLGTALFPITVLPLLWMTPQLGDPHQVLRAAL
FT                   SLLGVIIAATSLGFGLRAIVFPNPTEAQVKALDGLSVLAFSAIVVGLMAALNPALRNNA
FT                   PEVAMWALLAFAISYGAQIVVYLFLRRSRLGPVAGPLAIGAGNRNIALFLVALPEQVMA
FT                   PLMVFIGCWQLPMYMTPILLRWLYKPEG"
FT   gene            242542..243276
FT                   /locus_tag="RD1_0243"
FT   CDS_pept        242542..243276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0243"
FT                   /product="allophanate hydrolase subunit 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29970"
FT                   /db_xref="GOA:Q16DH3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH3"
FT                   /protein_id="ABG29970.1"
FT                   /translation="MSYPQIKTVGLSGLLVTFAEKMSSPANRAALAFRAAVVAADWPEV
FT                   RETSMSLVSVYVVADLVSEDIPKLITKLENLLSQTDWYAAPLPEGRRLWHVPTVYGTDL
FT                   APQLEEAAELAGVDPDTAIQQLSTTRMRVLTIGFAPGQPYMGELGENWNIPRQQDLTKS
FT                   VPAGALVAAIRQLVVFTAPTPTGWRHVGQTAFENFRQTADQPFALTPGDELLFPQVSRQ
FT                   ALMDIMKSDTSGNGGAERETLP"
FT   gene            243273..244295
FT                   /locus_tag="RD1_0244"
FT   CDS_pept        243273..244295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0244"
FT                   /product="allophanate hydrolase subunit 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29971"
FT                   /db_xref="GOA:Q16DH2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH2"
FT                   /protein_id="ABG29971.1"
FT                   /translation="MSGHLTIHAAGPGSSVQDMGRAGFLAYGLTRGGAADQMALHEAAA
FT                   LLGQSATLGAIEMVGVGGTFESDVDTVIALTGAEMSASIDGSALVWHASHALPKGAKLK
FT                   IGGALKGTYGYLSVAGGIEAPQIMGARSTHFKAGIGGALEAGQSLPIGVTPTQRAGFVI
FT                   HASGRFAGGDIRIVPSVQTDQFSPETLARFTQTTFRRDARGNRQGVRMDADTDGFFVDG
FT                   GLSIVSEVITEGDIQITGDGAPYVLMCECQTTGGYPRIGTVLPCDLARVAQAPVGAPLR
FT                   FRFVTMDEAREIELKARAEIKALAGRAQPLVRNPHEMSDLLSYQLIGGAISATTDPFAD
FT                   "
FT   gene            244308..245078
FT                   /locus_tag="RD1_0245"
FT   CDS_pept        244308..245078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0245"
FT                   /product="LamB/YcsF family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29972"
FT                   /db_xref="GOA:Q16DH1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH1"
FT                   /protein_id="ABG29972.1"
FT                   /translation="MNRVDLNADMGESFGPWKMGDDATLLKTVTSANIACGAHAGDPDV
FT                   MVATMRTAHANGVGIGTHPGFADLQGFGRRRMSVPRASLQNSIRYQVAASVGVAKSIGA
FT                   RVRHLKLHGALANMASEDDTLARDLFEAALSVDPDLIVMVLCATAQEEAVRALGCSYAG
FT                   EIFADRAYNDDATLVDRSLPGAVIHDPQIAGPRMVEMVQAGAIITESGKRIKTSIDTIC
FT                   LHGDTPTAVEIARSVRTALEGADIAVRQFDGRRH"
FT   gene            245288..245749
FT                   /gene="iorA"
FT                   /locus_tag="RD1_0246"
FT   CDS_pept        245288..245749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="RD1_0246"
FT                   /product="isoquinoline 1-oxidoreductase, alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29973"
FT                   /db_xref="GOA:Q16DH0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DH0"
FT                   /protein_id="ABG29973.1"
FT                   /translation="MPTTFNVNGNPVTLDVDPDMPLLWALRDHLKLTGTKYGCGIAQCG
FT                   SCTVMLDGFAARSCVTTVGDVAGSQVQTIEGVESAAARAVQQAWTTLNVAQCGYCQSGQ
FT                   VLVATELLENTPKPTDEEIDAAMGANICRCATYARIRKGVRAASDSLEA"
FT   gene            245753..247936
FT                   /gene="iorB"
FT                   /locus_tag="RD1_0247"
FT   CDS_pept        245753..247936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorB"
FT                   /locus_tag="RD1_0247"
FT                   /product="isoquinoline 1-oxidoreductase, beta subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29974"
FT                   /db_xref="GOA:Q16DG9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG9"
FT                   /protein_id="ABG29974.1"
FT                   /translation="MHAIKPAHSKSNADATGPSRRAFLAGATGLVVAMALPIKGRAQAV
FT                   ATAQAAFAPNAFIRVSPDNIVTVLIKHVEMGQGANTGLAILAAEEMDADWSQIRAEQAP
FT                   DDPSLYANLAFGVQGTGGSTGLSNSYMTMREAGATARALLIEAAAQTWGIPAGDVSVSA
FT                   GVVSNDATGQTATFGELAERAATLPMPQDVTLKDPSEFKLIGAEGITRLDAADKARGKS
FT                   TFSIDVMRDGMQVVTVLHPPKFGAVLASFDATAALDVPGVTAVHQIASGVAVYGADTFA
FT                   ALRGRDALVVQWDETNAETRSSQEIEEEFLKAARSPARVAENIGDVDAAFDQAERSFEA
FT                   EYIFPYLAHAAMEPLDGVVEWTPDRVDVWSAIQIPTIAAPVFSSTLGVAPEAVSLHTMY
FT                   AGGSFGHRATATNHFENEMAQVAAAAGPGSYKLQWTREDDMTQGYYRPLTVHRFRGGLD
FT                   ADGNITGWDNTVANQSIMAGTMFEQALMGDGLDRTSYEGSTDLPYALPARRVSWAQMQT
FT                   GVPVLWWRAVGHTHTAYATETFLDELLIAGGRDPVQGRLDLITQDRPRDRAVLERVAEM
FT                   AQWSGPGTGERRYGVALHRSFGSFVAQIAEVENRDGTPHVTRVWCALDCGVAVTPDVVR
FT                   AQMEGGIGFGLSAALFEQLTLEAGGTVRERNFDAYRVLGLEEMPEIMVDIMPSEVAPTG
FT                   VGEPGTPPIAAAVGNAWRAHTGQTPRRLPIIGA"
FT   gene            248152..249030
FT                   /gene="araC"
FT                   /locus_tag="RD1_0248"
FT   CDS_pept        248152..249030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="RD1_0248"
FT                   /product="transcriptional regulator, AraC family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29975"
FT                   /db_xref="GOA:Q16DG8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG8"
FT                   /protein_id="ABG29975.1"
FT                   /translation="MPRRYADIYPSSPLLNSDAMQHVSAAALMSVRYFQAEPDSMPEEV
FT                   FAEHHVLLNLCETPHRVQNRRDGELRDFMFHKDEIIVTPAGMKSGWRWFGKSDVIVVTL
FT                   DPAKVQKFAQSELGIILDRQQFADLPQFNDPDLCAAGIMLRDALENDDLTSGVMFEAMS
FT                   RVLLVKLLQRYGQKRPEELALSARFTTDHYGQVLAFIRANLDRTITVDDLAAEVGMSPS
FT                   HFGRVFKETLGQTPMQYVLAYRIEQAIEMMKEAGRPLGMIALDCGFADQAHFSRSFKQV
FT                   MGQTPRQYRAR"
FT   gene            249157..250302
FT                   /locus_tag="RD1_0249"
FT   CDS_pept        249157..250302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0249"
FT                   /product="transcriptional regulator, AraC family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29976"
FT                   /db_xref="GOA:Q16DG7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG7"
FT                   /protein_id="ABG29976.1"
FT                   /translation="MRSLTLPPSQGGAGRFDSACCTWLKVFVALTFDDSDCLEMTIDKL
FT                   PHLSTVSSQFIADWLAALRPLCSADHFTDLLQRSDLQSGEDVQNGRVTLDQIVCLYQLA
FT                   AVETGDEMMGLWSRPIRHRALQHLLTSVREATSLSSALYRFSTFWNLLLDDYEFTFSED
FT                   ETGSVLRLTPRGDHEPQRFGHMLILKLAHGLISWLARDEVPVTAVDFAFARPRFDEDYA
FT                   VIFPAPVRFDQSATAITFDLSLQGPVQLRSTADLDVFLQNAPRDWIFTRSEVHTQSLRV
FT                   RSYLSQAGWDTANLTGAARALHLTPRTLIRKLEADGTSFQMIKDALRRDIAIRHLQTGQ
FT                   HSIEAIAHEVGFSSAANFHKAFQRWTGNTPSSYRRRNAGKR"
FT   gene            250459..251688
FT                   /locus_tag="RD1_0250"
FT   CDS_pept        250459..251688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0250"
FT                   /product="acyl-CoA dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29977"
FT                   /db_xref="GOA:Q16DG6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG6"
FT                   /protein_id="ABG29977.1"
FT                   /translation="MLERRTEHMSDKLESILAAAHDHATQVVTPNVDAWNAAKAWPRDA
FT                   SDKAGAAGLMGLYAPEAWGGEGLPLSEGIQVYEQLGLGDGAYAFALSMHNICTFAGCGY
FT                   GTDAFKEKWAHDLTSGRKLANFALTEPQSGSDPVKMYTRATINDDGTWTISGSKAWVSL
FT                   AAEADIYFTVVKTSDAPGHKDMAMIAIPADAPGISFGKPYETPSYNYLPMSEMYLDKVV
FT                   VSADNIILPIGQGLQGSLMAIDIARVSIASGCCGLMQAALDTALAYSKNRKMFGGKNLD
FT                   LDGIQWMLGEVATDLEVSRLLYRKAAQALGTPEGPLMAAHAKRFVPDAAVKATNTCTQV
FT                   LGGMGLLQPYGLDRLSRLAQMLRIVDGTTEISRVVIGRALQKRAAGLPDLPVPKGFGEE
FT                   AADAVPVAAE"
FT   gene            complement(252232..253581)
FT                   /gene="fliI"
FT                   /locus_tag="RD1_0251"
FT   CDS_pept        complement(252232..253581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="RD1_0251"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29978"
FT                   /db_xref="GOA:Q16DG5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG5"
FT                   /protein_id="ABG29978.1"
FT                   /translation="MNQPIPFDGLTAQITELNPVRSIGRVCRVEAGVIHISGLAGKARI
FT                   GDLVVVYRQGEPLSGEILQLDGDTLVILPDQDAEGVALNDRAALLEARGIAPSQGWIGR
FT                   IIDPFGNPIDGKPLLRGAEARSLRSAPPEPALRRPMGTRLNTGMSVLNTMLPVVKGQRV
FT                   GLFAGSGVGKSSLLGHLAQNMTADVVVVALIGERGRELRHFVEEVLGPEGLKRSVVICA
FT                   TSDQSPLIRRRCAWAAMSVAEHFRDMGLSALILADSITRFAEAHREVAVASGEAPVLRG
FT                   YPPSTAHLIMSLCERAGPGEGAQGDITGIFSVLVAGSDMEEPIADILRGVLDGHIVLNR
FT                   EIAERGRYPAIDVLKSISRSLPAAADDIENELISIVRRYLSIYEQNEMMIRAGLYSQGS
FT                   DPDIDAAIQVWSDLDAFFAKPEKQDVSNSFSQLELLLRRNKIQTRPTMVQ"
FT   gene            253663..254061
FT                   /gene="flgB"
FT                   /locus_tag="RD1_0253"
FT   CDS_pept        253663..254061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="RD1_0253"
FT                   /product="flagellar basal-body rod protein FlgB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29979"
FT                   /db_xref="GOA:Q16DG4"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG4"
FT                   /protein_id="ABG29979.1"
FT                   /translation="MFEKLEVFRMAHAMAVHAGEKQAVTAQNVANSDTPDYQARDVIPF
FT                   SDTYSRDPANGGWGSQKATRQTHINGAAAGQTPDPIIDENGVGSPNGNTVSLENEMLKS
FT                   LDAKRQHDRALAIYKSSLSILRATLSRS"
FT   gene            254075..254464
FT                   /gene="flgC"
FT                   /locus_tag="RD1_0254"
FT   CDS_pept        254075..254464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="RD1_0254"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29980"
FT                   /db_xref="GOA:Q16DG3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG3"
FT                   /protein_id="ABG29980.1"
FT                   /translation="MSEFSKSLDVTTSGLKAQATRLRHLSENISNADTPGYRRKLVSFE
FT                   TAFGGQGVSTVETSRVRLDQSTLERVYDPSHPMADESGYFDGSNVDLLIELSDAREAQR
FT                   SYEANLKVFEQTRKMSSSLMELLRK"
FT   gene            254518..254844
FT                   /gene="fliE"
FT                   /locus_tag="RD1_0255"
FT   CDS_pept        254518..254844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="RD1_0255"
FT                   /product="flagellar hook-basal body complex protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29981"
FT                   /db_xref="GOA:Q16DG2"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG2"
FT                   /protein_id="ABG29981.1"
FT                   /translation="MDMKAVSAIQNFTNARAASAIESYQQARPATEPLPEESSASETLG
FT                   RVAKDFASTLAESEEIAKSSMVGDADPHALVQALAQTELAVEAAVRVRNKVVEAYQEIL
FT                   RMPV"
FT   gene            254846..255115
FT                   /gene="fliQ"
FT                   /locus_tag="RD1_0256"
FT   CDS_pept        254846..255115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="RD1_0256"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29982"
FT                   /db_xref="GOA:Q16DG1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG1"
FT                   /protein_id="ABG29982.1"
FT                   /translation="MADQIIFFDTLRHGLWIAVLISIPVLTAALVTGVSIGLVQALTSI
FT                   QEMTLTFVPKLAAIVLVFWMSMGFMTQTLVSFFHEQIIPLIVGG"
FT   gene            255118..255831
FT                   /gene="flgF"
FT                   /locus_tag="RD1_0257"
FT   CDS_pept        255118..255831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="RD1_0257"
FT                   /product="flagellar basal-body rod protein FlgF, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29983"
FT                   /db_xref="GOA:Q16DG0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DG0"
FT                   /protein_id="ABG29983.1"
FT                   /translation="MENSGYTTITRQSGLMKEMRVVANNIANAATSGFRQEGVIFSEYV
FT                   KSVDGASSLSMGQADARQTSFAQGALTQTGGQFDFAIEGDGFFLVETPLGERLTRAGAF
FT                   SPNADGDLVTPDGYRVLDAGGAPVFIPPGAADIAVSADGTISTNGDPVGQLGLVQPRNP
FT                   QGLVREDGVMFRADEGYEAAEQGRILQSFVENSNVNPILQLTRMIEVQRAYELGASFVE
FT                   AEDERVRQAMRTMSQ"
FT   gene            255861..256646
FT                   /gene="flgG"
FT                   /locus_tag="RD1_0258"
FT   CDS_pept        255861..256646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="RD1_0258"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29984"
FT                   /db_xref="GOA:Q16DF9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF9"
FT                   /protein_id="ABG29984.1"
FT                   /translation="MRALKIAATGMSAQQMRVETISNNLSNMSTTGYNARRAEFADLHY
FT                   QQMSRPGTVNATDGTVLPTGVQLGLGVRPSAVSVQLQQGSLSATGGDLDLAIEGTGFLE
FT                   VTLPSGQTAYTRDGGLKRDAEGLIVTSDGYPVEPEIVIPDDARSISINTSGEVFAYFSD
FT                   ATDAELLGQFNLAGFTNAKGLEALGGNLFAETEASGAAIVSTPGEDGLGTVRQGYLESS
FT                   SVDAVREITELIEAQRGYEMNAKVISAADQMMGATTQIR"
FT   gene            256643..257065
FT                   /gene="flgA"
FT                   /locus_tag="RD1_0259"
FT   CDS_pept        256643..257065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="RD1_0259"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29985"
FT                   /db_xref="GOA:Q16DF8"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF8"
FT                   /protein_id="ABG29985.1"
FT                   /translation="MIRLALISWLMCLPLALFAEVVVPAKTIRANATITASDITLKPIQ
FT                   NENAYTLMADVVGQEARTTLYAGRPILFDDIGPPAIVSRNQIVLLSYQSSGLKILTEGR
FT                   ALQRGGVGDRVRIMNLDSRATLFGQVQADGSVRVSN"
FT   gene            257075..257806
FT                   /gene="flgH"
FT                   /locus_tag="RD1_0260"
FT   CDS_pept        257075..257806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="RD1_0260"
FT                   /product="flagellar L-ring protein FlgH, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29986"
FT                   /db_xref="GOA:Q16DF7"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF7"
FT                   /protein_id="ABG29986.1"
FT                   /translation="MKNVFLCVMTAALVMSGCARLDHLGKPPSFSPASATKEHTAMLSP
FT                   GLPLRVDTSTPTDDASLWSGARQSLFGDRRAVQQGDILTVVIEIDEEAEISNATDRSRS
FT                   GSESLGIPSLFGLPQRIDRELPTGATLSDAVSINSSSNSSGDGSVKRNEKLTLRVAATI
FT                   VDVLPNGVLSIAGSQELRVNFEMRELLVSGYVRPEDISRKNEITYDKIATARVSYGGRG
FT                   QITDVQQPRWGQQALDIVLPY"
FT   gene            257816..258316
FT                   /locus_tag="RD1_0261"
FT   CDS_pept        257816..258316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29987"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF6"
FT                   /protein_id="ABG29987.1"
FT                   /translation="MKKILPVLMLLLGSAAGVGAGVYLRPPPTEEAAAPEETAEEGSAA
FT                   TEKEEAQDDLPIAGKEYVKLSNQFVVPIVEKDRVSSMIVMTLSVEAPQGQGEVIYDLEP
FT                   KIRDVFLRILFDHAAIGGFRGAFINNENLDVVRRNLRDGAIKTFGEDLISDVLIFEIAR
FT                   QDY"
FT   gene            258378..258602
FT                   /locus_tag="RD1_0262"
FT   CDS_pept        258378..258602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0262"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29988"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF5"
FT                   /protein_id="ABG29988.1"
FT                   /translation="MGTSIYSDDFTRDAVHGITVRGNPVWEASELLTDSAHSPFKWISR
FT                   FGETVRQAISIEQQAMNRHLQRELAGVTR"
FT   gene            258705..258971
FT                   /locus_tag="RD1_0263"
FT   CDS_pept        258705..258971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0263"
FT                   /product="inverted repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29989"
FT                   /db_xref="GOA:Q16DF4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF4"
FT                   /protein_id="ABG29989.1"
FT                   /translation="MKKSRFSEEQIIGILKEHQAGLGARELCRKHGISDATFYKWRSKY
FT                   GGMKVSDARRLKTLESENATLKKMLAEQMMDVATLKEMLGKNL"
FT   gene            259000..259518
FT                   /locus_tag="RD1_0264"
FT   CDS_pept        259000..259518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0264"
FT                   /product="integrase, catalytic domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29990"
FT                   /db_xref="GOA:Q16DF3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF3"
FT                   /protein_id="ABG29990.1"
FT                   /translation="MGDDDQNQRWSLDFMLDAHEDGRRYRVLNVIDDFSQECLAAVVDT
FT                   SIDGAHVARELDRIAELRGYPCLVVSDNGAELTSNVMLKWQEDRKVDWHYIAPGKPMQN
FT                   GLVESFNARMSEECLNEHLFPSLRHARHMIAARRAGYNHQRPHSSLDGLTPWEYHQRSR
FT                   EDQNLNRAN"
FT   gene            complement(259899..260636)
FT                   /gene="fliP"
FT                   /locus_tag="RD1_0265"
FT   CDS_pept        complement(259899..260636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="RD1_0265"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29991"
FT                   /db_xref="GOA:Q16DF2"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF2"
FT                   /protein_id="ABG29991.1"
FT                   /translation="MKMTRITLLAVVLIGLFTPSVSLAQDLSISLGDDGSLSARTIQLF
FT                   ILITVLSLAPGLAIMITCFPFLVTVLSILRQAIGLQQSPPNMLIVSLALFLTYFIMEPV
FT                   FQAAWQNGIQPLTDNAIDAETAFVRTLEPFRIFMAGRLDPDTFFAMAELRSETIDAAPT
FT                   AEAPLSVLVPSFLLSEISRAFQIGFLVFLPFLIIDLVVAAVLMSMGMMMVPPVIVSLPF
FT                   KLAFFVLADGWNLIAGSLVQSYF"
FT   gene            complement(260633..260926)
FT                   /gene="fliN"
FT                   /locus_tag="RD1_0266"
FT   CDS_pept        complement(260633..260926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="RD1_0266"
FT                   /product="flagellar motor switch protein FliN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29992"
FT                   /db_xref="GOA:Q16DF1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF1"
FT                   /protein_id="ABG29992.1"
FT                   /translation="MDDGPMESVGGLDANNPFTSVPIEVTVCVGKARPLIRDLVTLGEN
FT                   AVLSLDKSVEDPVDLYIGDRLIARGMLEEKDDDQSGQLIVRLTEVIDLKSGL"
FT   gene            complement(260919..261518)
FT                   /locus_tag="RD1_0267"
FT   CDS_pept        complement(260919..261518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0267"
FT                   /product="ABC transporter, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29993"
FT                   /db_xref="GOA:Q16DF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DF0"
FT                   /protein_id="ABG29993.1"
FT                   /translation="MAVSHRYKNFADAKQTSPDKLNSNSEAVEDQKLQAFEAGYQAGWD
FT                   DATKAQTDEKERITAELGQNLIDMKFTYQEALSELTVSIEPVMKAIVEKLFPEAMRAAL
FT                   SAHILDQVASMVDAKTDRSIEVVVSTGNVERVTNLIGSTSEQPMNVIAEPTLADGQAFV
FT                   RLGETERQIDLNSLMEGVSKAIEAFFHEAHRESDNG"
FT   gene            complement(261518..263140)
FT                   /gene="fliF"
FT                   /locus_tag="RD1_0268"
FT   CDS_pept        complement(261518..263140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="RD1_0268"
FT                   /product="flagellar M-ring protein FliF, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29994"
FT                   /db_xref="GOA:Q16DE9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE9"
FT                   /protein_id="ABG29994.1"
FT                   /translation="MQQIVTAWTGLPLRRQVIVALATGAMFFAILAMSRMATAPNMTLL
FT                   YAGLENGAAGDVVAALEQRGAVFEVRGGSIFVDSSQRDELRMTLASEGLPANSTQGYEL
FT                   LDTLSGFGTTSQMFDAAYWRAKEGELARTIVSSPHISMARVHIASTGSNPFQRGVTPKA
FT                   SVSVTPSGAAITPQQGKAIRFLVSSAVAGLASEDVAVIDANGALIGNADEVAPTIGGED
FT                   KADVLKARVQRLLEARVGFGNSVVEVSVDTVTESEAIRERIFDPESRVAISTDTEERNT
FT                   SSSEAGGGDVTVASNLPDQDGAGGENSSSQNNETRERVNYEVSETEREILREPGAIKRV
FT                   TVAVLVNEMTITDEAGQETVTPRDESELEALRDLVASAVGFDEARGDIITIKSMGLQSV
FT                   PLQGTAAGTSLMSNFNIDVMSAIQMAILALVTLILGLFVVRPLLARNDLNDAPAVAALP
FT                   GATDGETDGLGLDGEIDGDDFQLPDLPVISDFGDASGELPDLNIGSGMSEDPVDRLRTM
FT                   IGERQDETVEILRSWLEDKEESV"
FT   gene            263263..263754
FT                   /gene="fliL"
FT                   /locus_tag="RD1_0270"
FT   CDS_pept        263263..263754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="RD1_0270"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29995"
FT                   /db_xref="GOA:Q16DE8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE8"
FT                   /protein_id="ABG29995.1"
FT                   /translation="MTDATNEESAEAPKSGKLPLIVGAVLAIIGGGGGFYAASSGMIFA
FT                   TESKKETVEEEKETSNEFSDISFLPLEPMTISMPRDSAYKHLRFRGELEVPKEYAEDIK
FT                   KVTPRIIDVLNGYLRALQVADIEEPASLTRLRSQMLRRIQIVAGPGRVNDLLIMEFVLN
FT                   "
FT   gene            263765..264133
FT                   /locus_tag="RD1_0271"
FT   CDS_pept        263765..264133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0271"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29996"
FT                   /db_xref="GOA:Q16DE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE7"
FT                   /protein_id="ABG29996.1"
FT                   /translation="MDVIADIFLAAGAFGAGIYCYILGRRLNKFNDLEKGVGGAVAVLS
FT                   AQVDDLTKTLAAAQSTASVSAETLTQLTVRAEAMSQRLELQMASLHDIPPQESTVAAAE
FT                   TSKVQQTTAEPMFIRHRA"
FT   gene            264145..264738
FT                   /locus_tag="RD1_0272"
FT   CDS_pept        264145..264738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29997"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE6"
FT                   /protein_id="ABG29997.1"
FT                   /translation="MKINMLRRNGRGSVLLICCLLIGSAAIRIGSEAGKAVATENPFPA
FT                   PAISEAKEESAGSEETKADFSKMLIAFQEREARIERLERQIDRRQKALEVADAEIEKRL
FT                   QVLQDAENALRSMLAIADTAAEDDVVRLTSVYENMKPKVAAALFEEMEPAFAAGFLGRM
FT                   RPDAAAGIMSGLTPNKAYTISVILAGRNAEAPKG"
FT   gene            264805..265674
FT                   /gene="motA"
FT                   /locus_tag="RD1_0273"
FT   CDS_pept        264805..265674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="RD1_0273"
FT                   /product="chemotaxis MotA protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29998"
FT                   /db_xref="GOA:Q16DE5"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE5"
FT                   /protein_id="ABG29998.1"
FT                   /translation="MIGIIGIITVFAMVFGGYLAAGGKMGIIFKALPFEMTMIGGAAVG
FT                   AFLISNDMSAIKHTMRDLGRVFKGPKWSHEDYKDLLCLLFELIRLARQNPVAIEEHIEA
FT                   PEESSIFSKYEKILKDKEAVALICDTLRSASMNYDDPHQVEEVLEKRMEANMHHAMHSS
FT                   HALQTVADGLPALGIVAAVLGIIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGFVG
FT                   PFAAKVKSVTEEDGHFYQLIREVLVANLHAHATNICIEVGRQNTPSHHRPSFAELEEAL
FT                   KSVKQNAA"
FT   gene            265671..267926
FT                   /locus_tag="RD1_0274"
FT   CDS_pept        265671..267926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG29999"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE4"
FT                   /protein_id="ABG29999.1"
FT                   /translation="MRKLTLLIFVAVLFPLRLMAEPIVVRSGEHNTFTRLVMQLPTDVE
FT                   WSIAQAEKNPILKLENYDGGFDLSVAFEIIPRTRLQALVAKASQLELQLACNCVVDAFL
FT                   EQNSFLVIDITNSDRPVLEDVVDAGSETEAISIPASGFSYGELLWSQSDQQIAQSSESV
FT                   VQDGSSEAGIVTDEQSLSMESELVSETQERLLAAFSSAASRGILTPKPDVSISNPPRNA
FT                   ETPPAEIFDSSEQIPIIATPLAGNMRISNSSDIPESGLERDTVASSPVCMDPAVVDVAS
FT                   WGHEEDMGKQIGTSVLGLYDPSGRLMPEKVLAHARLQLYFGLGQEAKQTLEMAPSLKAQ
FT                   YPELLDIASVLEFGHAQNPRSLHRFADCDSDLALWALLAASEIPPDQTVNALAALRGLD
FT                   KLPSHLKSFLAQKVSERLAARGDVANASIALRSYQRLTDGDDEPRLVHAELADLRNEAA
FT                   QAEAVINDIVNSETSETAEAIIELIDRQVAAQTPVEADVALLAETYALELRNSEKGPVM
FT                   LRAFVLAAASSGQYTKAFETLDTQNSALDVQTRTELTSFAFTELADGATDIDFLEAYFD
FT                   LFSGKKDDLNQKAIVATAQRLFDLGFHTEAASVLLNRPIEPLSPDARLLKSRLALLEND
FT                   YQQSYDLISDLNGTDAALIKGQAMQGLGKPEIAAQYFSVAEAETDARDSAWLSDDWNNL
FT                   LTEDDMVFGQLRAIVNEPTDRIPQNNEMINNSNQAIASSANARLTLEGLLTELEVQN"
FT   gene            268321..268422
FT                   /locus_tag="RD1_0275"
FT   CDS_pept        268321..268422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30000"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE3"
FT                   /protein_id="ABG30000.1"
FT                   /translation="MARETTDQRRCSDFVSDALLNDQRFHVLCIMED"
FT   gene            268503..268964
FT                   /locus_tag="RD1_0276"
FT   CDS_pept        268503..268964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0276"
FT                   /product="integrase, catalytic domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30001"
FT                   /db_xref="GOA:Q16DE2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE2"
FT                   /protein_id="ABG30001.1"
FT                   /translation="MRKRGTRRPIGLPETIHQWWRPGFVSDAFTPSHPLRRKRLPGNGW
FT                   PEVPCSGHHRRLQPGVFGACARQVTVWRAADTRAGSDHSAARNWYQYAKVDWHCIAVGK
FT                   PPQNGFVESFYGRMRDDFLNQHLFSSLADARSEIAKCKDDHNQNQPTPR"
FT   gene            complement(269452..270537)
FT                   /locus_tag="RD1_0277"
FT   CDS_pept        complement(269452..270537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0277"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30002"
FT                   /db_xref="GOA:Q16DE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE1"
FT                   /protein_id="ABG30002.1"
FT                   /translation="MTDAPPLVRIEGISKSFGNTVALDNLTLDIARGEFVTFLGPSGCG
FT                   KSTTLRILGGFERPDKGRVILDGEDVTTQPPEKRHVNMVFQDYALFPHMTVRQNISFGL
FT                   ELKGMDKANIKRRQDEIMAFLELDGFGDRYPGQLSGGQRQRVALARALAPDPALLLLDE
FT                   PLGALDAKLRGQVQQELKSIQQRTHKTFFFVTHDQEEALTMSDRIVVMNKGRVEQDGTP
FT                   EELYFHPATRFVAEFIGETNLLSGQMRARDGDRIVMDWFGHTLSGQAPAGPLQTGDAIT
FT                   ASVRLEKLGFHTTRPNAANAVQGKVVGKTFLGSRMALDLVIEETEGAVLRAFVDAETGQ
FT                   AVGADPIWIGWDSDSMAVLQD"
FT   gene            complement(270534..271325)
FT                   /locus_tag="RD1_0278"
FT   CDS_pept        complement(270534..271325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0278"
FT                   /product="spermidine-ABC transporter, permease component,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30003"
FT                   /db_xref="GOA:Q16DE0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DE0"
FT                   /protein_id="ABG30003.1"
FT                   /translation="MRRGNRILLSCIYWAFVLYVFVPLLLMILMGFKDSKFIGFPIRSW
FT                   TLDWYMGVFVDAELLSTLGYSVTIAILSTLISVVVGTWIAVLLEGRKFIGRAAVFGLTL
FT                   LPALVPGIISAIAFRIYARWLGIEPGMGAIIWAHAVHNVPFVVLVVMARLSTLPKSQIE
FT                   AARDLGADPIIAFLRITVPYLIPAILGASIFCLLLSFDDFVRSFFLGGYEPTLPVLIFA
FT                   MLRSGMSPEINAIATVALVLTAAIGIWAERFTRRMNRDTNP"
FT   gene            complement(271322..272299)
FT                   /gene="potB"
FT                   /locus_tag="RD1_0279"
FT   CDS_pept        complement(271322..272299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="RD1_0279"
FT                   /product="spermidine/putrescine transport system, permease
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30004"
FT                   /db_xref="GOA:Q16DD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD9"
FT                   /protein_id="ABG30004.1"
FT                   /translation="MRNEAAAQGSIPQNGADRTFWGRLSGWTAYRTVMGIATASPRRQF
FT                   LILAAFPILWVLTQHLGPMVQMLRVSLMDAYPVAPGVEQSFTLDNYARFFGDQIFWQPF
FT                   FRTLSFAAVFTFCTLILTYPVAYFLARHVSRKNRMLLLLLLLIPFWVGEIVRTYAIMIL
FT                   LGNTGAVNLVLQWFGLIDRPIPFMYTSFSMGVGIVYLTALYMLLPLYSALEKLPDSYNE
FT                   AAADLGAGAWTRFRRVTLPLTLEGISSGCTLVFLISTGFYATPVLLGGPSTTVFAQTIA
FT                   GFFHVAGDEWPTGAAFATIMFAGAIVLTAVFQKLMYALRKGDTK"
FT   gene            complement(272377..273483)
FT                   /gene="potD"
FT                   /locus_tag="RD1_0280"
FT   CDS_pept        complement(272377..273483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="RD1_0280"
FT                   /product="spermidine/putrescine-binding periplasmic
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30005"
FT                   /db_xref="GOA:Q16DD8"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD8"
FT                   /protein_id="ABG30005.1"
FT                   /translation="MTKLIYDRRRFLGTAAMTGVALASPAYLRRASASGGEVNIWTYND
FT                   FVPAAFKDQFEAETGIKVNVRLVDDQGKQFNLLAAEAPNPTVDIMTVAGHRFLQFIDSE
FT                   LLAPLDTDRLANWGNINPTFSESDWATINGNKWGAPILSGMEVLSYNTELVSPEEVTSW
FT                   DALFSEKFKGQTAYIIQDMMSIIMLKMGYDGNMVAYMDDPEKAAAIVEEAKQFLIEHKP
FT                   LVRKYYDSGAEIQQMFVNQDIALGHSWNGPAAALINDGFPLAMTIPEEGSYGFVYTYNI
FT                   ANNAPNVDNAYTFINAILASPEIGAAMTRASGFISTYKDASNYLTDLEKKSTAFPDEEL
FT                   ARLQFFRAEANKMKYELVDPAVEAIKAA"
FT   gene            complement(273528..274634)
FT                   /locus_tag="RD1_0281"
FT   CDS_pept        complement(273528..274634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0281"
FT                   /product="dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30006"
FT                   /db_xref="GOA:Q16DD7"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD7"
FT                   /protein_id="ABG30006.1"
FT                   /translation="MSDAVRIGIAGAGSVAFGTAALLHQQGHDPMLWSPSGAGTEALKS
FT                   APLRASGAIEATFEPRIAGSAAELARDNDILLLALPAYGHKAVMDALVPHIRDGQHVII
FT                   SSHASLGAVYLMQLLAARGIKAPITAWGTTVVTGRRQTGSAVQVNTVRKRVDLCTVPDT
FT                   QSDRALDACKRLFGDRFQPRDGLLAISLSNLNPQNHMGIALGNITRMERGETWSQGQNV
FT                   TPTIGRLLEQLDLERLAIAEALGLQVKTIFEHFHLSFHVPVASISEMNQQMHAQGNGGT
FT                   GPATADSRYVTEDVPYGLQLTAVLGQLAGTPAPLHEAGIAIFSAMYGRDFSKENALLAA
FT                   LELENFTLDDLTQAARTGLLGTAPSVPQ"
FT   gene            complement(274631..275218)
FT                   /locus_tag="RD1_0282"
FT   CDS_pept        complement(274631..275218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30007"
FT                   /db_xref="GOA:Q16DD6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD6"
FT                   /protein_id="ABG30007.1"
FT                   /translation="MARVIHKFTRNVPHWQPRLTPVKLAEATPEQLEALQVTPSNTKVS
FT                   DYVLTLAHDVESLKVRSPLFNAIMYDAGGLSRSERELGALAASMVNRCIYCAAVHADRH
FT                   AKIEKDTTTTDALFAAGEKADLNPRDRAIFDFARKSAEAPPTAGAADMEALRQVGLSDA
FT                   EILDLILSAALFGWANRLMHVLGDPVRKTEDA"
FT   gene            complement(275218..275697)
FT                   /locus_tag="RD1_0283"
FT   CDS_pept        complement(275218..275697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30008"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD5"
FT                   /protein_id="ABG30008.1"
FT                   /translation="MSIFETTSLRVAGVEVDGKTAKAISGRHNIIEMTQAAEDAVLRPR
FT                   DSGAFGHNLRAALAARVARLAQDDVLASHYLARAGDKAALADPTETGAAQGLSAVLAFI
FT                   DKVANQTRDIAAEDVSGLQAAGVEDADIVRLCELVAFLAYQTRLIAGLRLMQGAA"
FT   gene            complement(275694..277133)
FT                   /locus_tag="RD1_0284"
FT   CDS_pept        complement(275694..277133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0284"
FT                   /product="oxidoreductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30009"
FT                   /db_xref="GOA:Q16DD4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD4"
FT                   /protein_id="ABG30009.1"
FT                   /translation="MGLPALEGRLKEDLAFLCYPGKAWVPKREGVTDVVIIGGGMCGMV
FT                   AWFGLATGGIRNVRVLDRAETGREGPWLSYARMETLRSPKMLTGPAFGHGALTFQAWYR
FT                   AQFGAAAWEALDKIPRPMWMEYLQWYRTVLEVPVENGISVDHVEPEGDLLRLTVTGAET
FT                   PTILTRKLIFATGRDGTGGPNIPDFIKNLPGHLWAHSADEIDFTRLAGKRVAVIGVGAS
FT                   AVDNAAEALEHGAAEVRHLIRRKEMPTINKMMGIGSFGFTAGFADLPDEWRWRFMQYSF
FT                   ATQTPPPHGSTLRVSRHDNAYFHFGKATTRVDPQGDGAIIHFADGTFYEADFVILGTGF
FT                   VIDPMARREFGKTAGDILLWQDVYTPPEDEQSGDLGRFPYLNPDFTFREKQPGTAPWLA
FT                   NVYCFNYGASASLGKVSGDIPGISEGAAWLSRAVAAELYAEDIEAHWEGMQAYDTPELR
FT                   GDEWEATPLEIQPEPQKGRVA"
FT   gene            complement(277202..278539)
FT                   /locus_tag="RD1_0285"
FT   CDS_pept        complement(277202..278539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0285"
FT                   /product="NreB protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30010"
FT                   /db_xref="GOA:Q16DD3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD3"
FT                   /protein_id="ABG30010.1"
FT                   /translation="MSSPLSSPTFRRLFTAQICSLIGVGLLTVALSLAAFRIGGAAAGG
FT                   QILGLLLALKMVAYVLLAPLAETLLSGVSRKRAMVSLDVGRMLLLLPMAFVSQPWLVAL
FT                   LAFGFFVLSAGFTPLFQSVIPDILPEEATYTKALAWSRVAYTMEAVMSPVIAAAMLKIV
FT                   TGESLFYAAALAFAGSVLALLLARLPQFRDAAREGPFLKRVGHGFWIYRRTPRLRGLFL
FT                   LNLSLSLSMAWVLVNSVVYAGARLGDSEHYFPILMACYGAGAALGAVIVPKLLTRMSER
FT                   SAMIIGALGFAAVGALFAVLPAVPMPYLGAVWVAFGVASSLVLTPGGLVITRSAAQKDR
FT                   ASVFAAQFSASHAGWLVAYPLAGWLGSLLSLETALLSLASLSTVLVLVALRVWPADDPV
FT                   DLAHCHPELPDDHPHLEQVPASGAQHRHIHAFRIDELHPIWTERSI"
FT   gene            278721..279437
FT                   /locus_tag="RD1_0286"
FT   CDS_pept        278721..279437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0286"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30011"
FT                   /db_xref="GOA:Q16DD2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD2"
FT                   /protein_id="ABG30011.1"
FT                   /translation="MTQEHGHSPTEVARRLSAGQRAGHLKDMIYGGIDGAVTTFAIVAG
FT                   VAGAGLSHHIIVALGVANIIADGFSMAASNYSGTKAELDDRKRIIQVEERHIEQHPDGE
FT                   LEELRQILQMRGLSGDVLEEATTAISQSKTNWIDMMLTDEYGLSRVEPEPMKAALATFA
FT                   AFLVAGSIPLIPFLLNLDDAFSISIFATLLTFFLIGTGKSRWSLSKWWKSGFETLLIGG
FT                   VAALLAFSVGSLFHPG"
FT   gene            complement(279456..280064)
FT                   /locus_tag="RD1_0287"
FT   CDS_pept        complement(279456..280064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0287"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30012"
FT                   /db_xref="GOA:Q16DD1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD1"
FT                   /protein_id="ABG30012.1"
FT                   /translation="MIDVDRTGDIWTVTLNRPEKANSLTEQMLVDLRDTMRAAQAARAV
FT                   ILSGSGKVFSAGADLEAARAGLATSPLWEEVSQAVASLPGLSVAALNGTLAGGAFGMAL
FT                   ACDLRIAVPGANFFYPVMKLGFLPQPSDPGRLAALIGPSRAKLILMGGQKIAADEALAF
FT                   GLIDRIVAPDDLMAVAQTLVADTVAADSAIATGIKDMCR"
FT   gene            complement(280061..280810)
FT                   /locus_tag="RD1_0288"
FT   CDS_pept        complement(280061..280810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0288"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30013"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DD0"
FT                   /protein_id="ABG30013.1"
FT                   /translation="MNMTGKTVMITGASRGIGAEAARVFAQAGANVALLARSQQQIADL
FT                   AGEIGERAVAIPCNVARYSDMAKAVAATQEMFGSLDVLINNAGVIEPISHLAEAEPDAW
FT                   ADVVDVNLKGVFNGMHAALQVMKPAGGGTIITISSGAAHGPVEAWSHYCTSKAGAHMLT
FT                   RCLDHEESQHGIRAMGLSPGTVATQMQREIKSSGINPISQLEWEVHIPADWPARALLWM
FT                   CSPEADEWCGREISLRDEDIRRKVGLT"
FT   gene            280944..282452
FT                   /locus_tag="RD1_0289"
FT   CDS_pept        280944..282452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0289"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30014"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC9"
FT                   /protein_id="ABG30014.1"
FT                   /translation="MPRITRHFMASTALVLIAPAAFAELSADDVWSDWKTYISGLGYSV
FT                   TGQEARAGDVLTVTGVAITSGDASLGGGRISMDRIVLTERDDGTVTVALPTVMPFEMAT
FT                   PNDTGSTTRVSADYRQTGLSIVASGTPNDLQYEYSAQTISLESTGFEVNGQVLPAQSNA
FT                   FVITLDDISGTTDMVLDAHRRYTQDLEIGAARYALKATDAASGGSSDMSGQMQSLTFDG
FT                   QSTLPLRAVDTNDLEAMLAAGFTAGGTFGFAANALTLNVTSPTGPSDASVIGQSGRIGV
FT                   TLGQDGLTYDVAQDDMQVEMTSPQFPLPINFNVAQTAMNIAMPIRKSEAPDDFALGFTL
FT                   DGFTMSDMLWGLFDPGGQLPRDPATIALDLAGKARLMFNFLDPSVAAEIDPGTAPAEID
FT                   KLDINRVQITVAGAELVGNGAFEFDNSAEGAPKPAGAVDLTLTGANGLIDKLVAGGLLP
FT                   EEQAMGARMMMGLLAVPGNAPDTLNSKIEINDQGHVMANGQRIQ"
FT   gene            282483..283883
FT                   /gene="pmbA"
FT                   /locus_tag="RD1_0290"
FT   CDS_pept        282483..283883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="RD1_0290"
FT                   /product="PmbA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30015"
FT                   /db_xref="GOA:Q16DC8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC8"
FT                   /protein_id="ABG30015.1"
FT                   /translation="MQRGSEAATSTPPLTEHMMTQALSDLNEQLLQAARRAGADDADAM
FT                   AVRGTSLGIEVRHGALEQAERSEGIDIGLRVFLGRRSAIVSASDTRSDTLKDMAERAVA
FT                   MAKEAPEDPCAGLANADQITQGYHIAALELYDPTPEPSPAALQEDAARAEAAALGNPQV
FT                   SQVQSASAGYSSREVHFAATNGFRGGYARTDRGLSCVAICGTGTEMERDYDSDSRIFQS
FT                   DLRSPEDIGTRAAARAVERAGARKPPTGSYPVLFDERVSSTLIGHLLMAANGSSVARGA
FT                   SWLRDAKGEQVLPSGISLHELPHRPRTSGSRPFDAEGLPTKARDIVADGVLTGWTMDLA
FT                   TARKLGMSSTGNAARSASSGPSPTSWNVTLTQGDQSRADLIADMGTGLLVTSMIGSTIN
FT                   SNTGDYSRGAAGIWIENGEMTYAVNECTIAGNLRDMLLNIVPANDARAHLSRVVPSLLV
FT                   PGMTLAGV"
FT   gene            283870..284664
FT                   /locus_tag="RD1_0291"
FT   CDS_pept        283870..284664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0291"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30016"
FT                   /db_xref="GOA:Q16DC7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC7"
FT                   /protein_id="ABG30016.1"
FT                   /translation="MQASDLDLITDAIVMAGRVATSFTGQSTQSWDKPGGAGPVTEADL
FT                   AVNTYLETVLRLARPDYGWLSEESEDTGDRLSRDTVFIIDPIDGTRSFVDGSSTWAHSV
FT                   AISHKGRITAGAVYLPLRGLLYTAARGKGAMLNGAPITVSAKDDLENADVLAAKPMIAP
FT                   DHWPNGVPGFNRSHRPSLAYRLALVGQGRFDAMLTFRPTWEWDVAAGSLIVEEAQGTST
FT                   DKGGKPLLFNNRDPRLNGMVASGKPLHYSLMQALAREGGSGA"
FT   gene            284674..284967
FT                   /locus_tag="RD1_0292"
FT   CDS_pept        284674..284967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30017"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC6"
FT                   /protein_id="ABG30017.1"
FT                   /translation="MDRQRCSHSLFVLRTACMAQRLHLVFGGELVDPGKNTFKNVDDLH
FT                   IVGIFPDYASAFDAWKAEAQRTVDNAHMRYFIAHIHRLRDEETAASSTEELE"
FT   gene            284974..286221
FT                   /locus_tag="RD1_0293"
FT   CDS_pept        284974..286221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0293"
FT                   /product="3-deoxy-D-manno-octulosonic-acid"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30018"
FT                   /db_xref="GOA:Q16DC5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC5"
FT                   /protein_id="ABG30018.1"
FT                   /translation="MARSIGLTAYRALSKRSTERAYKPRGKRPRGTLVWIHAGEPQNML
FT                   AVQDLAQRLCNTRFGVHVLITLPDPASYEETLQSWVPHDLIQIEQVPSEHPHAVTSFWR
FT                   HWMPEVAIWAWGGLRPNLVDQVHQSGCPIALIDADAAGFDGKRERWLPELSRQLLEPFV
FT                   AIMVRSNAAVQKLQTLGIESARIDRKPPLQAGGNALACRDSDLADLTETLRGRPVWLAN
FT                   NIQEEELPVILQAHRQSLRLSHRLLLVLHPAHGGLSDGFAEKIATDDLRHADWTAGEDP
FT                   DDASQVLLTEDHGDLGLFYRVAPVTFMGSSLVSGYSGRNPFEAAALGSAVLYGPHVSRF
FT                   MPFYSRLAKAGAARIVKDVETLGAAVTQLIAPDQAAAMAHAGWDVVSEGADVTDRVIDL
FT                   VQAALDGELETAHARA"
FT   gene            286208..287203
FT                   /gene="lpxK"
FT                   /locus_tag="RD1_0294"
FT   CDS_pept        286208..287203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="RD1_0294"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30019"
FT                   /db_xref="GOA:Q16DC4"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DC4"
FT                   /protein_id="ABG30019.1"
FT                   /translation="MRAPDFWYTPPQAPALLARLLQPFGKIYGMATARRLAKGTPVKLD
FT                   VPVICVGNLNAGGTGKTPTVIAVLTTLMDMLETPHVVTRGYGGSLKGPVRVDPSKHTAK
FT                   QVGDEPLLLAAFAEVWVARDRAAGCAAAAQGGASVVVLDDGFQNPSVHKDFSLIVVDAE
FT                   KGFGNGRCLPAGPLREPVDIGLKRADALLSVGAAEAQARFDSSTLPTDLPHIRGALTPL
FT                   QTGMDWSDMRAIAFAGIAHPEKFFATLRALGANVVHSEPLDDHQPLSTALMSRLEADAK
FT                   RQNAQLVTTEKDAARLPNSFRTKVITLPVRLSFDGQENALADLLRPVVKS"
FT   gene            complement(287267..287938)
FT                   /gene="bdbD"
FT                   /locus_tag="RD1_0295"
FT   CDS_pept        complement(287267..287938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdbD"
FT                   /locus_tag="RD1_0295"
FT                   /product="thiol-disulfide oxidoreductase D, Putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30020"
FT                   /db_xref="GOA:Q16DC3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC3"
FT                   /protein_id="ABG30020.1"
FT                   /translation="MSRMMIISAAVAVIGLGAYFVTSPGTNPVTPANPLGAANAQEAAD
FT                   IDTSSIMDMTLGNPDAPVTVIEYASYTCPHCARFHEGPFKQLKADYIDTGKINFVYREV
FT                   YFDRYGLWASMIARCAGTPESFFGMSDLIYQKQSEWSRAGDPAAIVDELRKVGLLAGLD
FT                   RDTMEACLQNGEKAQTLVAWYQENATADGIESTPSFLINGQRYSNMSYAEMAELIDAAA
FT                   E"
FT   gene            complement(287952..288461)
FT                   /locus_tag="RD1_0296"
FT   CDS_pept        complement(287952..288461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30021"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC2"
FT                   /protein_id="ABG30021.1"
FT                   /translation="MPPRRASTKGFTRTSSLLTQRIRTASESRGFAQSRLLTHWSEVAG
FT                   EEMARISRPVEVSYGRGGLGATLTLLTTGANAPMLEMEKEKLRARVNAVYGYNAIARVR
FT                   VTQTAATGFAEGQVDFMLGDAKSKTAPIDPALRQKAADTVQPVADEGLRSALALLGENI
FT                   LNKTNR"
FT   gene            288546..289613
FT                   /gene="mutY"
FT                   /locus_tag="RD1_0297"
FT   CDS_pept        288546..289613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="RD1_0297"
FT                   /product="A/G-specific adenine glycosylase, putative"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30022"
FT                   /db_xref="GOA:Q16DC1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC1"
FT                   /protein_id="ABG30022.1"
FT                   /translation="MRENPDDPQVLSDAILAWYDVHARDMPWRVPPQARRAGQTPDPYR
FT                   IWLSEVMLQQTTVATVKSYFERFTARWPTVRDLAAAQDADVMAEWAGLGYYARARNLLK
FT                   CARTVDQDYGGTFPADHAELLKLPGIGPYTAAAIASIAFDLRHTVLDGNVERVMARLHD
FT                   IHVPLPASKPILMEKADALTPVDRPGDYAQAVMDLGATICTPKSPACGICPWRDPCAAR
FT                   AEGTAADLPKKTPKKAKPTRHGTVFLAQRADGAWLLETRPDKGLLGGMLGWPGSDWIDV
FT                   SHPLPEAPPPCAAEWQLIDGEVRHTFTHFHLILHVFRAQVAIGTEPETGGFRDAAEFKP
FT                   TDLPTVMRKAFDLAR"
FT   gene            complement(289727..290821)
FT                   /gene="ccrM"
FT                   /locus_tag="RD1_0298"
FT   CDS_pept        complement(289727..290821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrM"
FT                   /locus_tag="RD1_0298"
FT                   /product="modification methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30023"
FT                   /db_xref="GOA:Q16DC0"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DC0"
FT                   /protein_id="ABG30023.1"
FT                   /translation="MTKTKGAAALPLNTIIDGDCIEVMNGLPEASVDLIFADPPYNLQL
FT                   KGDLHRPDNSRVDAVDDEWDQFSSFKAYDNFTKAWLKAARRILKPDGAIWVIGSYHNIF
FT                   RVGAELQNQGYWILNDVVWRKSNPMPNFRGKRFTNAHETMIWAGRDESSKYTFNYEALK
FT                   ALNEGIQMRSDWVLPICTGHERLKDENGDKAHPTQKPESLLHRVLVGATNPGDVILDPF
FT                   FGTGTTGAVAKMLGRDFIGIEREAAYRKVAEKRIAKVRKFDREALQVSVSKRAEPRVPF
FT                   GQLVERGMLRPGEALYSPRGQVAKVRADGTLIGNDVKGSIHQVGAHLEGAPSCNGWTYW
FT                   TFKQDGKKIPIDVLRQQIRSEMSG"
FT   gene            complement(290914..291510)
FT                   /gene="rnhB"
FT                   /locus_tag="RD1_0300"
FT   CDS_pept        complement(290914..291510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="RD1_0300"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30024"
FT                   /db_xref="GOA:Q16DB9"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16DB9"
FT                   /protein_id="ABG30024.1"
FT                   /translation="MALGARRVAGVDEVGRGPLAGPVTAAAVVLDPANIPEGLNDSKQL
FT                   SVKRRNLLGDALASSADISVGHASVEEIEQHNILRASHMAMLRALAGLRLRPDFVLIDG
FT                   AMVPQGLNLRAQPVVKGDTRCLSISAASIIAKIARDKIMVDLAQQHPGYGWETNMGYGS
FT                   KSHISALRNLGVTPHHRRTFKPVHHMLYQDKNVKP"
FT   gene            complement(291742..292227)
FT                   /locus_tag="RD1_0301"
FT   CDS_pept        complement(291742..292227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30025"
FT                   /db_xref="GOA:Q16DB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB8"
FT                   /protein_id="ABG30025.1"
FT                   /translation="MTRRFIATVVSAAIAVAVIGNTPARADEALARALAAVVGIAVVGA
FT                   VIQNRLEDDRKDKQANRVTHTRSGVHHSNARYRDHGIKRANPRHTNRRLLPGDCLRSFN
FT                   TGYARYRVFGKTCLEQKYGATRQLPQACKVQFRTNSKNRVGYGARCLRRAGYQLARS"
FT   gene            292221..292688
FT                   /locus_tag="RD1_0302"
FT   CDS_pept        292221..292688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30026"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB7"
FT                   /protein_id="ABG30026.1"
FT                   /translation="MSWGRSLSVVHGAAFGCCRSDNKLGRTRADRQYRAMVIRYHRPQT
FT                   PFVIECHGDPAQVHAMRYSVFIAAALVTFSLAQPGMAAGCYADYKAKQDDPLRLHYGVA
FT                   QVSECSKKAARAELTARLAPKGWTLLNVISVFDQSGLAERKESAGPNYLRY"
FT   gene            292660..293364
FT                   /locus_tag="RD1_0303"
FT   CDS_pept        292660..293364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30027"
FT                   /db_xref="GOA:Q16DB6"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB6"
FT                   /protein_id="ABG30027.1"
FT                   /translation="MQDQTTSATDMRRSGGRIVGYGIAGILAILAVGVAMLFWALPDAN
FT                   AFNARVEKLFVENDDLTTQAEIKLLEILAQSGTAFSETLMSYRVVIFVLLVFATAMLIA
FT                   ALVFLVMLVGFNRRMAQIERVGIQVNSLLISREENTVYLNNLGFKLTDAAMETMSVLAE
FT                   ARMDDDVLSGSEIEGMISGRKAVDCEEAAGATRIKRLRDTLGNQIVSELLVKNIARRGY
FT                   MLAIDKDVIKVI"
FT   gene            293443..294213
FT                   /gene="bphF"
FT                   /locus_tag="RD1_0304"
FT   CDS_pept        293443..294213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bphF"
FT                   /locus_tag="RD1_0304"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30028"
FT                   /db_xref="GOA:Q16DB5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB5"
FT                   /protein_id="ABG30028.1"
FT                   /translation="MPAPLNTFKKSLSEGETLFGCWMSIAESYTAEILGNAGFDWLLID
FT                   GEHSPNDVRSIRDQMIALKSSDSHPIIRVPVGETWIIKQMLDLGAQTILVPMVETAEQA
FT                   QELVRACRYPPEGRRGVGYAVGRASGFGQIDNYGPTADAQTCLLVQVENKTGLYNLDAI
FT                   LAVDGVDGVFIGPADLSASLGYLGQTMHPDIQATILKTIKRISDSGKAAGILTTDDGMI
FT                   QASLDAGARFVAVAMDIAMLLNTGKSIAAKWKQG"
FT   gene            complement(294210..295361)
FT                   /locus_tag="RD1_0305"
FT   CDS_pept        complement(294210..295361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30029"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB4"
FT                   /protein_id="ABG30029.1"
FT                   /translation="MKSFHQPDDFYDSVPRETSFDHLTDLGRYTPLPDDWQIGVADIVN
FT                   STGEVAAGRYKTVNMVGAAVISAVMNGLNGRPFPFVFGGDGAGFAVGPDAEPAAREALA
FT                   AISVWARAEFAIGMRVALVPVADARAAGHDVKVARFQASPGADYAMFSGGGLLWAETEM
FT                   KRRRYVVAPAAEGTIPDLTGLSCRWAHMKARNGTILSLVVAPIPDADAADVAQVYKRVI
FT                   DVAGQLDRGGHPAPQVGMVSRWPPAGATLEAHAARGSGSLGAARRKALLESLLAWVLIR
FT                   TGLKIGGFDARRYARVVADNADFRKLDDGLKTTLDCDAETQSRLTAVLAQGADQGIVRF
FT                   GMATQEEAMMTCIVPSILTDDHLHFIDGAAGGYTQAAAQMKTR"
FT   gene            295514..296536
FT                   /gene="asd"
FT                   /locus_tag="RD1_0306"
FT   CDS_pept        295514..296536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="RD1_0306"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30030"
FT                   /db_xref="GOA:Q16DB3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB3"
FT                   /protein_id="ABG30030.1"
FT                   /translation="MGYRVVVAGATGNVGREMLNILAERHFPVDDITVLASRKSLGTEV
FT                   SFGDKTLKTKDLATFDFTGWDMALFAIGSDATKEFAPKAAKAGCVVIDNSSLYRYDADV
FT                   PLIVPEVNADAIMDYANKNIIANPNCSTAQMVVALKPLHDRATIKRVVVSTYQSVSGAG
FT                   KEGADELWDQTKSIYNPTDDKPPKKFTKQIAFNVIPHIDVFMEDGTTKEEWKMVVETKK
FT                   IIDTKIKVTATCVRVPVFVGHCEAINIEFEEHLDEDEAREILREAPGVMVIDKREDGGY
FT                   VTPVECVGDFATFISRIRQDSTIDNGLNLWCVSDNLRKGAALNAVQIAELLGTRVLKKG
FT                   "
FT   gene            complement(296611..297165)
FT                   /locus_tag="RD1_0307"
FT   CDS_pept        complement(296611..297165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0307"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30031"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB2"
FT                   /protein_id="ABG30031.1"
FT                   /translation="MRTAVLILTLIVPQVVQAQDDSAMIKVQRGLEMPAHRALQSVISE
FT                   SDLAVFETDGCSGGMSWSWRVVADLFPDFEAAQGAHPPWEQCCVVHDRAYHNAAGATSA
FT                   DQSFEARLSADQALQTCVVEQGEAQVKDLALRYDVDEDNIRLAYDMIATSMFNAVRFGG
FT                   GPCSGLPWRWGFGYPGCIPGL"
FT   gene            complement(297162..298934)
FT                   /gene="glpQ"
FT                   /locus_tag="RD1_0308"
FT   CDS_pept        complement(297162..298934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="RD1_0308"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30032"
FT                   /db_xref="GOA:Q16DB1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB1"
FT                   /protein_id="ABG30032.1"
FT                   /translation="MFVRLIIAAVLVPLIAALLAITLSFSDQSALTDQDIARFLLTPVG
FT                   AIGAVFIASLIIVAATIDIAVMTAVLRSDQRGAGKALAAAFGFLTRSLPRLAVFAGHLL
FT                   VRVLVISLPFLAVAGAIALFLMRDFDINYYLANRPPAFMAAIASGGVIAVALALVLLER
FT                   LSAWAVALHMSVFDLVPTRTAFQVSREKMRGHRLDLLKRLLSWLALRAAVAFVLVGTIG
FT                   FLLAEIPPFFSGNLALFFTVTAVLIGIWVFVNSALNAIANGALSDILNEEFDRCLEARV
FT                   ARGDPGPETHAPRLAWLSGLAALFAVGSLFVGGTAFNQVGGAERVDVIGHRGAAASRPE
FT                   NTMAAVIKAIEDGADWVEIDVQETADGEVLVVHDSDFMKAAGVDRKVWDVTMEEVAQID
FT                   IGTWFDPIYADERPPLLRDVLEVVKGRSKLIIELKYYGHDVDLENRVIALVEAAGMQDQ
FT                   IATMSLKYPAVQKMRRLRPDWRSGVLAATAVGDMSGLDGDFLAVSAGRLSARLLAQAQS
FT                   VGKDVYAWTVNDAASMSRMISLGVDGLITDKPKLAREVIAYHETLSTPERLMLRLGDTI
FT                   GFAFDLTPETGAEM"
FT   gene            complement(299130..299540)
FT                   /locus_tag="RD1_0309"
FT   CDS_pept        complement(299130..299540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30033"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DB0"
FT                   /protein_id="ABG30033.1"
FT                   /translation="MTKHAITLQLSDDLFKAVHDLATEQQGTVAEVVEDLVTEHLGGPK
FT                   SAARRLPRAGEKLIFALQKLLFRDMAEARDWADLDDRLRKHGYFMKITLGGLALHTETS
FT                   GKRVCHTHDLGFSYGTFVRRFGPGKPKDPREL"
FT   gene            complement(299577..299888)
FT                   /locus_tag="RD1_0310"
FT   CDS_pept        complement(299577..299888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30034"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA9"
FT                   /protein_id="ABG30034.1"
FT                   /translation="MKTHQAKRVEITIEAIMQSRLTDALSAAKVTGYTVLPVLGGSGRS
FT                   GEWVRSGEIGRASGMVQVVCIIRPERLDGLLDAAFGVVDKHIGVVSIMDCDVVRAERF"
FT   gene            complement(299893..300870)
FT                   /locus_tag="RD1_0311"
FT   CDS_pept        complement(299893..300870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0311"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30035"
FT                   /db_xref="GOA:Q16DA8"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA8"
FT                   /protein_id="ABG30035.1"
FT                   /translation="MDQILSLAANNLLSPIILSFVLGVAASLARSDLSVPEAAAKALSI
FT                   YLLFAIGFKGGVSVAAHGVDAKLGLTLLVGIILSAGLPLIAFGLLQVMTGLSRLDAAAV
FT                   AAHYGSISIVTFVAATSVLQSSGITYEGYMVAVAAAMEAPAILSALWLISRGGSERRMD
FT                   SDLWREILLNGSIVLLVGAFFIGWITGEEGLSEISSFIVAPFKGVLCLFLLDMGLVAGR
FT                   GLRSRSGVLKPGVLAFGLLMPVVGSSLGAVFGLLLGLSTGGVALLMVLSASASYIAVPA
FT                   AMRVALPEANPSIYLTLSLGVTFPFNLTLGIPLYVAVASALTGA"
FT   gene            complement(300952..301602)
FT                   /gene="cynT"
FT                   /locus_tag="RD1_0312"
FT   CDS_pept        complement(300952..301602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="RD1_0312"
FT                   /product="carbonate anhydratase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30036"
FT                   /db_xref="GOA:Q16DA7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA7"
FT                   /protein_id="ABG30036.1"
FT                   /translation="MDQAKPLPGYLVQRYHGWKATGYQENQSWYKQLARGGQHPRAMVI
FT                   SCCDSRVHVSALFGADQGELFIHRNIASLVPPYEPDGDPHGTSAAVEYAVTMLNVAHVI
FT                   VLGHSGCGGIQGCIDMCQGNAPDLEEKSSFIGRWMDILKPSYPLVAAENDPEIQAQALE
FT                   KQSVLVSLRNLMTFPFINSRVDGGLLTLHGLWTDIGEGSLEVFHSKDQAFHAI"
FT   gene            301733..302128
FT                   /locus_tag="RD1_0313"
FT   CDS_pept        301733..302128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30037"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA6"
FT                   /protein_id="ABG30037.1"
FT                   /translation="MRVRKMNHVLEIRLNETVHVCQDRLSALYAQLGEAGAEDVVCRAM
FT                   EELALRLSHCSRLHAAGEADELRKCARSLIAISEQIGMLVLARVAADVIEALDGNDGPA
FT                   VAATLSRLLRIGEQSLSAIWDLQDITI"
FT   gene            302192..303574
FT                   /gene="pepA"
FT                   /locus_tag="RD1_0314"
FT   CDS_pept        302192..303574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="RD1_0314"
FT                   /product="leucine aminopeptidase, putative"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30038"
FT                   /db_xref="GOA:Q16DA5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA5"
FT                   /protein_id="ABG30038.1"
FT                   /translation="MTSLFADADDQTIPLHIIDEDSLEAWLGDQSQTVQAWVRANGFAA
FT                   RIGQALLVPSDTGLPVMALAGFGTAKSRARGRFHLAAAASKLPAACYAIASGLPQAQSD
FT                   MEVLGWLLAAYRFGRYSETGAMGARLARPEGLDTARLEILAQAETLTRDLINTPANDMG
FT                   PPDLEAAAQDLAQQHGASIEVVLGDDLLAQDFPLIHTVGRAADRAPRLIDMKWGDRGPK
FT                   ITLVGKGVCFDTGGLNLKPGASMGLMKKDMGGAANVLGLAHMIMALQPRISLRVLIPAV
FT                   ENSVAGNAFRPGDILPSRKGLSVEINNTDAEGRLVLADALAYAQEDAPDLIISMATLTG
FT                   AARVAVGPDLAPYYCDDPDFVTALENAATHQCDPVWRMPFHTPYESMIEPGIADLDNAP
FT                   KGGFAGSITAALFLRRFVDESVYAHFDVYGWNPSDAPGRPKGGAGQATRALLGVIEAMQ
FT                   TS"
FT   gene            303571..304365
FT                   /locus_tag="RD1_0315"
FT   CDS_pept        303571..304365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0315"
FT                   /product="NlpC/P60 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30039"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA4"
FT                   /protein_id="ABG30039.1"
FT                   /translation="MTDRRVTPDPTHVTLDIPAQVTGPIADLRQSPAGPRDRQVLFGDR
FT                   AAILGRMEGHSLIRAQKDGYCGWVSDAALGPVHPVTHRVTSRATHVYAEANFKSPDLMH
FT                   LGFSAGLNVVAETATFVETPQGFIPRQHVRPTEARATDPATIAELFLGVPYLWGGNAHL
FT                   GIDCSGLVQAACLACGIACPGDSDQQAEQLGVALPSGAALQRNDVIFWKGHVALVLDKD
FT                   TLIHANAGHMLVTTEPIADALARIEMQGDGVPTGFKRLEMPT"
FT   gene            complement(304378..304725)
FT                   /locus_tag="RD1_0316"
FT   CDS_pept        complement(304378..304725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30040"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA3"
FT                   /protein_id="ABG30040.1"
FT                   /translation="MNYQVPPTSTLHQMPPSQVAFHRTELSVILSLYGRFVAAGEWRDY
FT                   GISCLKDVAVFSVFRRTAETPLYRIEKRPRLRDKQGMYAVVGMDGQIIRRGHDLKKVLR
FT                   VLERKLIRAVE"
FT   gene            complement(304795..306456)
FT                   /locus_tag="RD1_0317"
FT   CDS_pept        complement(304795..306456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30041"
FT                   /db_xref="GOA:Q16DA2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA2"
FT                   /protein_id="ABG30041.1"
FT                   /translation="MKTRRILSIWFPHFGADRLMRRNPQLATVPLGVVEEQHNSQVLTS
FT                   LNAAAAQAGLRVGQPVRDAHAMCEKLVTRARSQPAEAAFLTALQRWAGKFSPWVAPEGH
FT                   DALVIDLTGCAHLFGGEESLLQVVQQDCEDLGLSVRMGLADTRGAAWALARFAGQSAGS
FT                   HRTGDAIDQEARATRSRASKRRRWTKGGAAPVVTPGPAAGAHQISAPGQTYCALSPLPV
FT                   AALRLDTEITAQLSRLGIRRIGDLLGQPRAVLARRFGRGLVMRMDQAMGSAPEPVSPAR
FT                   APAHFAVRMTLPDPIGLESDLLAGLDRLLPRLCENLEKKGRGARRVLFQAYRTDHDIQS
FT                   VEVGLARAARDPAQIKPLIALKLGSIDAGFGIDMLRLEAVQTEPIHARTPVGHLEAGAV
FT                   VSTRLASNTSMDDLIGRIGARVGLEAITRLKPASSHIPEKTSTLHAAAWSTPFDGQWPD
FT                   PPNPRPLLIWQPEPVQAPDSPKLPDVFLWRGQRLRAVRAIGPERIAPEWWLDDPNWRSG
FT                   VRDYWSTETEDGQRLWLFYAHGHLMSSGWFCHGSYA"
FT   gene            complement(306540..307157)
FT                   /locus_tag="RD1_0318"
FT   CDS_pept        complement(306540..307157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0318"
FT                   /product="transcriptional regulator, TetR family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30042"
FT                   /db_xref="GOA:Q16DA1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA1"
FT                   /protein_id="ABG30042.1"
FT                   /translation="MTVATLAIRKGRKFDQVLDGARDVFMADGFEGASVDEIARVANVS
FT                   KATLYSYFPDKRLLFMEVATAECQRQARGAMDKIDMEAAPQDVLAQTGQHFLRFITSDF
FT                   GQKIFRICVAESERFPDLGQKFYNSGPAVFRTEMAAYFKQAEARGQLRMSDHLMAADQF
FT                   GELCKSDVWPRLIFGVIDKVSEAEIIRVVDSAVETFMARYGT"
FT   gene            307438..308367
FT                   /locus_tag="RD1_0319"
FT   CDS_pept        307438..308367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0319"
FT                   /product="auxin efflux carrier family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30043"
FT                   /db_xref="GOA:Q16DA0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q16DA0"
FT                   /protein_id="ABG30043.1"
FT                   /translation="MIEIFFKTVPFFALIGLGYWAGRIRFFTEEATAYLTKFVFYFALS
FT                   AMLFRFSANLSFADVWDTNLVSGYLLGTVAVYLIATIVGMIRRLDVATVAVEAQCAAIG
FT                   NVGFLGIPMLALLLGEAAIGVIMMALAVDLIVFSSLIVILITGSRDGRFSLRILRTIAL
FT                   GLVKNPMILAITSGLLWSALAIPIPTPMNDFLTILGGAATPGALFAIGASLASKSAERL
FT                   VIAGWLSFCKLVLHPLFVAIGVIILFPVDPYTAAVVISASALPVAGNVYILAQHYGVAS
FT                   HRVSAAILVSTAISIVSVSFVIGLVAPL"
FT   gene            308437..309267
FT                   /gene="fghA"
FT                   /locus_tag="RD1_0320"
FT   CDS_pept        308437..309267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA"
FT                   /locus_tag="RD1_0320"
FT                   /product="S-formylglutathione hydrolase, putative"
FT                   /EC_number="3.1.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30044"
FT                   /db_xref="GOA:Q16D99"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D99"
FT                   /protein_id="ABG30044.1"
FT                   /translation="METISENACFGGTQGVYSHTSASCNCDMTFGLFLPEEAQDGPVPL
FT                   LWFLSGLTCTHENAMIKAGAQSWAAEHGIALVFPDTSPRGEGVADDDAYDLGQGAGFYV
FT                   NATQAPWSSHFKMWDYVTEELPNLLEQNFALDMKRQAITGHSMGGHGALTIAMSLPGRF
FT                   RSVSAFAPISHPTASDWGRKQLSAYLGDDQSTWAPHDSTLLMREKGFDGPMLVDTGTKD
FT                   QFIDLLQPEALAEAVNTRRQQAVLRLQPGYDHSYFFIATFMEEHIAFHADALYA"
FT   gene            309264..309719
FT                   /locus_tag="RD1_0321"
FT   CDS_pept        309264..309719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0321"
FT                   /product="YaiI/YqxD family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30045"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D98"
FT                   /protein_id="ABG30045.1"
FT                   /translation="MTALYIDADACPVKSEAERVATRHRVKMYIVSNGGLRPSQNPLVE
FT                   TVIVPDGPDVADMWIADRCGTGDVVVTGDIPLAAKCIEAGALVLKHNGEALTSANIGNV
FT                   LASRDLMADLRAADPFRQGGGKSFGKADRSRFLDGLERTLRKAATLG"
FT   gene            309740..310372
FT                   /locus_tag="RD1_0322"
FT   CDS_pept        309740..310372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0322"
FT                   /product="hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30046"
FT                   /db_xref="GOA:Q16D97"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D97"
FT                   /protein_id="ABG30046.1"
FT                   /translation="MSDNPTPQAVIFDVGNVLIEWDPDRFYDGAIGEDRRRAMFEALDL
FT                   HAMNERIDLGAHFTDTVYAEAEKYPDWRAEIRMWHDRWIEMASPVIDHSVRLMKALQDK
FT                   GVPVFSLTNFGVESYDLAATHYPFLRAFDRDFISGHMRMIKPDPAIYAQVEATAGIKGD
FT                   ALLFTDDRDDNIAAAQGFGWQTHLFEGPQGWADRLVASGLLTRAEAA"
FT   gene            310369..311292
FT                   /locus_tag="RD1_0323"
FT   CDS_pept        310369..311292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0323"
FT                   /product="ornithine cyclodeaminase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30047"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D96"
FT                   /protein_id="ABG30047.1"
FT                   /translation="MSPIPIIPFSEGEAVLDWIGLTDALAAGHLLPKAEIADTFLYRDP
FT                   DTLLNRAAWIDGLGLAVKSATIFPGNTAQGLSSVNGGVTLYCDRTGTLEAIVDFHLVTK
FT                   WKTAGDSLLAARRLARADSRTILIVGAGTQARALHSAYSALFPHAQFTVWNRTAQNAEQ
FT                   LAREIPGIAIAEDLETAVRAADIVTAATMTTTPLIHGAWLQPGQHIDLIGAYRPDMREV
FT                   DDDALQRTRVFVDSLDTTVDHIGELKIPIAAGAFSADQIVADYYAPESFKRQGDDEITL
FT                   FKNGGGAHLDLMTSRFILERWQAQSA"
FT   gene            311289..312212
FT                   /locus_tag="RD1_0324"
FT   CDS_pept        311289..312212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0324"
FT                   /product="alpha/beta hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30048"
FT                   /db_xref="GOA:Q16D95"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D95"
FT                   /protein_id="ABG30048.1"
FT                   /translation="MIWALLLLAGIAAAPFVIEALRRPMNAAARKSAPGAFVDLSQGVT
FT                   HYQWSGPAEGPVIVCIHGLTTPSFVWQALRPALERRGFRILSYDLYGRGYSDRPKGVQN
FT                   PAFFLQQLNDLLASQDVRTDVTVVGYSMGGTIATLFAADRPQDIRQMVLLAPAGMRPVG
FT                   SGLFKAAVQNAVLGRWVMLALYPSILRKGLRAEAHVPSSVPGINALQHAELTWRGFVPA
FT                   VHSSLLGMLSDGLAAEHASLAQRKVPVMAIWGAADDVIPLAAKDQLAEWNPNAQQQVIP
FT                   DAGHGLTYTHCDEIDALLAPFLAKDA"
FT   gene            complement(312209..313501)
FT                   /locus_tag="RD1_0325"
FT   CDS_pept        complement(312209..313501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0325"
FT                   /product="transmembrane transporter, major facilitator
FT                   family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30049"
FT                   /db_xref="GOA:Q16D94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D94"
FT                   /protein_id="ABG30049.1"
FT                   /translation="MTFRSEIVVCPHIKDHILPKSAPLFTPVLIVGCAIIIVSFAIRST
FT                   FGVFQIPIADEFGWLRAEFSLAIAIQNLAWGIGQPLFGALAEKIGDRKSIVLGAVIYAL
FT                   GLLLSAGASTPIEHQLYAWLLGFGIAGTGFGVILAVVGRASSAENRSMSLAIVSAAGSG
FT                   GQIFGPPIAEWLLSFMSWQATFVVFAIAILAILLTLPMMRAPAMATKTDLEESLKEILG
FT                   KAFRDPSFTFIYLGFFSCGYQLGFITAHLPAFVTELCGPIMPGGMLDNMGISTTSALGA
FT                   VAISLIGLANIAGTLLAGWAGKYYSKKYLLAGIYTARTVVGALFIMFPITPTSVILFSL
FT                   AMGSLWLATIPLTSGLIAHIYGLRYMGTLYGIVFLSHQLGGFLGIWLGGRMYDVYGDYT
FT                   LVWWIGLAVGAFSAIIHLPIRERRLEGLQTV"
FT   gene            313515..314642
FT                   /locus_tag="RD1_0326"
FT   CDS_pept        313515..314642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0326"
FT                   /product="ATPase, AFG1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30050"
FT                   /db_xref="GOA:Q16D93"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D93"
FT                   /protein_id="ABG30050.1"
FT                   /translation="MPAAQSLICAASFLAQPQSLLGIMTSLSQHYMSLTQDGTLIADPA
FT                   QIAALPEFERVHDALLQPVKKGLFRKVPEPPKGVYFWGGVGRGKSMLMDLFVEHLDGIP
FT                   ARRVHFHAFMQEIHAAMHEVRKSGVEDAISPVAADVAASVRLLAFDEMQISDITDAMIV
FT                   GRLFEALFNAGVVVITTSNRHPDELYKNGLNRDLFLPFIALIKERMVIHELVSPTDYRQ
FT                   DRLGGQQVYFTPVNSDARKAMDAVWDDLAGGAGTPLVLKVKGRDVEIPAFRNSVARAGF
FT                   HDLCGKPLGPADYLTLAEAVKVLMIDGIPTLSRSNFNEAKRFVTLIDALYEAKVRLICS
FT                   AAAKPEMLYVEGEGTFEFERTASRLREMQGSDWGQ"
FT   gene            complement(314648..315922)
FT                   /gene="folC"
FT                   /locus_tag="RD1_0327"
FT   CDS_pept        complement(314648..315922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="RD1_0327"
FT                   /product="folC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30051"
FT                   /db_xref="GOA:Q16D92"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D92"
FT                   /protein_id="ABG30051.1"
FT                   /translation="MNSTSSDVILERMMALHPKVIDLTLDRVWRLLDALGNPQRNLPPV
FT                   IHIAGTNGKGSTQAMIRAGLEAAGKSVHAYTSPHLARFHERIRVAGDLISEADLTAVLD
FT                   ECYAANGGGDITYFEITTCAALLAFSRTPADFTLLEVGLGGRLDATNVVDDPVLTMITP
FT                   VSMDHEQFLGDTLRKIAFEKAGIIKPGVPCIVSRQADDGMEVIEEVAQRHAAPLLAYGQ
FT                   QWHVGPDRDRISYQDDAGLLDLPMPNLPGAHQIMNAGAALTALRYLGFDEHVAEAAVTT
FT                   AFWPARMQRLKTGPLTDAAPQAELWLDGGHNPAAGEALAAHLHSLPERPTHLICGMLNT
FT                   KDIDGYLRPLAAVTQDLTAVSIPGEASTLPAEATAEAARNVGFSADVADDVGAALAKIV
FT                   ATTPQARVLICGSLYLAGAILRENG"
FT   gene            complement(315919..316863)
FT                   /gene="accD"
FT                   /locus_tag="RD1_0328"
FT   CDS_pept        complement(315919..316863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="RD1_0328"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30052"
FT                   /db_xref="GOA:Q16D91"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D91"
FT                   /protein_id="ABG30052.1"
FT                   /translation="MNWITNYVRPRINSIFSRRETPDNLWTKCPECGTMLFHREVSDNL
FT                   NVCTNCDHHMNITARDRLTALFDGGIFTEVDVTPPTADPLGFRDQKKYPDRLKAAQKET
FT                   SEVEAMLVGCGEIGRTPIVAAAQDFSFMAGSMGMYVGNAIIAAAQEAVRLKRPLILFSA
FT                   AGGARMQEGILSLMQMPRTTVAVQMLKEAGLPYIVVLTHPTTGGVTASYAMLGDVHIAE
FT                   PNALICFAGPRVIEQTIREKLPEGFQRAEYLLDHGMLDRVTHRTKMRDELITITRMLLG
FT                   LPPAVRGDLPAPQPDDAAPTQDATETPVDTAEK"
FT   gene            complement(316922..317821)
FT                   /locus_tag="RD1_0329"
FT   CDS_pept        complement(316922..317821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0329"
FT                   /product="CAAX amino terminal protease family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30053"
FT                   /db_xref="GOA:Q16D90"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D90"
FT                   /protein_id="ABG30053.1"
FT                   /translation="MSLFRAYRAHEALVAPARPKAQVWRLIIGVILIAGVFLLANQFLH
FT                   QSLFTLLGSETYGALTGQDGRMSQLSVVFLLLSFGLLAVAVMVALKVAHNRGITAVFGD
FT                   AAAFRSQFVAVLLMLVILNAAVFALPPWDMGAPLVPNVTVGAWLVVLPFALVAIMVQVS
FT                   AEEILFRGYLQQQLAARFKSPLTWLLVPSVLFGLGHYMPEEAGENADIIMVWSVIFGVL
FT                   MADLTARAGTLAPAIAVHFVNNVVAILFVSMPDSLSGLSLYLSPFALTDTEELRAWLPV
FT                   EFAMMVVTWLAARLAIRR"
FT   gene            complement(317831..318001)
FT                   /locus_tag="RD1_0330"
FT   CDS_pept        complement(317831..318001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30054"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D89"
FT                   /protein_id="ABG30054.1"
FT                   /translation="MIGDDPDVLMSLLKTVASHLSGAAEVLRASGVSIREVAEEQRAAG
FT                   RAAPQPSKAME"
FT   gene            complement(318011..320953)
FT                   /locus_tag="RD1_0331"
FT   CDS_pept        complement(318011..320953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0331"
FT                   /product="ABC transporter subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30055"
FT                   /db_xref="GOA:Q16D88"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D88"
FT                   /protein_id="ABG30055.1"
FT                   /translation="MEPSIFSFIWKYSRRQQIVLLFFTIFTFPFLYATLELPKRIINDA
FT                   IGATSSIVEIWDGIEVSQTEFLMILCGLYLLSVLVHGLLKMRLNTMKGVLAERLLRRFR
FT                   YQLVGRMMRFPRAYFRSTSQGELVSMVTSEAEPMGGLMGDAVAQPVFQAGQMLIIVAFL
FT                   FAQSVWFGLAGIALIPLQAWLIPMLQRQINQLNKKRIVEVRQFAAEIGETAAGVTDLRT
FT                   NGGWRFRLAGFTDRLGRLFDIRFQIYQKKFFMKFLNNFITQLTPFFFYSVGGLLAIRGD
FT                   ITVGALVAALAAYKDLSSPWKELLTYYNQVQDMSLRWEIVVERFAPKGMIEESLFEGEP
FT                   DDMPRLDGAISMKNVTVRNADGNAVLENINLEIPAGARVAVKSTNQSERIAFAELLTRE
FT                   VIPTRGDITIAGRRLNDLHQAVVAARIGYAHSRPYLFNGTLGDNLFMPLKTSPKTVLWD
FT                   PKHKDKAAIEAQRAGNSPDSTKADWLDPQLAGLNTADEIRGWWFHLVEAMGTDDIMFRR
FT                   MLDARMDPEKHPQLAQQLVDLRDEVQVRLQERGLASMVNRFDPDEFNPSIPLGGNLMFA
FT                   APRRHITQESLASEANFLRLFTEIGLAEQGIAISQTLIETLHQTFGMDGTSHPLFTALG
FT                   IEEELYEKLVDIAMRRKDRGDQAISEDEFALLLTVPFAFTAEQIGPGFPESFKKEIVEI
FT                   RKTKSEEIRNRLKDLFVPVAPENYLPRMTLMENVLYGRVAGIAGVQGELIEDIVADVLA
FT                   EKGLKRLVAETVLDVPTGLGGANMANIFQERAAFSRAGIKRPDVLILDTVLASHDAASR
FT                   QRTRARLQELLPKTTMIFLEDNFENPQAYDLHIEIKNGRIDGEDDVEEVEDDASGSDDL
FT                   RRKIRVISRTELFADLEARSQRLLAFAAQWYDAPKGKRIFSMGERADAVYLCLSGTAMM
FT                   SYVDNNGTRQDVTAVEPGRLIGDLAIILDEPRQLDLIAQTDSQFLRIGAE"
FT   gene            321157..322920
FT                   /gene="ilvD"
FT                   /locus_tag="RD1_0332"
FT   CDS_pept        321157..322920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="RD1_0332"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30056"
FT                   /db_xref="GOA:Q16D87"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D87"
FT                   /protein_id="ABG30056.1"
FT                   /translation="MSSQRFDKSKLPSRHVTEGPSRAPHRSYYYAMGMTEEEIHQPLVG
FT                   VATCWNEAAPCNIALNRQAQSVKMGVKRESGTPREFTTITVTDGIAMGHEGMRSSLASR
FT                   EAIADTVELTMRGHCYDALVGLAGCDKSLPGMMMAMIRLNVPSVFLYGGSILPGRAPKG
FT                   ASVPAEYADRDLTVQDMFEAVGHQQNGTLSEAELEVLERVACPSAGACGGQFTANTMAC
FT                   VSEAIGLALPNSAGAPAPYESRDAYAEASGAAVMNLIEKNIRARDICTREAFENAARIV
FT                   ACTGGSTNAGLHLPAMAHEAGIDFFLEDVCEIFRDTPYFVDLKPGGQYVAKDMYEAGGV
FT                   PVVMKELRKAGLLHEDCMTVTGYSIGEELDKVSLEADGRVVYPIETPLSKTGGVVGLKG
FT                   NLAPEGAIVKIAGMEPQHLLFTGPARIFECEQDAFEAVQNRTYKEGDVFVIRNEGPAGG
FT                   PGMREMLATTAALSGQGMGKKVALITDGRFSGATRGFCVGHVGPEAAHGGPIALLKDGD
FT                   MITLNAIEGTITVDVSDEEMAERKANWKGARPTIYGAGALWKYAQLVGPTYLGAVTHPG
FT                   GKDEGHAYMEL"
FT   gene            complement(323220..324560)
FT                   /gene="ctpA"
FT                   /locus_tag="RD1_0333"
FT   CDS_pept        complement(323220..324560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="RD1_0333"
FT                   /product="carboxyl-terminal protease family protein,
FT                   putative"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30057"
FT                   /db_xref="GOA:Q16D86"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D86"
FT                   /protein_id="ABG30057.1"
FT                   /translation="MKKFAMAALGGTLAGVVATTQIAGPLLAQDSARSSNVYEQLDLFG
FT                   DIFERIRAQYVEEVDPGELIEAAIDGMLTSLDPHSSYLSPDDAAQMRVQTRGEFGGLGI
FT                   EVTQEEGFVKVVSPIDGTPADEAGVEAGDFITHVDGESVLGLSLDEAVTMMRGPVGSEI
FT                   IITLVREGEPEPFDVSIIRDTIKLTAVRTRTEGDTVVLRVTTFNDQTYTNLQSGLEEQI
FT                   AEAGGIDEINGIVIDLRNNPGGLLTQAIRVSDAFLEKGEIVSTRGREIQDGERFNATAG
FT                   DLAQGKPIVVLINGGSASASEIVAGALQDHRRAIVVGTKSFGKGSVQTVMPLRSDGAMR
FT                   LTTARYYTPSGRSIQSLGVSPDIVVEQPRRSLADEEEDESTNRPSRSEADLRGSLNNDS
FT                   LSEDEIKQIEADRAKAEAAAALREEDYQLAYAIDILKGLSAIGTSNR"
FT   gene            complement(324567..325709)
FT                   /locus_tag="RD1_0334"
FT   CDS_pept        complement(324567..325709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0334"
FT                   /product="M23 peptidase domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30058"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D85"
FT                   /protein_id="ABG30058.1"
FT                   /translation="MPHFIKLLALLTALLLPALAVAQTAPAERARLAVQMLDEASEKLE
FT                   TAQSARDRVRALSETVIAFEEGLGALRSGLRQATAREAQLSAQLIAQEREIASLLAVLQ
FT                   RVGGASSPVILLHPGGPTGAARAGMLVAEVTPALSAKAAEVRRDLEEMQALAALQTDAS
FT                   ARLEAALQQVQDARAALNQAMAERTELPKRFVSDPVNEAILIDTAETLDDFAAGLDRVI
FT                   LEEIAIVPPDLVGEKGALDLPVRGHLLRASGAADAAGIRRPGIILATRPAALVTSPVPA
FT                   TLRYVGPLLDFGQVVILEPQADVLFVFAGLETVYGAAGDVIEADAPLGLMGGVDDKIAA
FT                   ELSTDGDQTGTGRSETLYIEVRVNNTPEDPSDWFRTYKDG"
FT   gene            complement(325694..327211)
FT                   /gene="gpmI"
FT                   /locus_tag="RD1_0335"
FT   CDS_pept        complement(325694..327211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="RD1_0335"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30059"
FT                   /db_xref="GOA:Q16D84"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D84"
FT                   /protein_id="ABG30059.1"
FT                   /translation="MTRPKPVALCILDGWGLSERREGNAPLLADTPNMDRLMATCPHAT
FT                   LTTFGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEEGLFAQNSRLRAFIVT
FT                   LQDSGGTAHLMGVVSDGGVHGHINHMIAAAKALADENIPVVIHALTDGRDVAPRSALGY
FT                   FETLQAALPDGVEIATVTGRYFAMDRDNRWDRVSKAYQAIVTGTGRKAASASDAVDQAY
FT                   GQGENDEFISPTVLGGYTGAKDNDGFFCLNFRADRAREIMAAIGDPDFTAFETGARPKW
FT                   ASLMGMAQYSEAHANYMTTMYPKPEIVNTLGDWVAQQGLRQYRLAETEKYPHVTFFLNG
FT                   GEEVSFDGEDRLMPKSPDVATYDLQPEMSSKEVTDAFVAAIEEGYDLIVVNYANPDMVG
FT                   HTGDLQAAMKACEAVDQGLGRVLAALEKAGGAMIVTADHGNCDVMIDPETGGPHTAHTL
FT                   NPVPVVVVGAPDGATLRDGRLADLAPTILHLMGLESPKEMTGKCLIS"
FT   gene            complement(327286..330261)
FT                   /gene="dnaE"
FT                   /locus_tag="RD1_0336"
FT   CDS_pept        complement(327286..330261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="RD1_0336"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30060"
FT                   /db_xref="GOA:Q16D83"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D83"
FT                   /protein_id="ABG30060.1"
FT                   /translation="MFAELNITSNFSFLKGASHPEEYMSRAAALGIEAIAIADENTVAG
FT                   IVRAYAQARDIARQVRERQAWEAANDQIGPALPAGLRVAPATLYATPRLIPAARLVFAD
FT                   ACDITALPENRAGWGALCRLLSTGRQRAEKGACDLRQQDLLEGGCGLQLILWPQAQGVP
FT                   CGAGGWVQTARQLTHRFGGKIHIGLFPQYDGRDPQRFADLTEQARRLGLPTVASAAPVM
FT                   HHGARRKLADVVTAIRAGCRVDDLGRDALPNSEARLRSEAEMRRLFKGFDSAVDRAHTL
FT                   AQSLQFSLDELRYEYPSEIAENETPSGRLRRLAYEGLAWRYPAGASDKVHRLLEHELTL
FT                   IGKLKYEPYFLTVRDIVAFARSRDILCQGRGSAANSVVCYCLGVTSVSPEIGTMVFERF
FT                   VSEARNEPPDIDVDFEHERREEVIQHIYERYGRHRAGLCATVVHYRVKRAIREVGRAMG
FT                   LSEDTISALSSQLWGFFSTKGIEAERMAEIGLDANDRRLQQTLALVHEINGFPRHLSQH
FT                   VGGFVITEGRLDELVPIENATMEGRTVICWDKDDIEALGILKVDVLSLGMLTCIRKAFD
FT                   LMQMHHNVSHTLASLPPEDPAVYDMLCRADSIGVFQVESRAQMNFLPRMRPRCFYDLVI
FT                   EVAIIRPGPIQGDMVHPYIRRRNGEEEVSFPSDELGEVLGKTLGVPLFQEQAMQIAIVG
FT                   AGFTPDQADRLRRSLATFKKHGNVSEFKNLFLRGMKRKGYDDDFAERCFSQIEGFGSYG
FT                   FPESHAASFALLVYASSWIKCHHPGIFACALLNSQPMGFYAPAQIVRDAREHGVDVRPI
FT                   CINASFWDNVMEPDGRGGLALRLGFRQIKGISEEDATWLTAARGNGYRSVRDVWRRAGL
FT                   QPVMIERLAEADVFAALDLNRRAALWEAKALVPGAPLPLFAGDIDGEAIDEPAALLPEM
FT                   TLGEEVVEDYVAMRLTLRAHPMALLRHRLTPQPGASPAPLAPAEGKAPDLSKLSYTRGN
FT                   PD"
FT   gene            330297..330443
FT                   /locus_tag="RD1_0338"
FT   CDS_pept        330297..330443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30061"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D82"
FT                   /protein_id="ABG30061.1"
FT                   /translation="MESHLRATKTDFIKKNDARPVRPMQVSAITWFDNSEKSDAMISMG
FT                   YVG"
FT   gene            331353..333293
FT                   /locus_tag="RD1_0339"
FT   CDS_pept        331353..333293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0339"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30062"
FT                   /db_xref="GOA:Q16D81"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR004189"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015126"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D81"
FT                   /protein_id="ABG30062.1"
FT                   /translation="MNLSVTSIVGLPGMPTTTFGTRKWLKCRNVAHEKQGKRFVFNLCD
FT                   LPEDIRTAYLTRQIELAGLDTGTYDEAAHDQLRAAPASMQTAAERRAAITRLLVKLGDS
FT                   VSWKDRRALVCKEFGTKGNSIQSLKRLFKEVENTDPINFAPALLQGHKGRTVKADIADE
FT                   LWELWLGIIQKSAPSHALTAVYDDVQLIADKKGLAWPSYPTILRRWNALPEIERTTLRH
FT                   GGKHAAKELYQPQRRSVAKVQAMQVVEMDGRTLDIWAEFEDGTIARPTMIALVDRASFK
FT                   GLHFVIGKGETALLTRDLILETCDRYGIFDQLLTDNSRSFSGLLVAGGVKHKFRNSGSR
FT                   LPEWEPPGVCEHLGIELKFTLPHNPGAKIPESKFAKWSRRIDTRPEFAGAHSGHNPLDK
FT                   PNGNETPVPIALVREIYAREMARDNAKAGRRTQNARKGESYDQTFNRLLQSRIHRPMQP
FT                   KQRWRASLLYQVRTVDRLGQIRVNGWVYGKDSLDGSQERLLPYAGLPVLIGTDPSNYAA
FT                   PAIAFDMDTRREIMAGIQPDLEGDYMDQDGAREASKERARLRKITREIETRHSRDLSDF
FT                   YADLNDGRDLGCLDDPARANVVKPNFKDPIRAKANAKSEATERAERQEFLVRMKAEQNE
FT                   RKASGGTRQPF"
FT   gene            333253..334092
FT                   /locus_tag="RD1_0340"
FT   CDS_pept        333253..334092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30063"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D80"
FT                   /protein_id="ABG30063.1"
FT                   /translation="MNERPAVAPASLSECHQTLAKDHDNMRETIQPIDTTVYTTLDWQV
FT                   RNLLKTAGLGIARGPVGIGKSYSINRLHDELEAEGVKVILATCAPSTEGSYQAFVKTIL
FT                   AERNVYHTGIVDCMEAFETLIMGNPHGYIPQPSILIVDECQGMRAPVLTMLRQLWDIGD
FT                   PARLNGKGTAFAMLLCGNNTFLNRSGIVREMDLHPLRDRLTMKVRLDAPDTAELDSIAQ
FT                   SFCPHDANALAELRKYGRKRSNVRAIAQAYRMAGTLSGAAPVSAQNVRDAIKMMEGV"
FT   gene            334092..334430
FT                   /locus_tag="RD1_0341"
FT   CDS_pept        334092..334430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30064"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D79"
FT                   /protein_id="ABG30064.1"
FT                   /translation="MPEVIISIPMSDEEAQKTVGKQIMVLFVSDDQRAAISATMGQTHE
FT                   FLSLTHQNLNTLGEIAETRGAGETDLTKTIGQLRDPSRKVLGAFEGLMKFLGQAHFIKP
FT                   GSNGERLQ"
FT   gene            334427..334750
FT                   /locus_tag="RD1_0342"
FT   CDS_pept        334427..334750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30065"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D78"
FT                   /protein_id="ABG30065.1"
FT                   /translation="MNVSTHHVAVAVPADKLAALYDAMNESPYYLVRAAEVLRLISAAI
FT                   HDVTSDEDNAPPEIWKYAGTAELCAIGLEQIMHQHGELLIVMSSQVREAINFNDHIGQG
FT                   QDQ"
FT   gene            334747..335157
FT                   /locus_tag="RD1_0343"
FT   CDS_pept        334747..335157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30066"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D77"
FT                   /protein_id="ABG30066.1"
FT                   /translation="MKLTNKQMALLHVAKSKLDLSEHQYRATLVQIAEVTSATELDQDG
FT                   FDAIMGFFEYLGFTPLTPRAKDYGTRPGMASFAQIELILALWHEYTGGKAGEAELNKWL
FT                   LRTWKISSLRFLSKAMAPKAITALKSMKARAA"
FT   gene            335490..336506
FT                   /locus_tag="RD1_0344"
FT   CDS_pept        335490..336506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30067"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D76"
FT                   /protein_id="ABG30067.1"
FT                   /translation="MLHGPPQEACGCTDFRHFPRLLVFARNASDRLNITSGNCTLFLDT
FT                   KTLELVFKGFQTVYSDAYLKATVHWDKIAMQVPSASAEETYGWLGDFPQIREWLGSRIV
FT                   NGLEAHSFKILNREFESTVSVGRSHLADDKLGIFKPAFSEMGHLARNHPEELIFNLLAS
FT                   GFDTPCYDGQNFFDTDHQIKAPDGSSTSVSNMQDGSGPAWFLLDTSRAVRPIIWQERES
FT                   YKFEALDRPGDYNAFFHNEYIYGVRARVNAGFGLWQLAYGSKDILGSDNYAAARAAMMG
FT                   FRSDGGRILGVKPMMLVVPPELEERALQIVNTEFSTGGGTNPWRGTAELIVTPFLAG"
FT   gene            336530..337429
FT                   /locus_tag="RD1_0345"
FT   CDS_pept        336530..337429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30068"
FT                   /db_xref="InterPro:IPR012106"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D75"
FT                   /protein_id="ABG30068.1"
FT                   /translation="MQAAPLAAEAPEWVHLMPSGAISGRDGRSYTVSNPDALVAAFHAR
FT                   GVDLPIDYEHQSETHKETRVGPVPVAGWIKDMKARADGIWGRVEWTAAARDLISQKAYR
FT                   YLSPVMMHRKDDKEVLRLKGAGLVHHPNLTLTALASQEDTMDDTRPFMHKIAKRLGLAD
FT                   GASEDEIMQTLEDALGKTPDPEKYVPIAAMQSLMDDRAQTATAMSESRALAKVEDALEK
FT                   GHITPGMKDWATSLCRQNEASFDAFLERSGKVFSKLLEPTHTTAHPPSVQTSTARAESE
FT                   MAVSICRQLGLEETALNS"
FT   gene            337614..337979
FT                   /locus_tag="RD1_0346"
FT   CDS_pept        337614..337979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30069"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D74"
FT                   /protein_id="ABG30069.1"
FT                   /translation="MSEIQPLCPLPPAHVATYVNAMGVETAIEFLLNFGGAEIHLTTKP
FT                   SRGGMVERVIGYEKTKRLVEVSINSKHRVPLANKWLAQCLYCQGLSIAAIARRVRRSDT
FT                   TVRKYLRGTNTPRSMKR"
FT   gene            337985..338479
FT                   /locus_tag="RD1_0348"
FT   CDS_pept        337985..338479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0348"
FT                   /product="phage virion morphogenesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30070"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D73"
FT                   /protein_id="ABG30070.1"
FT                   /translation="MIEIQIDQDEIREALLDLGEKLNDMTPVFQNIGEALLASTEDRFR
FT                   EGVSPDGVPWAPKSQTTIDAYTAKGFAVDFRPLWGTNPKGTALRDSLFFQAGPDYAEIA
FT                   TGQAYSAAMQFGAQKGEFTKSGSASSVPWGDIPARPFLGVSDEDEHNILADLKEWLDVA
FT                   T"
FT   gene            339313..342114
FT                   /gene="polA"
FT                   /locus_tag="RD1_0349"
FT   CDS_pept        339313..342114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="RD1_0349"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30071"
FT                   /db_xref="GOA:Q16D72"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D72"
FT                   /protein_id="ABG30071.1"
FT                   /translation="MTNTFGKGHHLHLIDGSAFIFRAYHALPPLTRKSDGLPIGAVSGF
FT                   CNMLHRYVEGNTGPDAPTHVAVIFDKGSHTFRNDMYDLYKANRDAMPEDLRPQIPLTRR
FT                   ATEAFNIACKEKEGYEADDIIATLAVQARAAGGRCTIISSDKDLMQLVGDGVEMLDAMK
FT                   NKRIDRDGVFEKFGVYPERVVDVQALAGDSVDNVPGAPGIGIKTAALLINEFGDLDALL
FT                   ERAAEIKQPKRRQTLIDHADQIRLSRRLVLLDEATPLDFTLEDLEVRTPDPDQLMPFLA
FT                   EMEFRTLTKRIADQLKVEMPEINDTPANAPAAPEIADVPFDKAGYSQVDSAEALQGWID
FT                   QIYERGYVAVDTETTGLNEMTAELVGISLCVEPGTACYIPLIHKAAGSDDLFGSDDLAE
FT                   GQMPLETALEMLKPVLEDESILKIGQNMKYDAKVFAQVGITVAPIDDTMLMSYAMHGGL
FT                   HGHGMDALSERYLGHTPLPIKPLLGSGKSAITFDKVPLSEAVPYAAEDADVTLRLWQQF
FT                   KPALHRAQVTKVYETLERPMVAVLADMERAGIKVDRDTLSRMSNAFSQKMAALEDEVYT
FT                   LVGRKFNVGSPKQLGEILFDEMGLQGGKKGKTGAYATGADVLEDLATEHELPRRILDWR
FT                   QLSKLKSTYTDALQDHINPDTGRVHTSYSIAGASTGRLASTDPNLQNIPIRSEEGRRIR
FT                   EAFVAEEGKTLVALDYSQIELRILAHIADIPALKTAFDDGQDIHAMTASEMFDVPLDEM
FT                   TPEIRRQAKAINFGVIYGISGFGLARNLRIPRSEAQGFIDRYFERFPGIRAYMDDTKAF
FT                   AKEHGYVETLFGRRIHTPNIGAKGPQAGFAARAAINAPIQGTAADVIRRAMIRMPAAIA
FT                   ELPAKMLLQVHDELLFEVDQGAQDALIEAARSVMESAADPVVHLDVKLTVDAGQGPNWA
FT                   VAH"
FT   gene            complement(342206..342967)
FT                   /locus_tag="RD1_0350"
FT   CDS_pept        complement(342206..342967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30072"
FT                   /db_xref="GOA:Q16D71"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D71"
FT                   /protein_id="ABG30072.1"
FT                   /translation="MPKLAANLSTLWAELPYLDRFEAAQAAGFEGVAVPLPYEMPAKET
FT                   QRAALRSGLPVVHICAPPPNYTGGERGFAAVPGLEKRFEYDLRRALRYCEALRVPVLHI
FT                   IAGVASGAAARQTLVANLRHACDAAPDGIMLTLEPKAQADAFLSDFEVTAGVIRDVGAP
FT                   NLGLQFHSQHAAALGGDAVSVFETYADLIRHIQLADTNGAAPGSGAMDFEALAAAISRA
FT                   QYAGWLVADYTVDGRTEEHLDWMALFQTQNV"
FT   gene            complement(343043..343618)
FT                   /locus_tag="RD1_0352"
FT   CDS_pept        complement(343043..343618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30073"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D70"
FT                   /protein_id="ABG30073.1"
FT                   /translation="MSGQKTVTPSAEGLAASINAAKTRGLPPVHLWNPPFCGDLDMRIA
FT                   RDGTWFYEGTPIGRPGLVKLFSSILKKEAEDYFLVTPVEKVGITVDDAPFVAIDFEARG
FT                   SGTDQVLKFFTHVDDSAVASADLPIRVERDPKTGEPSPYVRVRSNLDALIDRKSFYRLV
FT                   DLGAHHEGWFGLWSSGAFFPVIPSAELP"
FT   gene            343688..344695
FT                   /gene="moxR"
FT                   /locus_tag="RD1_0353"
FT   CDS_pept        343688..344695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="RD1_0353"
FT                   /product="methanol dehydrogenase regulator moxR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30074"
FT                   /db_xref="GOA:Q16D69"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D69"
FT                   /protein_id="ABG30074.1"
FT                   /translation="MSEAEDLVAEIEALGEKLAQAKSSITKRFIGQERVVELTLTALLC
FT                   GGHGLLIGLPGLGKTRLVETLSTVMGLHGNRVQFTPDLMPADILGSEVLDTASDGSRAF
FT                   RFIEGPIFCQLLMADEINRASPRTQSALLQAMQEKTVTVAGENRTLGTPFHVLATQNPI
FT                   EQEGTYPLPEAQLDRFLVQIDVAYPDRDTERDILLATTGEVEEASTEVFSAADLLAAQK
FT                   LLRRMPVGESVVEMILDLVRAFRPEEDSASQQVRETVAWGPGPRAAQALMLTVRAKALL
FT                   EGRLAPSAEDVIDMARPVLSHRMALNFAARARGDSLTDLIESTAVTLSGTKAAA"
FT   gene            344692..345597
FT                   /locus_tag="RD1_0354"
FT   CDS_pept        344692..345597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30075"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D68"
FT                   /protein_id="ABG30075.1"
FT                   /translation="MSSLSSLPQDARPTALRASAETQAAMLPALLARAEHLAGAVLLGD
FT                   HGRRRAGMGDDFWQYRPAQPGDSRRLIDHRRSAMGDTQFVREREWQIAQSVMLWVDQGA
FT                   SMRFSSASDVPEKADRARVLALAIAILLVRGGERVGLTGTTLPPRRGNAQILRLAEMFT
FT                   KDAEEDYAPPEHRAMIPSARAVFISDFMGDVAEVKLALTKAADRGVRGVLLHVLDPSEE
FT                   EFPFSGRTIFESVGGTISHETLKANDLRTRYLDRLAARKEELQHLCTVTGWQYGQHHTN
FT                   MSAQSALLWLYSALDTGGFR"
FT   gene            345594..348371
FT                   /locus_tag="RD1_0355"
FT   CDS_pept        345594..348371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0355"
FT                   /product="N-terminal double-transmembrane domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30076"
FT                   /db_xref="GOA:Q16D67"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D67"
FT                   /protein_id="ABG30076.1"
FT                   /translation="MTVLGGIGFTAPWLLLALLALPILWLILRAIPPAPIKRMFPGVAL
FT                   LLGLQDDESVSDRTPWWLLLLRMLAVAAIILGLAGPVLNPNEDQAQGDGPLMIVLDGSW
FT                   AGATRWDEQMEAIDAQLSRASRAARPVAFLDLARPEAPVFQAADTWRSRLPGFTPSGWQ
FT                   PDAARIAEATSLLNETGAFDTLWFSDGLDYPGRDEALAAFEAKGMVDVYQTAANVVALA
FT                   PAGFEDGAIQLSALRATPGPEREVVLQVQGRDPVGNATLLATATATFQAGETNADTALT
FT                   LPAELRARITRFDIQGQRSAGATTLADDALRRREIALIAGREDREGLELLSPLHYLEQA
FT                   LAPSADLIKGSLSDILPANPDVIILADIATLSGGEAEDLGEWLDQGGMLVRFAGPRVAA
FT                   SDVSRVDEDPLMPVRLRTGGRTVGGAMSWGEPKTLAPFRENSPFFGLPIPDDVQVTSQI
FT                   MAQPDPTLAERVIAELTDGTPLVTRKTREQGQIVLFHVTATADWSTLPLSGLFVQMLER
FT                   LAVASSGTRPDATQLDGTTWTPEQVMDGFGTLSDAGNLPGVPGPDLVTAPPSPEMQPGI
FT                   YASGDRRLARNVVTDETALEPAVWPARIPVRGFSVPPEQPIAGLLLSLALLTLIADVIA
FT                   SLALTGRLKGAAGRTAAIVIALGIPLAIPSQSAAQSSELDEFALQSTEEMVLAYVITSD
FT                   QSVDDLSRAGLFGLSQTLTFRTSVEPASPVGVDLERDELAFFPILYWPITVEQPRPSSE
FT                   AYAKLNAYLRSGGLILFDTKDADIARFGTSSPNGRKLRDLAAPLDIPPLEPLPADHVLT
FT                   RTFYLLQDYPGRHTSRDVWVEAAPPDAEQIEGMPFRNLNDGVTPVVIGGNDWAAAWAMA
FT                   ENGAPLVPIGRGFTGERQRELAYRFGVNLVMHVLTGNYKSDQVHVPALLDRLGQ"
FT   gene            348368..350410
FT                   /locus_tag="RD1_0356"
FT   CDS_pept        348368..350410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30077"
FT                   /db_xref="GOA:Q16D66"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D66"
FT                   /protein_id="ABG30077.1"
FT                   /translation="MTGQMIFDPLIPWTLLAAIAVLAMAGVVFAALRGLSGWALRGLAA
FT                   LVVIAALTGPSYQQEDRAELSDIVLLLEDESASQNLSDRAEQTQSAADELADRIAARSN
FT                   TEVRRITVTDGDGDTGTQLMTALSKALAEEPRSRVAGIIAVSDGRVHDADLPVNLPAPM
FT                   HLLMTGKSTDWDRRLSIKNAPAFAIIGEPVTLTLRIEDMGNAPAGATAAPLLISVDGAE
FT                   PQEFQVPLGQDIDLPVTLPHGGRNVIEFTVPEADGELTDRNNKALIQMNGVRDRLRVLL
FT                   VSGEPHPGGRTWRNLLKSDSSVDLVHFTILRPPEKQDGVPVSELSLIAFPTRELFLEKI
FT                   DDFDLIIFDRYKRRGILPALYLDNVANYIRQGGAVLVAAGPDFAGADSIYRSPLGPVLP
FT                   ASPTARVLDQPFRPTVTEIGNRHPVSTGLPGGGDWGPWLRHIDITDPRGNVVMAGAGDR
FT                   PLLVLDRVGEGRVALLASDHAWLWNRGYEGGGPQLELLRRLAHWMMREPELEEEALTAD
FT                   ATGQTMRILRRTLQETVPPVVITDPLGNVTELPLLQSGPGVFETVFDGPEIGLYRLENG
FT                   DQMAVIGLGPAAPREFEQTIATPDILAPVLAALRGGTVMLEDGLPRLREVREGRPAAGR
FT                   GWIGLTPRNAYETRDVRQTAILPGWLVLLLSAGLITAAWLREGRR"
FT   gene            350567..352768
FT                   /locus_tag="RD1_0357"
FT   CDS_pept        350567..352768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0357"
FT                   /product="hybrid sensory histidine kinase, putative"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30078"
FT                   /db_xref="GOA:Q16D65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D65"
FT                   /protein_id="ABG30078.1"
FT                   /translation="MLELKQAELFAANRKLGLHARQLSNEIVETRAEVANVRDENKRVK
FT                   SDLSAAHKQIERVERRLWQSIETINDGFAFYSPDLELIMANNSYLAVFDGLEDMQPGVS
FT                   YVTVLQFLTEEGIVNTGDLRPAEWRQKMIERVQSPEPEAVVIQLWNNEYIRMIDRRGPD
FT                   GDIISLGINITAAVRYEEKLEAARASAEAASRAKSAFLANMSHEIRTPMNGVVGMADVL
FT                   TETPLSEEQRLYVDTIKNSGEALLVIINDVLDYSKIEAEKLQLHPEPFNLEKSIHEVLR
FT                   LLQSIARDKGILLSVDYALFLSSDFIGDPGRLRQILTNLLGNAVKFTTEGSVTVRVSGK
FT                   PDEATGKVILQIRVEDTGIGIPEDMIDHVFGEFNQVESERNRQFDGTGLGLAITKKLIK
FT                   MMNGQIWLTSEEGVGSCFGFEIALEPTGPVTLAHPALDPGLRHVMVVDDFPLNRDILQR
FT                   QLEEIGLKVTACQDAATALAMLDSSVDLVMVDHIMADVNGLQFAQTARKAGHTQQIILL
FT                   SSNHGYASKDPLSDSVDIIAQRPYLRSDLFGWLETVKPVSNNNAAPDKADGAASPAVFS
FT                   HRKTVSPSDAQPVEPTAPRKMRILAAEDNKTNRLVFGKMIKALDIELQFANDGQEAVDA
FT                   YPEFQPDLIFMDISMPRLDGKQATRAIREIEKSTSAHVPIIALTAHAMSGDDKDILEAG
FT                   LDHYMTKPLRKNEIIGKIMDFRPSDAAHPCPDDMDQEAG"
FT   gene            complement(352753..353532)
FT                   /locus_tag="RD1_0358"
FT   CDS_pept        complement(352753..353532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30079"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D64"
FT                   /protein_id="ABG30079.1"
FT                   /translation="MLVVISPAKRLDWAERDVPVTQPDFQEDAVRLSKTARNLTLGSLK
FT                   SLMGLSDDLARLNRDRFNAFAEDPAPEATRPAALAFAGDTYQGLEATSLDENERAWAQD
FT                   HLRILSGLYGVLRPLDAIQPYRLEMGSRLKTRRGSNLYEYWRDDLSKALNAQAQSVGTD
FT                   VLINCASQEYFGAVAPKALKLRVITPAFMEDKNDGKGPKIVSFFAKKARGAMARFVIQN
FT                   RLSDPDALTGFDTGGYAYQPELSTPDKPVFIRPYPAS"
FT   gene            complement(353567..355609)
FT                   /gene="recQ"
FT                   /locus_tag="RD1_0359"
FT   CDS_pept        complement(353567..355609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="RD1_0359"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30080"
FT                   /db_xref="GOA:Q16D63"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D63"
FT                   /protein_id="ABG30080.1"
FT                   /translation="MTGAPQMLRDVFGFDAFRPGQKEIVDAVTAGENVLAIMPTGGGKS
FT                   LCFQLPAILRDGVTVVISPLIALMRDQVRALQEAGVAAGALTSGNTPEETDAVFDALDQ
FT                   GRLKLLYMAPERLAAGSALGLLRRIGVSLIAVDEAHCVSQWGHDFRPDYLRIGELRRVL
FT                   GVPLAAFTATADADTRTEIVRKLFDDTDPQIFLRGFDRPNIHLSFAAKDGPRRQILDFA
FT                   AARPGQSGIVYCGTRAKTESLSAALREAGRTSLHYHGGMEAEDRRIAERRFQQEDGLIV
FT                   VATVAFGMGIDKPDIRWVAHADLPKSIEAYYQEIGRAGRDGAPAETLTLFGPDDIRLRR
FT                   NQIDEGLAPPERRAADHARLNALLGLAEAMKCRRATLLGYFGETDITCGKCDLCDAPPE
FT                   TFDGTIAVRKALSAILRTDEWFGAGHLIDILLGISTDKIMQRGHDKLPTFGVGKEYDKR
FT                   QWQAVFRQMMGHDLVRPDPARHGALKMTDAALPILRDQATIELRRDSIRNASTRRPAVK
FT                   SMVGEEDAPLLSALKAKRRAFAENAKVPAYIIFTDRTLIEMAENRPRTLDDLAGIGGVG
FT                   AKKLERYGAAFLEVINGEAEHMHPNRRKLAGKTAGTVYDRLLEVQAVLARGEAGQDKPL
FT                   SCSSSQLAKLAQMHNADEKAVENLLGDRRAARFGSAFLDVLREAG"
FT   gene            complement(355717..356004)
FT                   /locus_tag="RD1_0360"
FT   CDS_pept        complement(355717..356004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0360"
FT                   /product="YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30081"
FT                   /db_xref="GOA:Q16D62"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D62"
FT                   /protein_id="ABG30081.1"
FT                   /translation="MQSIFEILMLLLNVVWFFIIAHVIMSWLINFQVLNTQQSLVAQIW
FT                   YGLNRLLEPIYGPVRRVLPQMGGIDLAPLAVLLIVAILRIVLVNNYALFI"
FT   gene            356161..357525
FT                   /locus_tag="RD1_0361"
FT   CDS_pept        356161..357525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0361"
FT                   /product="major Facilitator Superfamily (MFS) transporter,
FT                   permease component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30082"
FT                   /db_xref="GOA:Q16D61"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D61"
FT                   /protein_id="ABG30082.1"
FT                   /translation="MSSTRQRIWGWYFFDWASQPYNTLLLTFIFGPYFAQTATETLIAD
FT                   GMAANAARAQAQAYWGYGLTAAGIAIAVLAPLLGSIADGSGRRMPWIVLFSTLYVVGAA
FT                   GLWWTAPADFSILWALFFFGIGLIGMEFATIFTNSFLPELHPNSNERGRISGSGWAFGY
FT                   LGGVVALAIMLVLFQAGDTGRTIAGLSPLFGLDPDTGADTRIVGPLTAAWFMVFIIPFF
FT                   LHFRDIAPRHTPQNHLRIGLIGLRDTLVKLPRTPSLLAYLGSSMFYRDALNGLYTFGGI
FT                   YALGVLGWSIMDIGIFGILAAISGAVFCWIGGHADRRIGPMPVIIFCCVTLILTSGLIL
FT                   SLTPRSILGIALADGSAIPDVTFYIAGALIGAAGGALQSSSRTMMTHQANPDRMTEGFG
FT                   LYALSGKATSFLAPASIAIVSDLTGSQRMGITPIVVLFILGLILLIWVKPKGDYA"
FT   gene            357522..358451
FT                   /gene="mepA"
FT                   /locus_tag="RD1_0362"
FT   CDS_pept        357522..358451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mepA"
FT                   /locus_tag="RD1_0362"
FT                   /product="murein endopeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30083"
FT                   /db_xref="GOA:Q16D60"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D60"
FT                   /protein_id="ABG30083.1"
FT                   /translation="MKTSHFILISVLAVGLMACSEQSAPPAQVAPLPTIGTSGHKDSLK
FT                   PAKQLFGAKSAASQSPPAPFGSYAKGCVAGAAQLPETGPTWQAMRLSRNRNWAHPETVS
FT                   FVKDLSRIAAQQPGWNGLYVGDLSQPRGGPMLSGHASHQIGLDADIWLRPATNLSLSVA
FT                   ERENISSISLRRNAGAFVNDNWTPQHAAILKAAASDPRVARIFIFPGAKVQLCNTATGD
FT                   RSWLRKIRPWFGHHYHFHVRLSCPSGSTGCVDQTPPPAGDGCADAQAWVNNILNPPPPD
FT                   PNAKPRKPRPPVRLADLPAQCADVLQSQ"
FT   gene            358424..359344
FT                   /locus_tag="RD1_0364"
FT   CDS_pept        358424..359344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30084"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D59"
FT                   /protein_id="ABG30084.1"
FT                   /translation="MRRRFTIAIISAVALAPWFWFKPVAPPDQPAHLLAVTDIPRDEDW
FT                   IGGLSGIDLTPDGTEFVFVTDRGHVARGQLLRRDGQLTGIEIDTKRVLVDPRGRVWETL
FT                   QTDAEGVAWAASGAIFVSFEHAHRVHAYPTLDTPEKLPSYTRAWGAFKQNGGLEALAIQ
FT                   DGGSLFAIPEHVHPGAWAALVYRRKPGEAWQQAFTLPVTDEFSPVGADFGPDGRLYVLE
FT                   RGLYPFGFYSRVRAMRVQEDSVTDIETVLQTKLGTHGNLEGLAVWRDAAGTIRLTMVSD
FT                   DNFYPFMRGEIVEYALTQRVATQPQ"
FT   gene            359414..360034
FT                   /locus_tag="RD1_0365"
FT   CDS_pept        359414..360034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0365"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30085"
FT                   /db_xref="GOA:Q16D58"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D58"
FT                   /protein_id="ABG30085.1"
FT                   /translation="MTRAHLPGIIAMAAIVVASNILVQFLFGNWLTWGAFTYPLAFLVT
FT                   DIMNRVYGAQAARRVVFTGFIVGIICSLIGTQIMGEYGPLVTLRIAIGSGIAFLTAQLL
FT                   DVSIFSALRGGTWWRAPLASTLIGSTVDTALFFSIAFSASLSFIEPANDVSWAGEVLPI
FT                   LGFGPQAPLWVSLAIADWGVKLSLALLALVPFRLITGRMTAAQ"
FT   gene            360368..360784
FT                   /locus_tag="RD1_0366"
FT   CDS_pept        360368..360784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0366"
FT                   /product="peptidyl-tRNA hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30086"
FT                   /db_xref="GOA:Q16D57"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D57"
FT                   /protein_id="ABG30086.1"
FT                   /translation="MRISDNITIEDWELTESFMRSSGPGGQNVNKVSSAVELRFEAARS
FT                   PNLPAPVKTRLKRLAGRRWTTDGALVLQCEETRSQARNREIIRERLAELIRKALVAPKR
FT                   RIATRPTLGSKKRRLKAKKQRGEVKSLRGRVDPE"
FT   gene            360858..361604
FT                   /locus_tag="RD1_0367"
FT   CDS_pept        360858..361604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0367"
FT                   /product="3'-5' exonuclease family protein, putative"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30087"
FT                   /db_xref="GOA:Q16D56"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D56"
FT                   /protein_id="ABG30087.1"
FT                   /translation="METGADAITTCAAALCDTIYRANTQHKETPNRLWRRLAEEYRKPM
FT                   THNVYKNDLPDGLDLGPMVAIDCETMGLHPHRDRLCVVQLSGGDGKAHLIQIAKGQTEA
FT                   PNLCKLLEDPKVLKLFHFGRFDIAAMLNAFGATAAPVYCTKIASRLVRTYTDRHGLAKL
FT                   LQELLAIDISKQQQSSDWGAETLTDAQIEYAASDVLYLHQLREALNKMLEREGRMETAQ
FT                   ACFDFLPMRAKLDLMGWPDTDIFAHS"
FT   gene            361601..362563
FT                   /gene="kdsD"
FT                   /locus_tag="RD1_0368"
FT   CDS_pept        361601..362563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsD"
FT                   /locus_tag="RD1_0368"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30088"
FT                   /db_xref="GOA:Q16D55"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D55"
FT                   /protein_id="ABG30088.1"
FT                   /translation="MSGIFQDTARRVIRIEIDALQQLEQSIDDSFAKAVELMIAATGRI
FT                   IVCGMGKSGHIARKIAATLASTGTPAHFVHPAEASHGDLGMMGAGDVVIVLSNSGETPE
FT                   LADVIAYTRRFSIPMIGVASRPESTLLRQSDVALVLPRAQEACGTGIVPTSSTTMTLAL
FT                   GDALAVALMEHRKFTPEHFRAFHPGGKLGAQLSKVSDLMHTGRAVPVVPGDAPMSEALR
FT                   EIGQKGFGVVAVSDPQGLLQGIITNGDISRHMDGLASFEAHNVMTPSPVTIPPDALAEQ
FT                   AVGIMNDKKITCLLVVDPQEPRKLVGLIHIHDCLRIGLG"
FT   gene            362569..363177
FT                   /locus_tag="RD1_0369"
FT   CDS_pept        362569..363177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30089"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D54"
FT                   /protein_id="ABG30089.1"
FT                   /translation="MHADRYSRMVAWLKVTLPLVALGMLSTLFLISRAVDPPSTIPFAD
FT                   SEVQERLTNQQVTGPYYTSMSANGDQIAVIAETMTGPTGVGGTNKGKNVDIEMKMASGT
FT                   NITAYGNDALLDIANDLSRLTGDVRITTSTGYVLLSDELLMRMSAMDVTSPGAVSATTP
FT                   LGDLQAGAMRFFVPEGKEDGQWVFTNGVKLVHTPDKTKE"
FT   gene            363181..363672
FT                   /locus_tag="RD1_0370"
FT   CDS_pept        363181..363672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30090"
FT                   /db_xref="GOA:Q16D53"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D53"
FT                   /protein_id="ABG30090.1"
FT                   /translation="MTVFRNLILSLPLVFAATGLLAQGTQVAFGTIQDNSGLPVEVTAD
FT                   SLAVDQNAGTALFTDNVIVIQGEMRLSADNVLVVYDTTAQAIDRIEATGNVVLISGQDA
FT                   AESERADYNVDDGTIVMSGSVLVAQGPSAISADTMTVQISDGTAQMSGRVKTVLQTGDQ
FT                   "
FT   gene            363673..364431
FT                   /locus_tag="RD1_0371"
FT   CDS_pept        363673..364431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0371"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30091"
FT                   /db_xref="GOA:Q16D52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D52"
FT                   /protein_id="ABG30091.1"
FT                   /translation="MARPRLTVAEGSAGLRVEHLRKSYRKKTVIRDFSMELDRGEVVAL
FT                   LGPNGSGKTTTFYAIAGLVTPEGGSVQIDGQDVTTFPMYRRAQLGIGYLPQEMSIFRGL
FT                   SVQDNIAAILDITEPDRHKRRERLEELLSEFSIEHLRRAPALALSGGERRRVEIARCLA
FT                   ANPRYLLLDEPFAGVDPISVDDIRTLVADLKKRSIGVLITDHNVRETLEIVDRAYILHE
FT                   GKVLMSGTPQDVVENENVRRVYLGDKFRIS"
FT   gene            364678..365244
FT                   /locus_tag="RD1_0372"
FT   CDS_pept        364678..365244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0372"
FT                   /product="sigma-54 modulation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30092"
FT                   /db_xref="GOA:Q16D51"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D51"
FT                   /protein_id="ABG30092.1"
FT                   /translation="MRYQISGKQIDIGEALQTHVREELSEAVKKYAERPTEAVVVFSKS
FT                   AHEFVCEATVHLSTGLTAQAKAHQTEIYAAFDACREKMEKQLRRYKRRLKDHHKDRAEP
FT                   VEIYGASSYILASEVESEDQEPETLQPIIVAEMETKIPSLSVGEAVMQMELQGAPVLVF
FT                   RNEGKEGVNVVYRRDDGNIGWIDPK"
FT   gene            365285..365749
FT                   /gene="ptsN"
FT                   /locus_tag="RD1_0373"
FT   CDS_pept        365285..365749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="RD1_0373"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30093"
FT                   /db_xref="GOA:Q16D50"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D50"
FT                   /protein_id="ABG30093.1"
FT                   /translation="MEFSELLKPEAVKVLNSASSKKRLMQDISDLSAQVYDLNADVVLD
FT                   AMLAREALGPTGVGHGIALPHARLSDLDSVLGVFVLLDKPIDFGSVDRQPVDIAFALFA
FT                   PEDAGVDHLKALALVSRTLRDASVCAKLRANRNPATLYTILTSAEAEQAA"
FT   gene            complement(365801..366694)
FT                   /gene="gtaB"
FT                   /locus_tag="RD1_0374"
FT   CDS_pept        complement(365801..366694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtaB"
FT                   /locus_tag="RD1_0374"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30094"
FT                   /db_xref="GOA:Q16D49"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D49"
FT                   /protein_id="ABG30094.1"
FT                   /translation="MTRKVTKAIFPVAGMGTRFLPATKSVPKEIMTLVDRPLIQYAIDE
FT                   ARAAGIKEFIFVTSRGKGALEDYFDHAPQLEQSLRDKGKTKLLEMLENTNMESGAIAYI
FT                   RQHKALGLGHAVWCARRLIADEPFAVILPDDVIAGDKPCLQQMVEAYEETGGNMVAAME
FT                   VPPEKASSYGMLDIETDMGSMVRVKGMVEKPPEGKAPSNLAVIGRYILAPSVLSNLNDM
FT                   KKGAGGEVQLTDAIATEIEKDHGVYGYRFQGQRFDCGSKSGFLQATVSFGLARDDLRDD
FT                   LSRYIHEIVSMSKAAQ"
FT   gene            complement(366908..367708)
FT                   /gene="kdsB"
FT                   /locus_tag="RD1_0375"
FT   CDS_pept        complement(366908..367708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="RD1_0375"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30095"
FT                   /db_xref="GOA:Q16D48"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D48"
FT                   /protein_id="ABG30095.1"
FT                   /translation="MSVLIAIPARYASSRYPGKPLVGLRGASGQTLSLIERSWRAAMEV
FT                   SGIDRVVVATDDTRIQDAAQAFGAEVVMTSPYCANGTERCAEVHAALGGGYDIVVNLQG
FT                   DAPLTPAWFIEDLVAGLLNAPTAEIATPVLRCDGETLQGLLNDRKAGRVGGTTAVFAQD
FT                   NHALYFSKEVIPFTSRDYSEDAQTPVFHHVGVYAYRPAALAAYPGWQVGPLEQLEGLEQ
FT                   LRFMENGRSVLCVEVEAKGRQFWELNNPEDVPRLEAMMAAMGLE"
FT   gene            complement(367708..368508)
FT                   /gene="cysQ"
FT                   /locus_tag="RD1_0376"
FT   CDS_pept        complement(367708..368508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="RD1_0376"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30096"
FT                   /db_xref="GOA:Q16D47"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D47"
FT                   /protein_id="ABG30096.1"
FT                   /translation="MFDYNKLTQVMRRLSIEAGAKIMEIYESDDFDVQTKSDQSPVTAA
FT                   DEAADAIISAGLRAAFPDVLLITEEQAASHSQTGDTFLIVDPLDGTKEFIQRRGDFTVN
FT                   IALVEDGVPTRGVVYAPARQRMFFTDASGQSVEETGSFAPETVGETKAMSVSAPDNAAL
FT                   MVVASKSHRDQATDDYINKYAVRDMKSAGSSLKFCLVATGEADLYPRLGRTMEWDTAAG
FT                   HAVLAGAGGHVVRFDDLSPLRYGKSGYANPFFIAYAPGVELTKA"
FT   gene            complement(368844..369443)
FT                   /gene="alkB"
FT                   /locus_tag="RD1_0377"
FT   CDS_pept        complement(368844..369443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="RD1_0377"
FT                   /product="alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30097"
FT                   /db_xref="GOA:Q16D46"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D46"
FT                   /protein_id="ABG30097.1"
FT                   /translation="MHLSVLGFDIYKGYLDLAAQQRVLDDVRDIVRSAPLVQPITPRGN
FT                   KMSVRMTAAGAYGWVTDRQGYRHARTHPGGQDWPAIPESVLRVWKDLSGSARDPECCLV
FT                   NFYGEGARMGLHQDKDEGSLEWPVLSISLGDDGLFRMGHSERGSKTQSVWLQSGDVVVM
FT                   GGAARLAYHGVDRIRFGSSTLLENGGRLNLTLRVVT"
FT   gene            369654..371564
FT                   /gene="dnaK"
FT                   /locus_tag="RD1_0378"
FT   CDS_pept        369654..371564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="RD1_0378"
FT                   /product="chaperone protein DnaK, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30098"
FT                   /db_xref="GOA:Q16D45"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D45"
FT                   /protein_id="ABG30098.1"
FT                   /translation="MSKVIGIDLGTTNSCIAIMDGSQPRVVENAEGARTTPSIVAFTDD
FT                   ERLVGQPAKRQAVTNPDNTIFGVKRLIGRRNDDAALAKDKKNLPFAVIDGGNGDAWVEA
FT                   KGEKYSPSQISAFILGKMKETAESYLGEDVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGLDKEQTQTIAVYDLGGGTFDVTILEIDDGLFEVKSTNGDTFLG
FT                   GEDFDMRIVNYLADTFKKEHSVDLTQDKMALQRLKEAAEKAKIELSSSSQTEINQPFIS
FT                   MGSNGQPLHMVMKLTRSKLESLVGDLIKASLKPCKDALKDAGLSASDIDEIVLVGGMTR
FT                   MPKVVEEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIETL
FT                   GGVFTRLIDRNTTIPTKKSQIFSTAEDNQNAVTIRVFQGEREMAADNKILGAFNLENIP
FT                   PAPRGMPQIEVTFDIDANGIVSVGAMDKGTGKEQKITIQASGGLSDEDIEKMVKDAEEN
FT                   ADADKARRELIEAKNQAESLIHSTEKSLEEHSDKVDPTTVEAIELAIAALKDEMESENA
FT                   DKIKSGIQNVTEAAMKLGEAIYNASQEENDDVAEPADGPHDDQDDIVDAEFEDLDNDKR
FT                   A"
FT   gene            371643..372797
FT                   /gene="dnaJ"
FT                   /locus_tag="RD1_0379"
FT   CDS_pept        371643..372797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="RD1_0379"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30099"
FT                   /db_xref="GOA:Q16D44"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D44"
FT                   /protein_id="ABG30099.1"
FT                   /translation="MAKRDYYEVLGVSKGASSDDIKKGYRRKAKELHPDRNKDDPNAEA
FT                   QFKEANEAYEVLKDADKKAAYDRYGHAAFEGGMGGGGGGRPGGGFGGGQDFSSAFSDVF
FT                   DDLFGNFAGGGQRGGGNRASRGSDLRYNLQINLEDAFSGLQKTINVPTSIGCKTCNGSG
FT                   AEGGSEPSSCPTCSGMGKVRAQQGFFTVERTCPTCSGLGQIIKNPCKSCQGAGRVEKDR
FT                   ALSVNIPAGVETGTRIRLAGEGEAGMRGGPSGDLYIFIEVAEHELFQRDGTNLFCRVPV
FT                   SMAKAALGGSIEVPTIDGGRGRVQIPSGSQSGRQMRLRGKGMPALRGGSSGDMFIELAV
FT                   ETPVNLTSRQKELLAEFDELSENNNPESSSFFSSVKSFWDSMKG"
FT   gene            complement(372925..373020)
FT                   /locus_tag="RD1_0380"
FT   CDS_pept        complement(372925..373020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30100"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D43"
FT                   /protein_id="ABG30100.1"
FT                   /translation="MTKYLKHQVSGNAGLLSSALKNRCAALMAAA"
FT   gene            complement(373054..375768)
FT                   /gene="secA"
FT                   /locus_tag="RD1_0382"
FT   CDS_pept        complement(373054..375768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="RD1_0382"
FT                   /product="preprotein translocase, SecA subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30101"
FT                   /db_xref="GOA:Q16D42"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D42"
FT                   /protein_id="ABG30101.1"
FT                   /translation="MLGIGTISRKIFGSPNDRKVKATRPVIAQINALEPEFEKLSDEGL
FT                   KEKTEEFRKRALEGESLDALLPEAFANCREAARRALGLRAFDTQLMGAVFLHQGNIAEQ
FT                   KTGEGKTLTATFAAYLNGLTGRGVHIVTVNEYLAKRDAAWMGSVFGALGLTTGVAYSDM
FT                   PEDEKRKAYASDITYATNNELGFDYLRDNMKSELDQIYQKQHNFAIVDEVDSILIDEAR
FT                   TPLIISGPSQDRSEMYKTVDAVIPQVRDDHFELDEKTRNVTFTDEGNEFLEEILHAQGL
FT                   LEEGQSLYDPESTTVVHHVNQGLRAHKLFQRDKDYIVRDDNVVLIDEFTGRMMPGRRLS
FT                   DGLHQAIEAKEGVDIKPENITLASVTFQNYFRLYDKLSGMTGTALTEAEEFMEIYGLGV
FT                   VEVPTNKPIARVDEDDQVYRTAREKYEAMLEKIKESNAKGQPVLVGTTSIEKSEMLSNM
FT                   LKQAGITHNVLNARQHEQEAQIVADAGKYGAVTIATNMAGRGTDIQLGGNVDLQVMNAL
FT                   TADPDADPEALRASIEAQHADEKAKVLAAGGLYVLASERHESRRIDNQLRGRSGRQGDP
FT                   GRSSFFLSLEDDLMRIFGSERLEKVLKTLGLKEGEAIVHPWVNKSLERAQSKVEGRNFD
FT                   IRKQLLKFDDVMNEQRKVIFGQRREIMEAKDLSEITTDMRHQVIDDFIEQYLPPNTYAD
FT                   QWDAEGLYAAVQEQLGIDVPVMDWVEEEGVDDEAIRERLVEATDKLMTEKAGQFGAENM
FT                   RNIEKQLLLQAIDTKWREHLLTLEHLRSVVGFRGYAQRDPLNEYKNESFQLFESMLDSL
FT                   REDVTQKLSQIRPMTEEEQQAMIEQIRAQQAAAQAAAAGPTVSAQAGPVAGPADAAVAF
FT                   DENDPSTWGNPGRNEPCPCQSGKKFKHCHGRLI"
FT   gene            375943..376800
FT                   /locus_tag="RD1_0383"
FT   CDS_pept        375943..376800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0383"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30102"
FT                   /db_xref="GOA:Q16D41"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D41"
FT                   /protein_id="ABG30102.1"
FT                   /translation="MQKHLRILAFSALTAAIAAPVVAQDDTALTADTVIATVNGEDIKL
FT                   GHMIAARATLGERYNQMPAEQLWNGIVEQLIQQTALAQGIESLSAGEAMALENQERSLK
FT                   AAKAIEIGLEQAVTEEDIQAAYDAEFGNLDPEEEFNASHILVATEEEAIAVKEAIDGGA
FT                   NFAATAREKSTGPSGPNGGELGWFSTGMMVPSFEAATIALEVGEVSDPVETQFGWHVIT
FT                   LNDTRQKNIPTLEEAREGIEARLAQDAALGIIQNAAAGAAIEVTPFENADERFDLINRF
FT                   DLLE"
FT   gene            376807..378033
FT                   /gene="argJ"
FT                   /locus_tag="RD1_0384"
FT   CDS_pept        376807..378033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="RD1_0384"
FT                   /product="glutamate N-acetyltransferase, putative"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30103"
FT                   /db_xref="GOA:Q16D40"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D40"
FT                   /protein_id="ABG30103.1"
FT                   /translation="MAKITVVSPLAPKRFPEMPVIDGVSFSTVAAGIKYEGRADVMLAR
FT                   LAPGTTVAGVFTKSATRSAPVLDCQEKLGGPAKDGAAILVNSGNSNAFTGRNGRDAVAR
FT                   IVGAVARACDVPETRVFTSSTGVIGEPLPFERITERLDTLAATLDPNAIEAAAAAIMTT
FT                   DTFTKGATASVEIDGKTVSIAGIAKGSGMIAPDMATMLVYIFTDARIDQGTLQSLVATH
FT                   NEKTFNCITVDSDTSTSDTVLVCATGASGVDVGDSAPFGDALHKVMKDLAHLVVKDGEG
FT                   ATKFVEITVTGAASDKDAKTHALSVANSPLVKTAIAGEDPNWGRIVMAIGKSGAPADRD
FT                   ALSIRFGDVEVARKGWVNPDYVEAEAAAHMKGQNICIHVDIGLGSGKATVWTCDLTHGY
FT                   IEINADYRS"
FT   gene            378052..378450
FT                   /gene="mutT"
FT                   /locus_tag="RD1_0385"
FT   CDS_pept        378052..378450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="RD1_0385"
FT                   /product="mutator mutT protein, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30104"
FT                   /db_xref="GOA:Q16D39"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D39"
FT                   /protein_id="ABG30104.1"
FT                   /translation="MKTVLVSAVALIDIDGRILLAQRPEGKAMAGLWEFPGGKVEAGET
FT                   PEHALIRELEEELGINTWQSCLAPLTFASHSYDDFHLLMPLFACRKWEGTPMSKENQSL
FT                   KWVFARDLKNYPMPAADIPLIPVLRDLL"
FT   gene            complement(378784..381258)
FT                   /gene="infB"
FT                   /locus_tag="RD1_0386"
FT   CDS_pept        complement(378784..381258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="RD1_0386"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30105"
FT                   /db_xref="GOA:Q16D38"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D38"
FT                   /protein_id="ABG30105.1"
FT                   /translation="MSDTDGKKTLGLRGGAPRPGNVKQSFSHGRTKNVVVETKRKRVVV
FT                   PKAGATTSAGGKAPIGDPSRRPAGISDAEMERRLKAVKAAKAREAEEEAARIAEEKARA
FT                   EERERRRAEQEERERAEREREESLKAKAEEDKRRKDEAEAAAKAAAAPAAEPVVQRPAA
FT                   KAAPEPAPRKQQDRDRDNKRGGKGNDDSRRSGKLTLNQALAGGEGGRQRSMAAMKRKQE
FT                   RARQKAMGGQVEREKVVRDVQVPEAIVVSELANRMSEKVGEVVKALMNNGMMVTQNQAI
FT                   DADTAELIVQEFGHRIVRVSDADVEDVIKEVEDDEADLKTRPPVVTIMGHVDHGKTSLL
FT                   DAIRKAKVVAGEAGGITQHIGAYQVKTDSGQLLSFLDTPGHAAFTSMRSRGAQVTDIVV
FT                   LVVAADDAVMPQTIEAINHAKAAEVPMIVAINKIDRPAADPTKVRTDLLQHEVIVEQMS
FT                   GDVQDVEVSAITGQGLDDLLEAIALQAEILELKANPNRAAQGAVIEAQLDVGRGPVATV
FT                   LVQNGTLRQGDIFVVGEQYGKVRALINDQGERVKEAGPSVPVEVLGLNGTPEAGDVLNV
FT                   TSTEAQAREIASYRANAAKDKRAAAGAATTLEQLMANAKADEDVSELPILVKADVQGSA
FT                   EAIVQAMEKIGNDEVRVRVLHSGVGAITETDVGLAEASGAPIMGFNVRANASARNTANQ
FT                   KGVELRYYSIIYDLVDDVKAAASGLLSAEIRENFIGYATIKEVFKVTGVGKVAGCLVTE
FT                   GVARRSAGVRLLRDNVVIHEGTLKTLKRFKDEVAEVQSGQECGMAFENYDDIRADDVIE
FT                   IFEREEITRTLT"
FT   gene            complement(381268..381888)
FT                   /locus_tag="RD1_0387"
FT   CDS_pept        complement(381268..381888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30106"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D37"
FT                   /protein_id="ABG30106.1"
FT                   /translation="MGRGGAPKDRGDGPERKCIATGDVQPKYGLVRFVVGPDGDVVPDI
FT                   LGKLPGRGIYVSADRAALEKAIAKGLFSRAAKQSVKVPETLVNEVETQLARRVVDLISL
FT                   QRKAGRAVAGFEKVKNWLQMEEAEVLIQAVDGSGRGKSKLSTPHYGSYIGWLTADELGL
FT                   AFGRQTVIHGALASGGLTQRVVEEAQRLKGVRVKEDGRGHPKG"
FT   gene            complement(381911..383527)
FT                   /gene="nusA"
FT                   /locus_tag="RD1_0388"
FT   CDS_pept        complement(381911..383527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="RD1_0388"
FT                   /product="transcription termination factor NusA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30107"
FT                   /db_xref="GOA:Q16D36"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D36"
FT                   /protein_id="ABG30107.1"
FT                   /translation="MAITSANQLELLQTAEAVAREKMIDPGLVVEAMEESLARAAKSRY
FT                   GAEMDIRVHIDRKTGRATFTRVRTVVEDELLENYQAEFTVEQAKQYMENPEVGQQLIEE
FT                   VPPVEMGRIAAQSAKQVILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVG
FT                   AGEAILRRNEKIGRESYRPNDRIRVYIKDVRREQRGPQIFLSRTAPEFMAELFKMEVPE
FT                   IYDGIIEIKAVARDPGSRAKIAVISYDGSIDPVGACVGMRGSRVQAVVNELQGEKIDII
FT                   PWNEDQPTFLVNALQPAEVSKVVLDEEAGKIEVVVPEEQLSLAIGRRGQNVRLASQLTG
FT                   LDIDIMTEEQESARRQAEFELRTKLFVDNLDLDEFFAQLLVSEGFTSLEEVAYVEVDEL
FT                   LVIDGVDEDTANELQARARDVLEAQNKAALESARALGVEDSLIEFEGLTPQMIEALAKD
FT                   DVKTLEDFATCADWELAGGWTTVDGERSKDDGVLEPFDVTLEEAQDLIMTARVMLGWVD
FT                   PADLEPDEDVAEDAEAEEAEV"
FT   gene            complement(383527..384117)
FT                   /locus_tag="RD1_0389"
FT   CDS_pept        complement(383527..384117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30108"
FT                   /db_xref="GOA:Q16D35"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D35"
FT                   /protein_id="ABG30108.1"
FT                   /translation="MNNDLIAKAAIDRRMAEIITPVIEDMGFELVRVRLMSGKSTILQI
FT                   MADRPDGGIEVDDCAEISQAVSAVLDVEDPILDEYTLEVSSPGIDRPLTRLKDFEMFEG
FT                   YEAKIETGDMVDGRRRFKGALAGVEDDEVLINIEEGTIGLKFDWLSDAKLVLTDDLIKE
FT                   MLRQRKAAGALDETNFDEVSTELETDTPSEGDQ"
FT   gene            complement(384261..385154)
FT                   /locus_tag="RD1_0390"
FT   CDS_pept        complement(384261..385154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0390"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30109"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D34"
FT                   /protein_id="ABG30109.1"
FT                   /translation="MTRRSHMDRRALFATGAAAALLAATGVSVQASPSRKGRLRAALSG
FT                   ASRTDRFDARQDHGLFMQVAMAGAVFDTLTEVAADGTLHGELSTAWEGDARAQVWTLTL
FT                   RDDVDFHDGTRFAAQDVVASFDLHRDTLLADVARVAVLDARRVLVELHRGDPDFPYRLS
FT                   DPRLVMYPSRNIAEAMRDGIGTGLYRVQRFQPGRHFLGARVAHHYKDGRAGWFDTVELV
FT                   ALSSSAVRAEALRDNYVDAAELSDTADLADLSGITLLPETHAMTAAVSQGLALPAQTGR
FT                   RWPLDNLRAAERWWMA"
FT   gene            complement(385151..386092)
FT                   /gene="pip"
FT                   /locus_tag="RD1_0391"
FT   CDS_pept        complement(385151..386092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="RD1_0391"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30110"
FT                   /db_xref="GOA:Q16D33"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D33"
FT                   /protein_id="ABG30110.1"
FT                   /translation="MQYLYPPVDPFDQRMLDVGQGHRIYVEQCGNPAGIPVIVLHGGPG
FT                   GGCSPAMRRYFDPTVFRVILFDQRGCGRSRPHASVTHNTTWHLVDDIELIRRTLDIDDW
FT                   IVFGGSWGATLSLIYAQSHPDRTRHLVLRGVFLMTQAELDWFYGGGAGKFWPEVWARFT
FT                   GPIPEDERGDLIEAYRRRLFSGDMPQETRFAKAWSSWENALASIHSSGTSGDAPGEYAR
FT                   AFARLENHYFSNAGFLDFDGQILANVGRIAHIPGVIVQGRYDMICPPDSAYRLAEAWEN
FT                   CELKMVRNAGHALSEPGISAELVRTMDRIGGR"
FT   gene            386171..386917
FT                   /gene="ubiG"
FT                   /locus_tag="RD1_0392"
FT   CDS_pept        386171..386917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="RD1_0392"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30111"
FT                   /db_xref="GOA:Q16D32"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D32"
FT                   /protein_id="ABG30111.1"
FT                   /translation="MQAPQTTVDPSEIAKFEAMAAEWWDENGKFKPLHMLNPCRLDYIT
FT                   TQIAGEFDRDLASPEPFKGLRILDIGCGGGLLAEPMARLGADVVGADAAERNIPVARVH
FT                   AEQSGLTIDYRHTTAEALAAEGEQFDVVLNMEVVEHVASPIDYLIACRQLLKPGGLQVC
FT                   STLNRNPKSYVMAIIGAEHVMRWLPKGTHEWSKFITPDELYDLLRQSGMDPVDRKGFVF
FT                   NPISWSWKLSGRDLSVNYVTASVKPA"
FT   gene            complement(387016..387459)
FT                   /locus_tag="RD1_0393"
FT   CDS_pept        complement(387016..387459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0393"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30112"
FT                   /db_xref="GOA:Q16D31"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D31"
FT                   /protein_id="ABG30112.1"
FT                   /translation="MNEDKNALAIALFTEVMAADQLVRARLSRVLPKGMEISHFSVLNH
FT                   LAWIADERTPAQLAETLHVTRGAMTNTLGKLEWAGYVHIRPDWDDARRKLVAISPAGRQ
FT                   ARDYAVGTVTPVITQMVDKMGAEQVRGAIPILREMRMLLGDEG"
FT   gene            complement(387460..388290)
FT                   /locus_tag="RD1_0395"
FT   CDS_pept        complement(387460..388290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0395"
FT                   /product="hydrolase, carbon-nitrogen family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30113"
FT                   /db_xref="GOA:Q16D30"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D30"
FT                   /protein_id="ABG30113.1"
FT                   /translation="MKTALIQLNVTDDPEENLPVTLGYVRQAAAEGATFILTPEVTNCL
FT                   SNSRSHQREVLSHEEDDPTLKALQHEARTLGVWILIGSLALKTQDADGRFANRSFMIDP
FT                   QGDIVARYDKIHMFDVQVTPEETYRESEGYRPGGRAVTAQTDFATVGMTVCYDVRFSAL
FT                   HMALARAGADILTVPAAFSPVTGAAHWHALLRARAIETGCYVLAPAQTGTHASKHHKTR
FT                   ATYGHSLVVGPWGDVQLDAGTQPGVYMTDLHMEQVGSARARIPSLANARLFDGP"
FT   gene            complement(388290..388547)
FT                   /gene="grxC"
FT                   /locus_tag="RD1_0396"
FT   CDS_pept        complement(388290..388547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="RD1_0396"
FT                   /product="glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30114"
FT                   /db_xref="GOA:Q16D29"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D29"
FT                   /protein_id="ABG30114.1"
FT                   /translation="MKNVEIYTSPLCGFCHAAKRLLSQKGIDFAEVDVLADPDRKPEMV
FT                   QRAKGSRTVPQIFVGDVHVGGCDDLYALERAGKLDQLLAA"
FT   gene            complement(388587..389318)
FT                   /gene="comF"
FT                   /locus_tag="RD1_0398"
FT   CDS_pept        complement(388587..389318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="RD1_0398"
FT                   /product="competence protein F, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30115"
FT                   /db_xref="GOA:Q16D28"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D28"
FT                   /protein_id="ABG30115.1"
FT                   /translation="MSQLSFQTAVSLVYPPRCLGCGGQVESDFGLCGGCWRDTPFIGGS
FT                   ICDSCGAPLPGDNHNECLKCDDCMITPRSWSKGRAALLYKDNARRLVLALKHGDRQEIA
FT                   EPAALWMSRAIEDLPLDNVLVAPIPLHWTRLLKRRYNQSALLAQALARHAGLPVCPDLL
FT                   QRQRRTQPMDGMTKEVRFTSVKGAIRAHPKRRHRMAGRPVLLVDDVFTSGATLSSATDA
FT                   CLAAGSGPVYVVTLARVTKNT"
FT   gene            389437..390153
FT                   /locus_tag="RD1_0400"
FT   CDS_pept        389437..390153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30116"
FT                   /db_xref="GOA:Q16D27"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D27"
FT                   /protein_id="ABG30116.1"
FT                   /translation="MQDRLTLVNRAFTVPAVVTPFPDLWRKHMPGAHIVRDAETLDLEV
FT                   GAHDLVIHAMSLHWANDPVGQLIQCRRSMKPDGLMIAATLGGQTLQELRNCLGDAEIAL
FT                   TGGLSPRIAPMGEIRDLGALLQRAGFALPVADSVTLRAQYRDAFHLMRDLRNMGETNAL
FT                   EQRRRVTPPRALFERMAAIYAENYATQADQVIATFEMVFLTGWAASDTQQKPLRPGSAK
FT                   QRLADALRVPEQPLRD"
FT   gene            390239..391282
FT                   /gene="hemH"
FT                   /locus_tag="RD1_0401"
FT   CDS_pept        390239..391282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="RD1_0401"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30117"
FT                   /db_xref="GOA:Q16D26"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D26"
FT                   /protein_id="ABG30117.1"
FT                   /translation="MARPTHAESDHPEVAKPKVGILLANLGTPDNYDYWSMRRYLNEFL
FT                   SDRRVIDYSPWIWQPLLQLIILSKRPFSSGAAYKSIWNEEDGESPLMTITKAQTKKVKE
FT                   VMAQRHGDEVMVDFCMRYGNPSTRSKVAAMTAAGCRKILFFPLYPHYAGATSATANDEF
FT                   FRSLTYEKWQPTTRTVDPYFDRPDYIEALAQSIERAYAGMVTKPDILVCSYHGVPIRYL
FT                   MEGDPYHCQCQKTTRLLKERLGWADTEITTTFQSKFGPEEWLQPYTVEEVARLAEAGKK
FT                   NIAVCAPAFSADCIETLEEINEEIKESFEEAGGEQFTYIPCLNDDDAHIAALCNTIDDN
FT                   LKGWVDT"
FT   gene            complement(391673..392284)
FT                   /locus_tag="RD1_0402"
FT   CDS_pept        complement(391673..392284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0402"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30118"
FT                   /db_xref="GOA:Q16D25"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D25"
FT                   /protein_id="ABG30118.1"
FT                   /translation="MSEQNFKNPGRRAFLAGGAALLASPAIAQDLGSVNSAGTTQGERD
FT                   LTETVRRNISSFRTLDWQPYFSDLRRGAILVDIDSRALHYWAEGGDFYKLYPSSVPLSE
FT                   ELTRRGRTKIVRKVEGPSWRPTPSMLERNPDWPEFIGPGPDNPMGTHALYLSWTYYRIH
FT                   GTHDTRKIGRQSSNGCIGLFNEHIAELYELSEVGTQVLLI"
FT   gene            392449..392994
FT                   /locus_tag="RD1_0403"
FT   CDS_pept        392449..392994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0403"
FT                   /product="SCP-like extracellular protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30119"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D24"
FT                   /protein_id="ABG30119.1"
FT                   /translation="MIRLISLLVALTVALAACAPTSSGTRLGSDGKPLPQVYRIKERDT
FT                   ANIQFRMLDAVNALRSASGQGPVALDAQLNAAAATHSRDMSVQNRPWHFGSDGSSPIDR
FT                   VQRVGFAGTLVGENISETYETEIETLGAWMEKPDTRRVILSPDANRLGFAWFQEDNGKI
FT                   WWTLILGKASGAGAGLGS"
FT   gene            complement(392999..393460)
FT                   /locus_tag="RD1_0404"
FT   CDS_pept        complement(392999..393460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0404"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30120"
FT                   /db_xref="GOA:Q16D23"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D23"
FT                   /protein_id="ABG30120.1"
FT                   /translation="MSLGACATGSKFKRYSGPEVTFVVVNKGARRMHLLHNETALRSYD
FT                   IHLGFAPVGHKQFEGDGKTPEGLYRIDRRNPNSDFHLSLGISYPNVNDYAAAKAVGKSP
FT                   GGDIFIHGQKSPFRKDEPDWTWGCIAVTNPEIEEIYAMVQNDTLIQLNA"
FT   gene            complement(393586..394365)
FT                   /gene="ccaA"
FT                   /locus_tag="RD1_0405"
FT   CDS_pept        complement(393586..394365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccaA"
FT                   /locus_tag="RD1_0405"
FT                   /product="voltage-gated sodium channel subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30121"
FT                   /db_xref="GOA:Q16D22"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D22"
FT                   /protein_id="ABG30121.1"
FT                   /translation="MGVREQLDIWLDNRWVTNLVIAVIIFNAILLGMETSPQIMAEAGD
FT                   LIIMLDKACLTFFVVEIFLKLVARGRRFFKSGWNIFDVLIVGAALVPGSQTMSVLRALR
FT                   ILRVLRVISVAPSLRRVVEGFVTALPGMGSVFVLMAIIFYIGSVISTKLFAASFPQWFG
FT                   SLPQSGYTLFQIMTLESWSMGIVRPVMEVYPFAWMFFIPFIMMTTFAVVNLLVGLIVNS
FT                   MQDAHQQEAGEQTDAYRDEVLSRLIAIEEKLKDRPRS"
FT   gene            complement(394385..395611)
FT                   /locus_tag="RD1_0406"
FT   CDS_pept        complement(394385..395611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0406"
FT                   /product="RNA methyltransferase, putative"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30122"
FT                   /db_xref="GOA:Q16D21"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D21"
FT                   /protein_id="ABG30122.1"
FT                   /translation="MTELLISRLGLHGDGIADGPVYVPRVLPGETVEGRVSGQVLQDVK
FT                   VIRPSDRRVSAPCAHYKSCGGCQLQHADDAFVADWKVDVVRQALANHGIETVFLPIRTS
FT                   PAKSRRRAGFAARRTKKGALVGFHGRASDTIIPVERCEILDPAVLQGARIAEELALAGA
FT                   IRKTALAVSVTLTKSGLDVAASKGKPLDGPLRQRLAAICEAQVIARLSWDDEVVAMRTP
FT                   PQYEFDGIDVAPPPGAFLQATAHGEAALLAAVRDITQDAGRIVDLFAGCGTFALPLARR
FT                   CEVHAVEGDGDMTAALDAGWRHAQGLKNVTTETRDLFRRPLVPMELTRVDAVVLDPPRA
FT                   GAEAQVVELAEAAVPRLAYVSCNPVTFARDAAVLCAAGYVLDWVQVVDQFRWSAHVELA
FT                   ASFTAAHMR"
FT   gene            complement(395650..397482)
FT                   /locus_tag="RD1_0407"
FT   CDS_pept        complement(395650..397482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0407"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30123"
FT                   /db_xref="GOA:Q16D20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D20"
FT                   /protein_id="ABG30123.1"
FT                   /translation="MNIGGWIDAFRRADGSPPQSLGAFMLWCLSGSWPALCLATVLSAL
FT                   AGAMEVGTALILGLVIDATAASTPDAFFSGDNLPVVIGALAFFLLARPVLYGLSSATNS
FT                   IIVMPNVNPLVLSRLHRWTLGQTVGFFDNDFAGRIAQKQMQAARAVTDVVSELINVVAF
FT                   ALAALIGSVALLFAIDWRVALCFAVWLVAYFALINWFLPRIRERSARRAGARAMVSGQI
FT                   VDTITNIKTVKLFAHAEYEDKAALGAMQTFRERALAFGYLSAGFRLALMSLAGLLPVLL
FT                   IGGTILLWQAGQATQGDIVAAGAVAIRIAQMTGWVSFTLMQIYSNIGEVEDGIKTLTPR
FT                   ERIEDNASAKTLDVPAGQIKLQDVGFAYGRETGGVQGINLTIHPGEKIGIVGASGVGKS
FT                   TLVALLLRLYDAEKGRITIDGADVTEVTQESLRRNIGMVTQETAMFNRSAMDNILYGRP
FT                   DATREEVIAAAQKAEADAFIQTLEDHRGRTGYDAHLGERGVKLSGGQRQRIALARAILK
FT                   DAPILVLDEATSALDSEVEAAIQSALERVMEGKTVLAIAHRLSTLTEMDRIIVMKDGQI
FT                   VEDGRHEALLAQQGLYAQYWERQSGGFIRTQAAE"
FT   gene            complement(397479..399317)
FT                   /locus_tag="RD1_0408"
FT   CDS_pept        complement(397479..399317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0408"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30124"
FT                   /db_xref="GOA:Q16D19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D19"
FT                   /protein_id="ABG30124.1"
FT                   /translation="MFRYFENLIDPYADYVETDQPPAKLWPFLWSFAGQFRKLFIVAGF
FT                   MSIIVAGIEVGLIYYMGRVVDLMEGDPAVFWARHGTELILVSLFILFLRPAIQALDVLV
FT                   LNNAILPNFGSLMRWRNHRHVLRQSVGWFENDFAGRIANRMMQAPSAAGEVVFQIFDAL
FT                   SFSLAYFLGAAILLSTADPRLLIPLLLWFVLYAALVRWTVLRVGPASEAASNARSKLTG
FT                   RLVDAYTNIHSVKMFAHHEREINYAREAIEETRVTFQKEMRVFTKMDVVLVMLNGVLII
FT                   GVVGWAMLLWVQGTASVGVVAAATALTLRLNAMTGWIMWALTSFFRELGVVAEGMQTIA
FT                   QPVTLTDAADAKPLRLTSGEISIEGLSHHYGRSSGGLDRIDLTIRRGEKVGLIGRSGAG
FT                   KSTLVKLLLRFYDAEAGRITIDGQDISTVRQDSLRLAIGMVQQDSSLLHRSVRDNLMYG
FT                   RAGASEEQMIAAAKQAQAHEFILDLEDPEGRRGYDAHVGERGVKLSGGQRQRITLARVI
FT                   LKDAPILLLDEATSALDSEVEAAIQDTLYGMMEGKTVIAIAHRLSTIAKMDRILVMDKG
FT                   RIVEDGSHDALLSKGGLYADFWARQSGGFLSVEENQ"
FT   gene            complement(399488..400666)
FT                   /locus_tag="RD1_0409"
FT   CDS_pept        complement(399488..400666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0409"
FT                   /product="polyA polymerase family protein, putative"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30125"
FT                   /db_xref="GOA:Q16D18"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D18"
FT                   /protein_id="ABG30125.1"
FT                   /translation="MERSDVINLPADTAWLHDADALAVCDALSCAGGAVYFVGGCVRDA
FT                   LLGIARSDVDLATDQTPENVMRLAEAAGLRAVPTGLDHGTVTVVSGGTGFEVTTFRRDT
FT                   STDGRHAVVSFSTDIREDARRRDFTMNALYAASDGRLVDPLNGVQDCLNRRVRFIEDPQ
FT                   KRIREDYLRILRFFRFHAWYADPAAGFDPDALDAIAQNTAGLAQLSAERIGTEMMKLLR
FT                   APDPAPSVAAMRQTGCLARVLPGSDDRFLAPVVHLEGSMGHGPDPVLRLSALGGDMAED
FT                   VLRLSRAEARKLKQLQVFGFGPMSLAEITYRENADLARGAAILRAAFASQPVPASAQDE
FT                   ISKGAQAEFPIKASDLMPTYQGKALGDRVRLLEQQWIASGFSLTRDALLALE"
FT   gene            complement(400645..401235)
FT                   /locus_tag="RD1_0410"
FT   CDS_pept        complement(400645..401235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0410"
FT                   /product="hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30126"
FT                   /db_xref="GOA:Q16D17"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D17"
FT                   /protein_id="ABG30126.1"
FT                   /translation="MTDLARIRHALTRPGRPSSDFDLNKDVVLPPARKLRPAGVLAAVF
FT                   EARKGLHLILTKRSSGLKHHPGQIAFPGGKQDEGDRDVTAAALREAHEEIGLQASNVEI
FT                   LGTLPAHETVTGFVVTPVIGYVRKPFEYRPEPGEVDEVFTVPLSHVLNKDNFAIEGRMW
FT                   RGQRRSYFAVPFGPYYIWGATARMLRAWSDQMS"
FT   gene            complement(401228..402259)
FT                   /gene="hslO"
FT                   /locus_tag="RD1_0411"
FT   CDS_pept        complement(401228..402259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="RD1_0411"
FT                   /product="chaperonin, 33 kDa, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30127"
FT                   /db_xref="GOA:Q16D16"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D16"
FT                   /protein_id="ABG30127.1"
FT                   /translation="MDAVCQSPGHKETPMTLGHKIAWDDTVLPFQLDASDIRGRVARLD
FT                   GALDGILKQHNYPAHVEALVAEMALLTALIGQTVKLRWKLQLQVQSKGPVRMITTDYYG
FT                   PEDTGGPARIRAYASYDETRLTDGAPFDQVGEGYFAIMIDQGQGMKPYQGITPIAGDSL
FT                   AACAEAYFAQSEQLPTRFSLSFGRSTEPQVDEHWRGGGIMLQHMPKASPFVAQGDGSGD
FT                   VLQPSDLVEGDEKENWNRVNILLDTVEEMELIGPKLSPSDLLLRLFHEEVPRVYDAQVV
FT                   RFGCSCSEDRVRQSLSIYSARDIETMTTDEGRVTADCQFCGAHYDLDPKTVGFEAEGEQ
FT                   AGD"
FT   gene            402299..402748
FT                   /locus_tag="RD1_0412"
FT   CDS_pept        402299..402748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30128"
FT                   /db_xref="GOA:Q16D15"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D15"
FT                   /protein_id="ABG30128.1"
FT                   /translation="MIPRVGHAPEAKRRYTARPGAYAILPHEARFLLTLQVADRLDVQL
FT                   PGGGIDPGEQPLQALHREVLEEIGWRIANPRKMGVFRRFTYMPEYDLWAEKICHIYVAK
FT                   PVLQIADPIEEDHETLLLPADQAIDALGNDGDRLFLSRYISMGSG"
FT   gene            complement(402724..403935)
FT                   /locus_tag="RD1_0413"
FT   CDS_pept        complement(402724..403935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0413"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30129"
FT                   /db_xref="GOA:Q16D14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D14"
FT                   /protein_id="ABG30129.1"
FT                   /translation="MVDDSRLQRKILSSSLVRWGYEVIEAASGEEALDICIAQRPELVI
FT                   SDWVMPMMDGIQFCKEFRELTSDSYGYFILLTSKSEKNDVAEGLDAGADDFLTKPVNGN
FT                   ELRARITAGERILKMQLELTQKNRVIGDTLKELQRLYDSLDNDLIEANKLQESLIPERF
FT                   KQIGDSHLSLLLRSSGHVGGDLVGHYPAGDGHLGLYSLDVSGHGISSALMTARLAGYLS
FT                   GSAPDQNIALEKGEDGSYRSRPLFEAIETLNEMVLDEMETEHYFTLMLADINLRTGEVL
FT                   IAQAGHPHPVIQRKSGEITQKGTGGFPVGLMSGVTFEQFETKLEPGDRLMIFSDGVTEC
FT                   PNAAGEMLGEEGLETFLRDLHHVTGPALFETLMWKLGEFAGTSDFPDDVSGILFEFQPD
FT                   PIEM"
FT   gene            404158..404490
FT                   /locus_tag="RD1_0414"
FT   CDS_pept        404158..404490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0414"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30130"
FT                   /db_xref="GOA:Q16D13"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D13"
FT                   /protein_id="ABG30130.1"
FT                   /translation="MIDWDRVAALREEVGAEDFDEVVELFLQEVDEEIETLAAQPVQDG
FT                   LSEKLHFLKGSALSLGFRAFSDLCQTGEAALAQDPAASVDVEELQNSYQSSRSSFLNDL
FT                   PTKFAC"
FT   gene            complement(404487..405278)
FT                   /locus_tag="RD1_0415"
FT   CDS_pept        complement(404487..405278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0415"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30131"
FT                   /db_xref="GOA:Q16D12"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D12"
FT                   /protein_id="ABG30131.1"
FT                   /translation="MAFTGQTVVVTGGLSGIGAALVRQFEALGARVCVFDIVDVPASGA
FT                   SITAYVKCDVSVQQDLRDAIQKVEREVGAIDIFVSNAGVMSAGPPLGDGDDWARCLSVN
FT                   LMAHVYAARVLIPLMAARGGGYLVTVASAAGLLNQIGDAAYSASKHAAVSFAESIAITH
FT                   AEDNIGVSLVCPQYVATPLLGLTAADIEGQSLLTADQVADRVLHAVKARQFLVLPHPEV
FT                   RTYALARAEDHDRWVSGMRKLRARSIKEYGDALPRRFYRLV"
FT   gene            complement(405287..406519)
FT                   /gene="ilvA"
FT                   /locus_tag="RD1_0416"
FT   CDS_pept        complement(405287..406519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="RD1_0416"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30132"
FT                   /db_xref="GOA:Q16D11"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D11"
FT                   /protein_id="ABG30132.1"
FT                   /translation="MTPSFRQSADAATLAMRDVFPATPLMRNDLLSAKYDADIWLKRED
FT                   LSPVRSYKLRGAFNAMRKVIPARDVFVCASAGNHAQGVAFMCKHFGVHGVVFMPVTTPA
FT                   QKVMKTKVFGGEFVEVRMVGDYFDQTLSQAQAFCAEAHAHFLSPFDDEDVIEGQASVAA
FT                   EILDQLGHAPDRIVLPVGGGGLSAGTRSYFRDDTQYTFVEPSGAKSLAAAISEGAPVDV
FT                   SPINSFVDGAAVAKIGARTFARLKDVAPADIIDLSEDRICGTIVEMLNIEGIVLEPAGA
FT                   LAVEALAEIPQAIKGKTIVCIASGGNFDFERLPEVKERAQRYAGLKKYFILRLPQRPGA
FT                   LKDFLQTLGAQDNITRFEYMKKSARNFGSVLIGIETDDPHNFFDMFQRIDDAGFTYTDI
FT                   TNDETLAQFVI"
FT   gene            406646..407866
FT                   /gene="argG"
FT                   /locus_tag="RD1_0417"
FT   CDS_pept        406646..407866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="RD1_0417"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30133"
FT                   /db_xref="GOA:Q16D10"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D10"
FT                   /protein_id="ABG30133.1"
FT                   /translation="MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEEL
FT                   EPARAKAEMMGASDIYIEDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKRLV
FT                   EIAEETGADAIAHGATGKGNDQVRFELAAYALNPDIKVIAPWREWDLSSRTKLIDFAEK
FT                   NQIPIAKDKRGEAPFSVDANLLHTSSEGKVLENPAVDAPDYVYQRTVNPEDAPDTPEYI
FT                   EIGFEKGDAVSINGEAMSPATILTKLNEIGGKHGCGRLDLVEGRFVGMKSRGIYETPGG
FT                   TLLLEAHRGIESITLDRGAMHLKDELMPRYAELIYNGFWFSPERTMLQAAIDASQTHVT
FT                   GTVRLKLYKGLARTVGRWSDHSLYSEAHVTFEEDAGAYDQTDAAGFIQLNALRLKLLAA
FT                   RDRRLKS"
FT   gene            complement(407957..408661)
FT                   /locus_tag="RD1_0418"
FT   CDS_pept        complement(407957..408661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0418"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D09"
FT                   /protein_id="ABG30134.1"
FT                   /translation="MRIAMWSGPRNLSTAMMYSFGARSDFTIMDEPFYAPFLAATHTDH
FT                   PMRDDILRAHENDPAAVATQCLAPQSTPHLYMKHMPHHMVAGFPMDWAHACVNVHLIRH
FT                   PARVIASYSAKWDDLTLDQIGFVQQSALYDQLGGVVIDSFDIRQNPEKALRRLCSAIDL
FT                   PFDPAMLRWPAGPRAEDGIWAAHWYGAVHRSTGFAGAEGPLPDVDPRHRDMLEQALPHY
FT                   EKMRAAALDSGV"
FT   gene            408854..409516
FT                   /gene="msrA-1"
FT                   /locus_tag="RD1_0419"
FT   CDS_pept        408854..409516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA-1"
FT                   /locus_tag="RD1_0419"
FT                   /product="methionine-S-sulfoxide reductase, putative"
FT                   /EC_number="1.8.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30135"
FT                   /db_xref="GOA:Q16D08"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D08"
FT                   /protein_id="ABG30135.1"
FT                   /translation="MLNISSLKTYALAGMIALGLCVHGTQSHAAELETITVAGGCFWCV
FT                   ESDFERVTGVTEAVSGFMGGSVSNPTYKEVTSGGTGHYEAVQITFDPDVVSRDTLYAMF
FT                   FRSVDPTDAGGQFCDRGDSYRTAIFAETPAQAAAAKAAKANAAAALGVPVVTPVLDAST
FT                   FYPAEAYHQDYYKGTRLVITRFGPKRQASAYKAYREACGRDARVRELWGAAAPFAGG"
FT   gene            complement(409513..410385)
FT                   /gene="rbsK"
FT                   /locus_tag="RD1_0420"
FT   CDS_pept        complement(409513..410385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="RD1_0420"
FT                   /product="ribokinase, putative"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30136"
FT                   /db_xref="GOA:Q16D07"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D07"
FT                   /protein_id="ABG30136.1"
FT                   /translation="MAIYNLGSINADNVYRVPHLVGPGETLAATGFSQGLGGKGANMSV
FT                   AAARAAARVFHIGAVGGDGAWASERLLEYGVDTRHIARVDEPTGHANICVDEAGENDIV
FT                   VFAGANRAITDAMIGAALAEASPGDSFVTQNETSGQAFGAATARKLGLRVIYAAAPFDA
FT                   AAVTAVMEHLDLLVLNAVEAAQLSAQTGSDIGDLPVSDIIVTIGSQGCKWLSRGAEPRL
FT                   FPALDVTPVDTTGAGDTFTGYLIAGLDRGMPMAQAIDLATRAAALMVTRVGTADVIPDL
FT                   KEIQDMRLG"
FT   gene            complement(410385..412640)
FT                   /gene="tme"
FT                   /locus_tag="RD1_0421"
FT   CDS_pept        complement(410385..412640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tme"
FT                   /locus_tag="RD1_0421"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30137"
FT                   /db_xref="GOA:Q16D06"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D06"
FT                   /protein_id="ABG30137.1"
FT                   /translation="MTKNRVTAEEALAFHLEPTPGKFEVTATVPMTTQRDLSLAYSPGV
FT                   AVPCEAISQNPETAYDYTNKGNLVAVVSNGTAVLGLGNLGALASKPVMEGKAVLFKRFA
FT                   DVNSIDIELDTEDTDAFINAVKLMGPTFGGINLEDIKAPECFIIEQRLKDEMDIPVFHD
FT                   DQHGTAVICAAGLINALHLSDKKIEDVRIVLNGAGAAGIACLELLKAMGARHQNCIMCD
FT                   TKGVIYQGRAEGMNQWKSGHAVATEARTLEDAMKGADVFLGVSVKGAVTEAMIASMADD
FT                   PVIFAMANPDPEITPEEAHAVRADAIVATGRSDYPNQVNNVLGFPYLFRGALDIHARAI
FT                   NDEMKIACAHALAALAREDVPDEVALAYGKNLSFGRDYIIPTPFDPRLIHRVPPAVAKA
FT                   GMDTGAARRPIIDMEAYELSLKTRMDPTASILRGINARARANQARMIFAEGDDARVLRA
FT                   AVMYQRSGLGKALVVGRKEDVKDKLEQAGMPDAVREIEIVNAANTTHLDTYKDFLYSRL
FT                   NRGGFDAQDIHRLAARDRHVFSALMLAHGHGDGLVTGATRKSAHIMDRINHVFDADVKS
FT                   GAAGITAILHKGRIVFIADTLVQEWPDEEDLANIAERAATVARNMGLEPRVAFVSFSTF
FT                   GYPVSERATKMADAAKVLDARGVTFEYEGEMTVDVAMNTTVQASYPFSRLTGPANILVV
FT                   PARHSASISVKLMQEMAGATVIGPILSGVDRSIQICSTGATANDILNMAVLAACKVG"
FT   gene            412776..415412
FT                   /gene="mutS"
FT                   /locus_tag="RD1_0423"
FT   CDS_pept        412776..415412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="RD1_0423"
FT                   /product="DNA mismatch repair protein MutS, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30138"
FT                   /db_xref="GOA:Q16D05"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D05"
FT                   /protein_id="ABG30138.1"
FT                   /translation="MTVTPMMAQYLDLKAEYADALLFYRMGDFYEMFFEDAVAAAEALD
FT                   IALTKRGKHDGADIPMCGVPVHSAEGYLLTLIRKRFRVAVCEQMESPAEAKKRGSKSVV
FT                   KRDVVRLVTPGTLTEETLLDARRNNYLTSFAQVRDAKALAWTDISTGAFHVMPLTALKL
FT                   GPELARLAPSELICSESAENDLREVAEDFGIALTGLARAAFDSTSAEQRICDLFGVETL
FT                   DSYGSFTRAEVAAMGGIIQYLDITQKGKLPLLRPPQRETENRTIQIDAATRRNLELTQA
FT                   LSGGRAGSLLAVIDRTITAAGGRLMSARIASPSRDLETITNRLDAVSFAQDHHDLCGAL
FT                   RDHLRKVPDLDRALSRLSLDRGGPRDMAAIRNGLTQSAILFETLGSHELPPLLADALND
FT                   LSRHDNLIDRLDATLVAEPPLLARDGGFIATGFDAELDEARSLRDEGRSVIARMQQEFA
FT                   ALTGITSLKIKHNNVLGYFIETTATHAEKMLSPPMSETFIHRQTTANQVRFTTVELSEL
FT                   ETKILNAGGRALEIEKRLYETLKSDILACSARIAQTASALAELDLTTALATLATTDGWV
FT                   RPKVDDSRAFAIENGRHPVVENALRQQSGDPFIANDCDLSAEEDAAQIYLLTGPNMAGK
FT                   STYLRQNAIIALLAQMGSFVPASCAHIGLISQLFSRVGASDDLARGRSTFMVEMVETAA
FT                   ILNQADDRALVILDEIGRGTATYDGLSIAWATLEHLHDVNKSRALFATHYHEMTALAGK
FT                   LPGVENATVTVKEWEGEVIFLHEVKMGAADRSYGVQVAQLAGLPPAVISRARAVLDMLE
FT                   KGEREGGATQKTLIDDLPLFSVAPAPAPAPAKTSDVEARLAEIHPDELTPKQALELLYQ
FT                   LKEAANP"
FT   gene            complement(415441..416004)
FT                   /gene="grpE"
FT                   /locus_tag="RD1_0424"
FT   CDS_pept        complement(415441..416004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="RD1_0424"
FT                   /product="GrpE protein HSP-70 cofactor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30139"
FT                   /db_xref="GOA:Q16D04"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D04"
FT                   /protein_id="ABG30139.1"
FT                   /translation="MAEPKNEEFLDDIEEAEADAFAEEMEEIDEEALEVEQLRAERDQL
FT                   KDRFMRALADAENARKRSERDRREAENYGGSKLSRDMLPVYDNMKRALEAVTDEQREQN
FT                   AALLEGIELTMRELLSVFKKHGIEIVAPEVGDRFDPQYHQAMFEAPLPGTKAGDIIQVS
FT                   AEGFMLHDRLLRPAQVGVSSTPAS"
FT   gene            complement(416014..417048)
FT                   /gene="hrcA"
FT                   /locus_tag="RD1_0425"
FT   CDS_pept        complement(416014..417048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="RD1_0425"
FT                   /product="heat-inducible transcription repressor HrcA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30140"
FT                   /db_xref="GOA:Q16D03"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D03"
FT                   /protein_id="ABG30140.1"
FT                   /translation="MNERSREVFRRVVEGYLADGAPVGSRTLTRDFSEKVSAATIRNTM
FT                   QDLEYLGLLDSPHISAGRIPTQMGLRMFVDGLLEIGDPDEMDREKIDATLSSNSEDVSG
FT                   LLDRVGSALSGVTQGASLVMTPKHEAPIKHIEFVSLSPDRALVVLVFADGHVENRLFSP
FT                   PAGQTPSSMREAANFLNALIEGKTLSEVHGAIQKEIRNRRQEIDSLAQALVESGMAVWE
FT                   REGDQNERLIVRGRSNLLTGDGEGEDFERIRLLFDDLERKRDIAEFLERTEEGEGVRIF
FT                   IGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVNYTAQLVGKLI
FT                   ADRS"
FT   gene            417192..417905
FT                   /gene="rph"
FT                   /locus_tag="RD1_0426"
FT   CDS_pept        417192..417905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="RD1_0426"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30141"
FT                   /db_xref="GOA:Q16D02"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16D02"
FT                   /protein_id="ABG30141.1"
FT                   /translation="MRPSGRELNEMRPVSIETGFTKHAEGSALIKIGDTHVLCTATIED
FT                   RVPPFIKGSGLGWVTAEYGMLPRATNTRMRRESTAGKQGGRTVEIQRLIGRSLRAGVDR
FT                   VALGERQITVDCDVLQADGGTRCASITGGWVALRLAVNKLMKAGDVISDPLVDPVAAIS
FT                   CGIYAGQPVMDLDYPEDSEAGVDGNFIMTGSKQLIEVQMSAEGATFSRDQMNQLMDLAE
FT                   KGVGELVAAQKAATA"
FT   gene            417902..418513
FT                   /locus_tag="RD1_0427"
FT   CDS_pept        417902..418513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0427"
FT                   /product="Ham1 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30142"
FT                   /db_xref="GOA:Q16D01"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D01"
FT                   /protein_id="ABG30142.1"
FT                   /translation="MTRKFDGKRILIATHNAGKLEEMQQLFAPYGVDVVGAAEMGLAEP
FT                   EETESTFIGNARIKARAAVEATGLPALADDSGIEVEALNNAPGVYTADWAETPNGRDFV
FT                   MAMTKTHTKLEEINAPHPRRARFRATLVLAWPDGHDEVFDGRVNGTLVWPIRGKTGHGY
FT                   DPMFQPDGHDMTFAEMDPAEKNRISHRADAFQKLIAGCFG"
FT   gene            418506..419663
FT                   /gene="hemN"
FT                   /locus_tag="RD1_0428"
FT   CDS_pept        418506..419663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="RD1_0428"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30143"
FT                   /db_xref="GOA:Q16D00"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q16D00"
FT                   /protein_id="ABG30143.1"
FT                   /translation="MAEDWEHGGFGLYIHWPYCEAKCPYCDFNSHVVRRIDQTAWRDAY
FT                   LTELRRTARETQGRVLRSVFFGGGTPSLMDPDTVAVVISEVRKLWPVANDLEITLEANP
FT                   SSVEAGRFAAFRQGGVTRISMGIQALNDDDLRRLGRIHTVTEAQTAFDIARSEFDRVSF
FT                   DLIYARQGQSLHAWEQELKQALEMAVDHLSLYQLTIEQGTAFGDRYNAGKLRGLPDEDL
FT                   SADLYTLTQDLCGAAGMPGYEVSNHARDGAHSRHNLIYWRYGDYLGIGPGAHGRLTVNG
FT                   QRYATECYSNPAKWLAAVGDEHTEKPRGPLTYQDQASEFLLMGLRLKEGIDTHRYETLA
FT                   GKALDSHAVSELADLGMVSTTEDRITVSDQGFIILNAVIARLLET"
FT   gene            complement(419660..420556)
FT                   /gene="parB"
FT                   /locus_tag="RD1_0429"
FT   CDS_pept        complement(419660..420556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="RD1_0429"
FT                   /product="chromosome partitioning protein parB"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30144"
FT                   /db_xref="GOA:Q16CZ9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CZ9"
FT                   /protein_id="ABG30144.1"
FT                   /translation="MAVGTDRKRGLGRGLSALMSDVAEAESPPAPGVPMSNQKIPIDQI
FT                   SPNPDQPRKQFTDSDLDDLTASIKEKGVIQPLIVRKTGVDQFEIVAGERRWRAAQRAQL
FT                   HELPVVIREFTDVEVLEVAIIENIQRADLNPIEEAAGYRQLMDRFGHTQEKMAEALGKS
FT                   RSHIANLLRLLTLPDPVLQMVREGGLSAGHARALIPAQDPLKLAQQIVKGGLSVRAAEA
FT                   LVKKERSSSDDAPRPAAKPASAEKDADTKALEGDLSASLGMKVELTHKPGHESGHMTLH
FT                   YKSLDDLDELCRILSGA"
FT   gene            complement(420566..421375)
FT                   /gene="parA"
FT                   /locus_tag="RD1_0430"
FT   CDS_pept        complement(420566..421375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="RD1_0430"
FT                   /product="chromosome partitioning protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30145"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CZ8"
FT                   /protein_id="ABG30145.1"
FT                   /translation="MSDLSRPFGPKIIAVANQKGGVGKTTTTINLAAALAEAGRRVLVV
FT                   DLDPQGNASTGLGIEVEDRKYTTYDILLGDVDIKDVVLQTVTPNLLIVPATVDLSSADL
FT                   ELMSSEKRSFLLHDALRQIEMDGFNLDYVLIDCPPSLNLLTVNAMIAAHSVLVPLQSEF
FT                   FALEGLSQLMLTIREVRQTGNKDLRIEGILLTMYDKRNNLSLQVEQDARDNLGDMVFST
FT                   RIPRNVRVSEAPSFAMPVLTYDTMSKGAQAYRALAKELIQKHRVKVA"
FT   gene            complement(421368..421967)
FT                   /gene="gidB"
FT                   /locus_tag="RD1_0431"
FT   CDS_pept        complement(421368..421967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="RD1_0431"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30146"
FT                   /db_xref="GOA:Q16CZ7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CZ7"
FT                   /protein_id="ABG30146.1"
FT                   /translation="MDASTVSRETMHALQMYHDLLLKWNARINLISKSSIEDVWSRHIW
FT                   DSAQVVDCVAKAKTWVDLGSGGGMPGIVVAIFAKNIDPDRRVILVESDQRKAAFLRTVI
FT                   RELSLNARVIVERIEDVAPLRADVVSARALADLSVLLSFAQRHLSAQGTALFMKGQSWE
FT                   KEVSSAQETWSFDLKAHRSKTSPAAAILEIKEIQRV"
FT   gene            complement(421979..423850)
FT                   /gene="gidA"
FT                   /locus_tag="RD1_0432"
FT   CDS_pept        complement(421979..423850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="RD1_0432"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30147"
FT                   /db_xref="GOA:Q16CZ6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CZ6"
FT                   /protein_id="ABG30147.1"
FT                   /translation="MFHVKHFDVLVIGGGHAGTEAAHAAARMGSQTGLITMSRSGIGVM
FT                   SCNPAIGGLGKGHLVREIDALDGVMGRVADQAGIQFRLLNRRKGPAVQGPRAQSDRAIY
FT                   HNRMLEATDQQQNLDIIVGEAVDFVMDGERVIGVVLQDDAEILAKTVILTTGTFLRGVI
FT                   HIGDVSRSGGRMGDKASVRLADRIDSFGLPMGRLKTGTPPRLSSKSINWDVLEEQPGDD
FT                   EPTLFSFLSKGVSARQVSCGITHTNVRTHDIIRDNITRSAMYGGHIDGVGPRYCPSIED
FT                   KIIRFADKESHQIFLEPEGLNTDAVYPNGISTSLPQDVQSEYVHSIVGLEKAIILQPGY
FT                   AIEYDYVDPRALDSSLSVLSVPGLYLAGQINGTTGYEEAAAQGLVAGLNASLEARGSDP
FT                   ITFSRSDSYIGVMIDDLTTRGVMEPYRMFTSRAEFRLSLRADNADQRLTPIGLALGCVS
FT                   DERKQAFEVKIEALDRARRLLTESSYTPKQAGEAGISVSHDGSRRTAMQLLAFPNTSFK
FT                   DLSLLDPVFDGIDVETQQQMEREALYATYIERQQKDVDLLKKDEGHKIPADFDYDQLSG
FT                   LSNELKSKLNSTRPTSLAQVGRIDGMTPAALTLILAKLRQSSKKRSA"
FT   gene            complement(423855..425141)
FT                   /gene="trmE"
FT                   /locus_tag="RD1_0433"
FT   CDS_pept        complement(423855..425141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="RD1_0433"
FT                   /product="tRNA modification GTPase TrmE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30148"
FT                   /db_xref="GOA:Q16CZ5"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CZ5"
FT                   /protein_id="ABG30148.1"
FT                   /translation="MDTVFALGSAQGRAGVSVIRLSGPAAWAVAETICGSLPDPRKSAV
FT                   RVLRAQDGSVIDQALVLAFKAPHSFTGEDVVEFHVHGSIAVVRTVLDALSDQDVARLAE
FT                   AGEFTRRALENGKLDLSQVEGLADLIDAETEAQRRQAVRVLTGALGEKVEVWRSKLIRA
FT                   AALIEATIDFADEDVPVDVTPEVTSLLEDVSSDVRTEVAGTHVAERIRSGFEIALVGAP
FT                   NAGKSTLLNKLAGRDAAITSEIAGTTRDVIEVRMDLGGLPVTFLDTAGLRQSADEIETI
FT                   GIERAIKRAQEADLRVFLSGPDERLLIEPLEDDIRLTPKVDLAPGSQTGISGKTGQGIP
FT                   ELLEKIRSVFSERVSAVGLATHERHRLAMQRALEDLDNSFEALLRGPEFYDITAQELRS
FT                   AIRALETLVGRIDAENLLDEIFSSFCLGK"
FT   gene            complement(425171..426439)
FT                   /gene="rho"
FT                   /locus_tag="RD1_0434"
FT   CDS_pept        complement(425171..426439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="RD1_0434"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30149"
FT                   /db_xref="GOA:Q16CZ4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CZ4"
FT                   /protein_id="ABG30149.1"
FT                   /translation="MTETLNLADLKRKSPKDLLSMAEDLEIENASTMRKGEMMFQILRE
FT                   RADEGWEVSGDGVLEVLQDGFGFLRSPEANYLPGPDDIYVSPDMIRKYSLRTGDTIEGL
FT                   IKAPDDNERYFALLGVTQINFEDPEKARHKVAFENLTPLYPDERLTMETDDPTTKDRSA
FT                   RIIDLVAPIGKGQRSLIVAPPRTGKTVLLQNIANSIERNHPECYLIVLLIDERPEEVTD
FT                   MQRSVKGEVVSSTFDEPATRHVAVSDMVIEKAKRLVEHKRDVVILLDSITRLGRAFNTV
FT                   VPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFK
FT                   GTGNSEIVLDRKIADKRVFPAMDILKSGTRKEDLLVDKIDLQKTFVLRRILNPMGTTDA
FT                   IEFLISKLKQTKTNSDFFDSMNT"
FT   gene            complement(426595..427044)
FT                   /locus_tag="RD1_0435"
FT   CDS_pept        complement(426595..427044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30150"
FT                   /db_xref="GOA:Q16CZ3"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CZ3"
FT                   /protein_id="ABG30150.1"
FT                   /translation="MSDLLAIGYPWIKSFHIMSVIAWMAGLFYLPRLYVYHTEQVGQSG
FT                   DTHVLFQTMELKLLRVIMNPAMIATWVFGICLVLTPGIVDWSSIWPWLKFLGVFGMTAF
FT                   HMWLAKKRKVFAAGENQLTGKQYRMMNEVPTILMVIIVISVVVKF"
FT   gene            427268..427366
FT                   /locus_tag="RD1_0436"
FT   CDS_pept        427268..427366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30151"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CZ2"
FT                   /protein_id="ABG30151.1"
FT                   /translation="MDQSAEQIYTGIDLILLPGWTVSLSGHETIVL"
FT   gene            427445..428044
FT                   /gene="maf"
FT                   /locus_tag="RD1_0437"
FT   CDS_pept        427445..428044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="RD1_0437"
FT                   /product="septum formation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30152"
FT                   /db_xref="GOA:Q16CZ1"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CZ1"
FT                   /protein_id="ABG30152.1"
FT                   /translation="MPQPLILASTSEIRAKMLSNAGVPHTTSGARIDEEMVKEALLAEQ
FT                   ASPRDIADTLAEMKARKISDKTPGAIVLGCDQVLDHRGVLLSKPVDSHDALTQLQALRN
FT                   DRHTLLSAAVICEDGKPVWRHVGVVRLRMHDVSDAYLQDYVARNWDSIRHAVGAYKLEE
FT                   EGVRLFSRIDGDYFTVLGLPLLELLSYLALRGDLPR"
FT   gene            428041..428874
FT                   /gene="aroE"
FT                   /locus_tag="RD1_0438"
FT   CDS_pept        428041..428874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="RD1_0438"
FT                   /product="shikimate 5-dehydrogenase, putative"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30153"
FT                   /db_xref="GOA:Q16CZ0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CZ0"
FT                   /protein_id="ABG30153.1"
FT                   /translation="MSMTKIPLAGVMGAPIAHSKSPQLHRHWLETYGISGFYVPMEVKA
FT                   ADVEHVLRTLPKMGFVGLNVTLPHKEAVLKLADQITDRARLIGAANTLTFGKDGEIHAD
FT                   NTDGYGFLENLRSGATDWTPSQGPAVVLGAGGAARAVIVALLDAGVPEIILTNRTRARS
FT                   DQLQSDFGNRVRVMDWTQISGVLHEAQLLVNTTSLGMVGKPEMEASLDGLQAHTTVTDL
FT                   VYNPLKTRLLEVAEEKGCVTVDGLGMLLHQGVPGFERWFGRRPDVTDATRAAVLG"
FT   gene            428871..429464
FT                   /gene="coaE"
FT                   /locus_tag="RD1_0439"
FT   CDS_pept        428871..429464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="RD1_0439"
FT                   /product="dephospho-CoA kinase, putative"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30154"
FT                   /db_xref="GOA:Q16CY9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY9"
FT                   /protein_id="ABG30154.1"
FT                   /translation="MTFKLGLTGSIGMGKSTTAQLFVELGCALWDADAAVHRLYVEGGA
FT                   AVAPIGAIYPTVIHKNSVSRDALRDLIQNDPSVLRRIEKIVHPLVGADRTEFLDQTKSD
FT                   ITVLDIPLLFETGADSDMDAVACVRTTAEEQERRVLARGKMTAKQFQQIRHKQMPNAEK
FT                   CARADFVIETDTLEHARAQVQTITEQIRRAIADA"
FT   gene            429457..430143
FT                   /gene="dnaQ"
FT                   /locus_tag="RD1_0440"
FT   CDS_pept        429457..430143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="RD1_0440"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30155"
FT                   /db_xref="GOA:Q16CY8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY8"
FT                   /protein_id="ABG30155.1"
FT                   /translation="MREIVLDTETTGFDPESGDRIVEIGAVELMGHVATGRTYHQYINP
FT                   ERSMPEEAFQVHGLGDDFLRDKPKFAEVGQAFLDFIGDAKLVIHNAAFDIKFLNAELGW
FT                   INLPKIPWEQAIDTLDIARKRFPGSPASLDALCRRFGIDNTSRTLHGALLDSEILAEVY
FT                   LELIGGRQPDFGLSNIPQKSAGDTSVDWTPRPRPTPLPSRITEEEAAAHADFVAKLGDD
FT                   AVWLKT"
FT   gene            complement(430146..430646)
FT                   /gene="secB"
FT                   /locus_tag="RD1_0441"
FT   CDS_pept        complement(430146..430646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RD1_0441"
FT                   /product="protein-export protein SecB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30156"
FT                   /db_xref="GOA:Q16CY7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CY7"
FT                   /protein_id="ABG30156.1"
FT                   /translation="MAEEEEAKTEANGQQQAPQMRVLGQFIRDMSFENIMAQKGAPSDA
FT                   QPDVQVQVNLDAKKRTADNQYESAIKLNVTSKVKDGDATLFVLELDYVGIFHVDNVPDE
FT                   QLHPFLLIECPRMIFPFLRRIVSDITRDGGFPPLNLENIDFLSLYRNELARRQSSEAPK
FT                   MDA"
FT   gene            complement(430700..431191)
FT                   /gene="fxsA"
FT                   /locus_tag="RD1_0443"
FT   CDS_pept        complement(430700..431191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="RD1_0443"
FT                   /product="FxsA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30157"
FT                   /db_xref="GOA:Q16CY6"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY6"
FT                   /protein_id="ABG30157.1"
FT                   /translation="MWLFIAFLAIPLLEIALFIQIGGAIGLGWTLATVVVTAVLGTFLV
FT                   RNQGALALGQVKSSFNQMQDPTEPLAHGAMILFSGALLLTPGFFTDTIGFLLLIPAVRA
FT                   SAFRAIKARVSIASFEAANHTHRPRRPGHGQPDDVIDGDYTEVKTEADQNKRPSGWTDH
FT                   "
FT   gene            431296..431958
FT                   /locus_tag="RD1_0444"
FT   CDS_pept        431296..431958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30158"
FT                   /db_xref="GOA:Q16CY5"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY5"
FT                   /protein_id="ABG30158.1"
FT                   /translation="MNSSPLIQLLVLAGIAVFLIFRLKNVLGTRDGFEPGPAQAPTSDR
FT                   SPTRDFEVIEGGPDLDITDHVDEHSDAAEALANMKRLEPGFNVTEFLGGARGAYEMIVM
FT                   GYENGELADIQPFLAEDIYESFVDGVAAREDQGLTIEANFIGVRELKLIDATLDPDTNE
FT                   AELTIRFTAELTSAVRNSEGEIIEGSLTDVKRQKDTWSFARPMGSDDPNWILVSTDG"
FT   gene            432097..432687
FT                   /locus_tag="RD1_0446"
FT   CDS_pept        432097..432687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0446"
FT                   /product="Smr domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30159"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY4"
FT                   /protein_id="ABG30159.1"
FT                   /translation="MTRRRLKPDEVELWQKVTENTQALRQTQTFDPEAYAPQHVKRDVH
FT                   LPVEIKLDGKTPPKPAARKIEYDLAPSLPDRLNKAPVQMDRKTFAKMNRGKLKPEGRID
FT                   LHGMTLDRAHTALSRFILSSHGAGKRLVLVITGKGKNRDEGGPIPVRHGVLRHQAPQWL
FT                   ATPPLSSVVMQVSQAHVSHGGGGAYYVYLRRGR"
FT   gene            complement(432684..433901)
FT                   /locus_tag="RD1_0447"
FT   CDS_pept        complement(432684..433901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0447"
FT                   /product="transmembrane transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30160"
FT                   /db_xref="GOA:Q16CY3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY3"
FT                   /protein_id="ABG30160.1"
FT                   /translation="MGYIRFVIENRLFLLAGFLLCFTSSFGQTYFISLFAGEIKDSFSL
FT                   TDGDWGAIYTVGTTLSAITIIWAGALTDRFRVRHLSFGVMVLLALACMAMAFVPSGFLL
FT                   VIVVYALRLMGQGMMSQLGAVAMSRWFVAARGRAISLASMGFAVGQAVLPIIFVALLLQ
FT                   FDWRNLWMLAAVCIIVLIPVMQLLLRQERTPQSMAETAQSLGMQGKHWTRGELLRHPLF
FT                   YMMIPLILGPAAWGTALFFQQVHLTEVKGWSLVSFVALMPIYTVSTIAFTFVTGWAVDR
FT                   FGVKWVVPFQMLPFALSFAVLAFADTIWMAGVGLVIFGMGQGMQGTATTAFWAVFYGTK
FT                   HLGAIKAAGAALMVFGSAIGPGVTGAFIDWGVDFPEQMIPIAVFYVAGALLAGLGILRY
FT                   QRDLPG"
FT   gene            complement(433940..435247)
FT                   /gene="hslU"
FT                   /locus_tag="RD1_0448"
FT   CDS_pept        complement(433940..435247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RD1_0448"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30161"
FT                   /db_xref="GOA:Q16CY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CY2"
FT                   /protein_id="ABG30161.1"
FT                   /translation="MTDLTPREIVSELDRFIIGQNDAKRAVAVALRNRWRRKQLADDLR
FT                   DEVYPKNILMIGPTGVGKTEISRRLAKLARAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   DNAISMTRDHMRDDVKANAHQAAEERVITAIAGEDARESTREMFRKKLKAGDLDDTVIE
FT                   LDVADTSSPFPMMDIPGQPGGNMGMMNLGDIFGKALGGRTTRKKMTVSQSYDILIGEEA
FT                   DKLLDDETVNRAAIEAVEQNGIVFLDEIDKVCAKSDTRGGDVSREGVQRDLLPLIEGTT
FT                   VSTKHGPIKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELRALTEEDFVRILTETD
FT                   NALTLQYTALMGTEEVTVSFTEDGIAALAKIAAEVNQSVENIGARRLYTVMERVFEELS
FT                   FSAPDRAGEEIIVDAAFVDENLGALAKSTDVSRYVL"
FT   gene            complement(435339..436451)
FT                   /locus_tag="RD1_0449"
FT   CDS_pept        complement(435339..436451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30162"
FT                   /db_xref="GOA:Q16CY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CY1"
FT                   /protein_id="ABG30162.1"
FT                   /translation="MRLYQREPDGRNNQRMIGKDDIRAAVGAGILSEAQAASLTSLADS
FT                   RRGARENLDPGDEPFELFRGFNEVFIVIGLGILALGWIGIVSFGALEYISSVQTYMIVT
FT                   SVLGAVVIWLLSEYFIRRRRMVAPAIALSLMFGGNALYGFISGFGELFMLAQEDYSSLP
FT                   LPLALSTLALLLFWFRFRVPFALAVIALCAFLVSVLIAGNSAGAPEDLRSMFLLSAGGP
FT                   FAFITLGLGLIVFVIAMVFDMSDPHRVTRRSANGFWLHVVAAPALVNTIALSLLTETAG
FT                   GSNLMLLLVLTLIALIAIIIDRRSFLIAAIGYIVILSNTVFDGRQAVFTVFSLGVFLVF
FT                   LGARWERIRAFLMKRMPGFIPRHRLPPAGG"
FT   gene            complement(436403..436960)
FT                   /gene="hslV"
FT                   /locus_tag="RD1_0450"
FT   CDS_pept        complement(436403..436960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RD1_0450"
FT                   /product="ATP-dependent protease hslV"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30163"
FT                   /db_xref="GOA:Q16CY0"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CY0"
FT                   /protein_id="ABG30163.1"
FT                   /translation="MARDEFPGWHGTTIIGVKKGGEVVIAGDGQVSLGQTVIKGTARKV
FT                   RRLSPGGFDVVAGFAGSTADAFTLLERLEAKLEATPGQLARASVELAKDWRTDKYLQKL
FT                   EAMLIVSDGKDIFVITGAGDVLEPEHDVTAIGSGGNYALAAARGMMDSPRSAEEVARDA
FT                   MAIAADICVYTNGNLTVETISA"
FT   gene            complement(437073..437393)
FT                   /gene="trxA"
FT                   /locus_tag="RD1_0451"
FT   CDS_pept        complement(437073..437393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="RD1_0451"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30164"
FT                   /db_xref="GOA:Q16CX9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX9"
FT                   /protein_id="ABG30164.1"
FT                   /translation="MATLAVTDDTFDAEVKNSDIPVVVDFWAEWCGPCKQIGPSLEELS
FT                   AEMDGKVKIVKVNVDENPNSPAQMGVRGIPALFIFKDGQVVSNMAGAKPKAALQGWIED
FT                   NI"
FT   gene            complement(437431..440808)
FT                   /locus_tag="RD1_0452"
FT   CDS_pept        complement(437431..440808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0452"
FT                   /product="ATP-dependent DNA nuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30165"
FT                   /db_xref="GOA:Q16CX8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX8"
FT                   /protein_id="ABG30165.1"
FT                   /translation="MTPRHPATQAQVDAARPDASTWLAANAGSGKTRVLTDRVARLLLD
FT                   KVAPEHILCLTYTKAAASEMQNRLFKRLGEWAMLQDDALAEALRDLGVETAVDAEKLRK
FT                   ARTLFARAIETPGGLKIQTIHSFCASLLRRFPLEARVSPQFTEIEERAADLLRAEIIDT
FT                   MAEGPDAAVIADLAQHYTGENFVKLAKAVVQHKDGFRTPLSWEESLALFDQPADLTAKH
FT                   IEDQVFLGDEAALFDTLIPPMQAKGGNDAKTAVKLKKISGLNFSALPALEEIFLTGRKA
FT                   KPPFRAKIGTLPTKPTQDVVSDAMPALDDFMCRVETARDARVGLLAAQKTYALHRFAGS
FT                   FLPLYEEQKTLRGWLDFDDLIDRARALLSDEDVAAWVLFRIDGGIDHILVDEAQDTSPA
FT                   QWDVIRKLAAEFTSGEGARQEVQRTVFVVGDKKQSIYSFQGADPREFDRMQAEFASKIE
FT                   AAEQLFQNKTLAFSFRSASAILGVVDRTFDGLTDAGFTTDEQHIAFKQTLPGRVDIWPV
FT                   VEPQPSEEDRAWHDPIDRKAAHHHSVILAERVATQIKAMIAHDTIPDEKRSDGKITRRP
FT                   VQAGDFLILVQRRSVLFTEIIRACKNKDLDIAGADRLKVGGELAVRDLAALLSFLAVPE
FT                   DSLSLASTLRSPLFGWSEKELFQLAHHREHDHLWQALRMRSDAYPETLKVLRDLRANVD
FT                   FLRPYDLIERILTRHNGRRNLLARLGVEAEDGINALLSQALAYERNAVPSLTGFLVWME
FT                   TDDLEIKRQIDSASNQIRVMTVHGAKGLEAPIVILPDSGKRNNPVRDDIIILDDKPVWK
FT                   TPANDTPGAMAAALDEIAAAQAAERLRLLYVALTRAEKWLIVAAAGELSKQNDTWYQRV
FT                   DAAVDAAGARLVDMHGLAVKRHQKGDWEALPLSEANQNTTVQATLDPCFTTRAPARAPL
FT                   RETVSPSDLGGAKALPGEAGQDEEAAKAYGTSVHLFLEHLSAADPSDWPALVDVLSDNG
FT                   DPDLLRAASEAKTVLQDPNLAHLFTPDSLAEVAVTAEFGSARLHGIIDRLVVSDTAVLA
FT                   VDFKTNQTVPSQPATCPEGILRQMGAYTHALKQVYPDRKIETAILWTRNCTLMHLPHDI
FT                   VTQALQNTLYLDDGATPS"
FT   gene            complement(440805..443762)
FT                   /locus_tag="RD1_0453"
FT   CDS_pept        complement(440805..443762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30166"
FT                   /db_xref="GOA:Q16CX7"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX7"
FT                   /protein_id="ABG30166.1"
FT                   /translation="MFEHSDTPRVFGLAPGVDFPKGLIEGLLARVAQGAPEDLARVQLI
FT                   VNTSRMQRRLRSLFDAGPARLLPKIHLVTELDRLAPGLAVPPAVKPLQRRLELIALVAR
FT                   LIEQQKGLAPRASLYDLTDSLAALMDEMQGEGVTAETINSLDVSDISGHWQRTQTFIRI
FT                   VQDYLAQTTTTPDKEAQQRQFVCALAERWAVEPLRHPVILAGSTGSRGTTMLLMEAIAR
FT                   LPQGALILPGFDFDMPHQQWLHLDDALLSEDHPQYRFYKLMQNIGVGRSDITPWHDAPP
FT                   PSPARNALVSLSLRPAPVTDAWLTEGPKLHDLNKATDQITLLEAPSPRSEALAIALRLR
FT                   KAVEEGQKAAVITPDRMLTRQITAALDQFDILPDDSAGAPLHLSPPGRFLRHVAALFHR
FT                   RLDAEALLTLLKHPLTHSGSNRAAHILNTQRLELRIRRDGLPYPDADSIGQALAGISPN
FT                   ADHQRGVDAWGAWVGQTFAAMYSTTEQPLSHWAQTHIALAEAISCGLDGQDTGELWKQK
FT                   AGQEALKVMTNLAELAHHGGPMTASDYANLVGALLSEGEVRDRDAPHPDIMIWGTLEAR
FT                   VQGADLVILAGLNDGTWPEAPAPDPWLNRALRHQAGLLLPERRIGLAAHDYQQAIAAPE
FT                   VWLTRSIRSDDAETVASRWVNRLCNLLSGLKGQDGPALLEAMQDRGQYWLDQTVALEKV
FT                   EPATPAARPAPRPPLAARPKRLAVTDIKHLIRDPYTIYAKHVLRLRKLGPLVQNPDALL
FT                   RGTVSHDVMEKFVRQTLRDPATLNADHLIEIARDVLSRDVPWPAARALWLARLTRISEW
FT                   FVMNERARQHIGTPVVFEDDALGKMVWPDIEFTLTARADRIDQTEDGDALIYDYKTGSP
FT                   PTVKQQTLFDKQLLIEAAMVEQGAFEKLGPHHVAQATFIGLGSNPVEVPAPLDSEPPAQ
FT                   ILAELRMLVLAYKEMDQGFTARRMMEKDQYGSDYDLLSRYGEWDITQDPVPEELS"
FT   gene            complement(443755..444438)
FT                   /locus_tag="RD1_0454"
FT   CDS_pept        complement(443755..444438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0454"
FT                   /product="nucleotidyltransferase family protein, putative"
FT                   /EC_number="2.7.7.13"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30167"
FT                   /db_xref="GOA:Q16CX6"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX6"
FT                   /protein_id="ABG30167.1"
FT                   /translation="MGWSVMLFAAGFGNRMKHLTADRPKPMVEVAGRPLIDHARALTDE
FT                   LPAERVVANLHYKADILQAHLHGTNVQTIVETPDILETGGGLRNALPLLGSGPVMTLNT
FT                   DAIWKGVNPLDQLQKEWDPDRMDGLLMCIPPQNAVGYDGPGNFLIGANGRIERGDGSIY
FT                   SGAQIIKTERLADIDRPSFSLNILWDMLMAENRLYAMEYAGLWCDVGHPQGVTNAEALL
FT                   GYRHV"
FT   gene            complement(444423..445442)
FT                   /locus_tag="RD1_0455"
FT   CDS_pept        complement(444423..445442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30168"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX5"
FT                   /protein_id="ABG30168.1"
FT                   /translation="MTRAAQAKAFIAQAGWQNATVTPLAGDASNRRYDRLTRANGETSV
FT                   LMDAPPANNTNVSAFVQIATYLRTLGLSAPRIMHEDSDAGFLLIEDLGDTLFTHQIADN
FT                   PALEELLYETSVDVLTHLHQNAPPKLGSYASPVTLPLAALAFDWYQLGATGTVDNDAKR
FT                   HFMSMLEPLLAQYDTDLTVLIQRDYHAENLLWLPERNGVARVGLLDFQDAVLGHRSYDL
FT                   MSILQDARRDVDPQLETDMKARFVAQNALDPQAFDAAYAVFGLQRNMRILGVFSRLCMR
FT                   DAKSHYVDFIPRVWGHLMTNLNHPMLEPAAELITASLPEPTCDICATLTSKSGQWAGR"
FT   gene            complement(445439..445915)
FT                   /locus_tag="RD1_0456"
FT   CDS_pept        complement(445439..445915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30169"
FT                   /db_xref="GOA:Q16CX4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX4"
FT                   /protein_id="ABG30169.1"
FT                   /translation="MVCTPRTVTVGSAEETAQLAVALGVRLRPGDTLLLDGAVGAGKTH
FT                   FARHMIQSLLREPEDVPSPTFTLVQTYDTSSGSLWHADLYRLSSVYEIEELGLSEAFDT
FT                   AICLIEWPDRLGQLTPNDALFLRFTQGATDDSRIVTARWTDPKWNAPLQDWNAL"
FT   gene            complement(445966..447444)
FT                   /locus_tag="RD1_0457"
FT   CDS_pept        complement(445966..447444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0457"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30170"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX3"
FT                   /protein_id="ABG30170.1"
FT                   /translation="MLSKQQQAAPGTSLQPSDSENRVSFLFEDENLEHASETAAKLYKL
FT                   IPGHDDWTGMRERLVNRFPNLPERPLAAQSGQTTVPARDIEDAAILEVTRAGAFTRINM
FT                   VENEVQTSAQSLRFKNLQHELEDLRRASDTTPHAIWQVDSEGSVTWHNAAYTGLYNRLH
FT                   QKEPDPVKPVFDVAPSFHEKSGRQRVSAQLPDNEHVDWYDVTVASVGDIMIFHAIDVNA
FT                   VVKSEAAQRNFVQTLAKTFAQLSIGLAIFDRNGQLALFNPALIDLTELPADFLSGRPTL
FT                   MSFFDRIRENRRMPEPKNYHSWRQQITDVIAAATDGRYQETWTLETGQTYRVSGRPHPD
FT                   GAIAFLIEDISAEVSVTRNFRAELELGQSLMDTFDEALVVFSSTGVLTFCNLAYRELWG
FT                   LDPDNSFADVTINDSVRAWQEDCAPNKLWDGLIDFVLDFGEKTSWDMTARLHSGAEVKC
FT                   TVSRISSGATVVRFALLEQAGAPALKQPSNTQSD"
FT   gene            complement(447622..449000)
FT                   /pseudo
FT                   /gene="regB"
FT                   /locus_tag="RD1_0459"
FT   CDS_pept        complement(447622..449000)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regB"
FT                   /locus_tag="RD1_0459"
FT                   /note="sensor histidine kinase RegB"
FT   gene            449092..449715
FT                   /gene="senC"
FT                   /locus_tag="RD1_0460"
FT   CDS_pept        449092..449715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="senC"
FT                   /locus_tag="RD1_0460"
FT                   /product="SenC protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30171"
FT                   /db_xref="GOA:Q16CX2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX2"
FT                   /protein_id="ABG30171.1"
FT                   /translation="MNTRFIALISVAGVVGVLGGLWLATQSSKSDDQFAQCRSSTVAGG
FT                   AGALGGPFELVNAQGETVTDADVITEPSILYFGYTFCPDVCPLDVARNAVAVEVLEENG
FT                   MSVTPVFISIDPKRDTPEVVGDFAANMHERMIGLTGSPEQVKAASTAYRTYYKAHEGDE
FT                   DYYLVDHSTFSYLVLPEHGFVEFFRREVAPEQMAETVACFVENA"
FT   gene            449812..450366
FT                   /gene="regA"
FT                   /locus_tag="RD1_0461"
FT   CDS_pept        449812..450366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regA"
FT                   /locus_tag="RD1_0461"
FT                   /product="photosynthetic apparatus regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30172"
FT                   /db_xref="GOA:Q16CX1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX1"
FT                   /protein_id="ABG30172.1"
FT                   /translation="MPDTNPIELGEDKSILLLDDDEPFLRRLAKAMEKRGFQVETAGSV
FT                   AAGRAIATARPPAFAVVDLRLEDGNGLDVVEVLREKRPDTRVVVLTGYGAIATAVAAVK
FT                   IGAVDYLSKPADATDIVNALLATGDDLPPPPENPMSADRVRWEHIQRVYELCDRNVSET
FT                   ARRLNMHRRTLQRILAKRSPR"
FT   gene            complement(450480..451067)
FT                   /locus_tag="RD1_0463"
FT   CDS_pept        complement(450480..451067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30173"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CX0"
FT                   /protein_id="ABG30173.1"
FT                   /translation="MKRAWQRMLSGRRLDLLDPTPVDVEIEDIARGLAFVARWNGQTSG
FT                   AHAYSVAEHSLLVETLFTRIADKSPAKWRLAALLHDAPEYVIGDMISPVKAAVGPGYEA
FT                   LDERLTAAIHLRFGLPAAIPVAVKRQIKKADKISAWMEATQIAGFSETEASKFFGTPDH
FT                   KIMQGLEITLRPPAETRDAFTARHNELLAAMP"
FT   gene            complement(451064..452053)
FT                   /gene="rfaI"
FT                   /locus_tag="RD1_0464"
FT   CDS_pept        complement(451064..452053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaI"
FT                   /locus_tag="RD1_0464"
FT                   /product="lipopolysaccharide 1,3-galactosyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30174"
FT                   /db_xref="GOA:Q16CW9"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW9"
FT                   /protein_id="ABG30174.1"
FT                   /translation="MSTAPAESFHVRLTASRPARHKRAIVFCCDQNYLVFAAHAAAQIA
FT                   SLVEKPEFDICICYGHQAVVLPDSLAGLGIRLCHVDVGDVFEGLRLDKGKTHDVYLRIA
FT                   LPTAFAGEYDKILYLDSDIFVQGGDFNALFDIDVAPHCIASVRDNVQWRTPKRQNKRNT
FT                   IKGIPPSAYFNAGVMLMDVQAYTEQELMRRCVEFGRARRRDLKRHDQNLYNAVLQNDWA
FT                   EISPVWNWQYSWSTRLFAVFAYPNIIHFIGPAKPWKDESGQFEPRFADSFDRFIRTHFS
FT                   GSRQVETGGRRLAPDSMKMTKMLIKHLITARKIAHYLARFPNELTVHR"
FT   gene            452305..453693
FT                   /gene="ahcY"
FT                   /locus_tag="RD1_0465"
FT   CDS_pept        452305..453693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="RD1_0465"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30175"
FT                   /db_xref="GOA:Q9ZNA5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZNA5"
FT                   /protein_id="ABG30175.1"
FT                   /translation="MTKDFIVKDIALAEFGRKELDIAETEMPGLMALRAEYGDSKPLAG
FT                   ARIVGSLHMTIQTAVLIETLVALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAIKGQS
FT                   LEEHWDYLDRSFMFEDGPNLILDDGGDATLYVLLGARAEAGEEIIPVPTSEEEEAIKAQ
FT                   IKKRMAASPGWFTKVRDQIKGVSEETTTGVHRLYDLVKQGQLPFPAINVNDSVTKSKFD
FT                   NKYGCKESLVDGIRRATDTMMAGKVAVVMGYGDVGKGSAASLRGAGARVKVTEVDPICA
FT                   LQAAMDGFEVVLLEDVVGSADIFITTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQV
FT                   AALKNHKWTNIKEQVDMIEMPNGNRLILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQ
FT                   IELWTRADAYDNEVYILPKHLDEKVARLHLDRIGVKLTPLDPEQAAYIGVKPEGPFKPE
FT                   HYRY"
FT   gene            453868..454233
FT                   /locus_tag="RD1_0466"
FT   CDS_pept        453868..454233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30176"
FT                   /db_xref="InterPro:IPR021274"
FT                   /db_xref="InterPro:IPR023154"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW7"
FT                   /protein_id="ABG30176.1"
FT                   /translation="MNQRGTFIMGKRDDLIAQYAEDLKNKCGMEPDMDLLTKVTIGCGP
FT                   AIYNADASTVASSQPSELETVKEKFLMKKLGLADGPELMEGINKVIETYGKSERNKYRA
FT                   VVYYMLTKHFGKEAVYA"
FT   gene            complement(454710..455132)
FT                   /locus_tag="RD1_0467"
FT   CDS_pept        complement(454710..455132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30177"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW6"
FT                   /protein_id="ABG30177.1"
FT                   /translation="MAYWLFKSEPSAWSWDDQVAKGEAGEEWDGVRNYQARNFMREMKV
FT                   GDLGFFYHSQKEKSIVGIVEVIAEAHPDSTTQDDRWECVDIKAVRAVKTPVSLEDVKQD
FT                   DRLADMALLKMSRLSVQPVRPEEWAIICEMAGVAEE"
FT   gene            complement(455132..455404)
FT                   /locus_tag="RD1_0468"
FT   CDS_pept        complement(455132..455404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0468"
FT                   /product="YCII-related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30178"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW5"
FT                   /protein_id="ABG30178.1"
FT                   /translation="MLVALIAHDKPGALPIRQENRPAHVEYLKSSTAVQQAGPLLDDAG
FT                   EMCGSLIILDVADMDEAKAWAQGDPYGAAGLFASVDLIPWNRVIG"
FT   gene            complement(455406..456368)
FT                   /gene="gpsA"
FT                   /locus_tag="RD1_0469"
FT   CDS_pept        complement(455406..456368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="RD1_0469"
FT                   /product="glycerol-3-phosphate dehydrogenase, putative"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30179"
FT                   /db_xref="GOA:Q16CW4"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CW4"
FT                   /protein_id="ABG30179.1"
FT                   /translation="MSVGILGAGAFGTALAISLGHTTPVTLWARDAKQAQVMQNTRENT
FT                   ARLPGFALPAGVKVTSNLADLQGCDVLLLAVPAQKLRQFLRGLDQMVAGKTLVTCCKGI
FT                   ELETGMGPVDIAREICPQSEHAILTGPSFANDIAKGLPTALTLACANPDRARQLQQELS
FT                   NGTLRLYRTSDVIGAQLGGALKNVIAIACGAAIGAQLGESARAALMTRGNAEMQRYAQH
FT                   KGADASTLSGLSGFGDLVLTCTSELSRNYRFGLALGAGKAFDPATTVEGAATACAVAQE
FT                   AREKALDMPISSVVAALVENRLDVENAMTKLLSRSLKEE"
FT   gene            complement(456365..457462)
FT                   /gene="gcp"
FT                   /locus_tag="RD1_0470"
FT   CDS_pept        complement(456365..457462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="RD1_0470"
FT                   /product="O-sialoglycoprotein endopeptidase, putative"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30180"
FT                   /db_xref="GOA:Q16CW3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CW3"
FT                   /protein_id="ABG30180.1"
FT                   /translation="MGRTQTVLALESSCDDTAAAVLRKGATGETQVLSSIVRGQDSLHA
FT                   AYGGVVPEIAARAHAEILDICVEDALQAAQTSLHDVDAIAVTAGPGLIGGVVSGVMCAK
FT                   GLALATGKPLYGINHLAGHALTPRLTDNVPFPYLMLLVSGGHCQFLLIKGPDDFKRIGG
FT                   TIDDAPGEAFDKIARLLALPQPGGPSVERSARQGDAKRFSLPRPLLDRPGCDMSFSGLK
FT                   TAVLRVRDGLVQDQGGLYPQDQADLSAGFQAAVVDVLAEKTSRAMQQYQQLSPTTATLC
FT                   VAGGVAANMAIRTRLETVARDNGAVFVAPPLALCTDNAAMIGFAALERMADHPPDDLTL
FT                   AARPRWPLDSKSPAMLGSGKKGAKA"
FT   gene            457543..458247
FT                   /gene="hemD"
FT                   /locus_tag="RD1_0471"
FT   CDS_pept        457543..458247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="RD1_0471"
FT                   /product="uroporphyrinogen-III synthase, putative"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30181"
FT                   /db_xref="GOA:Q16CW2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW2"
FT                   /protein_id="ABG30181.1"
FT                   /translation="MQKIPLILTRPKGSNAVFEADIAPKVRQHVDFIHSPLLEIVPIDG
FT                   GYDSTGADHAIFTSANGVKYAPKGNGRRAFCVGEKTTQLARSHGWDAVFAGATVLALKD
FT                   HVLINRPQGEIHHYSGVFVRGNVAEDLSVAGLRVTNIPLYEQRLLPFSAQALSVLERRA
FT                   PVVVPLFSPRTAAHFAAIAPAHPQLYVVAMSTAVADSCNEMSPARLIIAREPTAKSMAL
FT                   CVENLVLNHSLG"
FT   gene            458308..459795
FT                   /locus_tag="RD1_0472"
FT   CDS_pept        458308..459795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30182"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW1"
FT                   /protein_id="ABG30182.1"
FT                   /translation="MEDLAKSRKPNKATETVDQGAEKPIEAEEIVTTATETPDAESVLK
FT                   EEPEAKDSAEKDADADTIPSDTDAKDDGLVDEKPADIAEEKIENDTVEPAETVEALKEH
FT                   EAEDKPEEKSDAVDGEPWLDKDTPDEKAPDADTAEKPDSPWDKESDAEPVEEKPQEPEP
FT                   AVAEKPVAQPQPEVVRGSMWPAVFGGVIAALIGFIAGRGDTLDAYLPASMQRPVVDISA
FT                   LEAAAAEASERAAAQAALIEAQAARLDALEAVEPTDTLDIVAELEADIAALTAMVAALE
FT                   NQEPVTIQADNSEANEAIASLQTALEAQNEEIEALAERAAAAEAGAAREAAQILARAAL
FT                   TRVVTAVDSGQPFGTALADLEAVTPVEVPAPLQEAAENGVPTMAVLREDFPDVARSALM
FT                   AARAETPESEVVGITGFFQRQLNMRSVTPREGSDPDAVLSRVQAAVENGDLETALTEAE
FT                   TLPDAAKAVMADWLDAAQSRKAAQDAANELADSLNSN"
FT   gene            459807..461285
FT                   /locus_tag="RD1_0473"
FT   CDS_pept        459807..461285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30183"
FT                   /db_xref="GOA:Q16CW0"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CW0"
FT                   /protein_id="ABG30183.1"
FT                   /translation="MLWSLIKIILFVVAVAALAMGAVYLLESEGGVQVQVMGTEFTFSP
FT                   IQSVIAAVVLIFVVWLFLKLLSLLVACLRFLSGDETAISRYFDRSRERKGFQALSEGLM
FT                   ALASGEGRVAMNKAAKAERYLNKPELTNLLVAQAAEMAGDRRKAEETYKKLVTTDATRF
FT                   VGVRGIMKQKLADGDTDTALQLAEKAFAIKPKHEEVQDVLLRLQAQKEDWSGARKTLSA
FT                   KLKYGNLPRDVHRRRDAVLALSEAKDILSDASSIDVQEKAIEANKLSPDLIPAAVMAAG
FT                   GYVEQNRPRLAVRLLKKAWEVHPHPDLAAAFAAIEPNETPAERIKRFMAITRIKPENPE
FT                   TKMLLAELHIANEDFPEARRALGDLAETDATARSVTLMAAIERGEGAPDTVVRGWLAKA
FT                   LTVSRGPQWICDNCQHIHREWGPFCENCESFDTLAWKTPPMSEMAMPGGMQMLPLIVGA
FT                   LEEKPDETSGDIIEDAEIIPDSMDSAAPEPSKAT"
FT   gene            complement(461337..462164)
FT                   /locus_tag="RD1_0474"
FT   CDS_pept        complement(461337..462164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30184"
FT                   /db_xref="GOA:Q16CV9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV9"
FT                   /protein_id="ABG30184.1"
FT                   /translation="MDKRDLSRLFKERLSSVINSHSEGRGHFMRAVGIDRSAMSQFLNP
FT                   DTDRLPRAETLRRIATVSGVSVDWLLCLENAQEGRQEVAESVQIEKEIQSDGSTPLDQW
FT                   RNEAAGFKLRTVPSTLPDIISMAPDVSDRASLEDARGGGVENVLERISLNDMDVEVAMP
FT                   LQTLQDLSARSGLWRGTSRDRCHRQLTHMARICADHYPALRLHVYDGTKTFSAPFTVFG
FT                   NQRVALYIGDAYLVVSSADQVRGFARQFDRLVRRAVISSDKIHVTLRQLADAV"
FT   gene            462237..463301
FT                   /locus_tag="RD1_0475"
FT   CDS_pept        462237..463301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0475"
FT                   /product="beta-carotene ketolase, putative"
FT                   /EC_number="1.13.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30185"
FT                   /db_xref="GOA:Q16CV8"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV8"
FT                   /protein_id="ABG30185.1"
FT                   /translation="MRKHALVRTRGFSKDIPQISENLCCERAVVTPRKTHVQWPTLLVC
FT                   LCCYGGVAGSTLYAEILGPVLAGLVLTLSLTLFSSFNHEVLHGHPFRSRHANTALVFPA
FT                   MGLVIPYMRFRDTHLAHHHDPSLTDPYDDPESNYVDPAVWCRWSVARRRVYAWNNTLLG
FT                   RMLIGPIIGLLTFYEGDARRIRQGDRDVIRAYLFHFAGLIPVVFWLVWMSEMPFWLYAI
FT                   AVYASLAILKIRTFLEHQAHEKARCRSVIIEDRGPLSVLFLKNNLHAVHHAHPTLPWYR
FT                   LQGFYDKRRAVVLTRNGGYVYRSYMQIAGLFLLKAKDPVPHSQWSSGHEQVPQPQKPQK
FT                   TTAARDITACNLTG"
FT   gene            463338..464144
FT                   /locus_tag="RD1_0476"
FT   CDS_pept        463338..464144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0476"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30186"
FT                   /db_xref="GOA:Q16CV7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV7"
FT                   /protein_id="ABG30186.1"
FT                   /translation="MKDIQNTLVELQIEGGIATITLNSPQTLNALSEDMLTGLQNALDG
FT                   IAVNRDVKAVILRGAGNHFCAGHNLKEMTARRADADKGSAYFNALFGTCSKMMMSIVDL
FT                   PQPVIAEVKGIATAAGCQLVATCDLAIAAEDARFATSGVNIGLFCSTPMVALSRNVPRK
FT                   KAMEMLLLGEFLPASKAEEMGLINRVVPAADLETASAAMAQIIVDKSPVAIKTGKKAFY
FT                   EQCNMPLDAAYAYAGAVMAENMLARDATEGINAFIDKKPMPDWTGE"
FT   gene            complement(464214..465290)
FT                   /locus_tag="RD1_0477"
FT   CDS_pept        complement(464214..465290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30187"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV6"
FT                   /protein_id="ABG30187.1"
FT                   /translation="MADISSSLSMPFIQPSQAQKHVTHNEALRILDVVTQLGVAADDQT
FT                   TPPTSPADGTRYIIDAGGVNEWANHEGEVALFENGVWRFFVPRAGWRAYVINRDALVVY
FT                   DGAEWIDLDSPELEEIETFGLGMNSLPDTPFSAKLNATLWTALYRADGGNGSLLKTLNK
FT                   EASADDNGFVFQQDFQTRALLGLFGSDNLRLATTPDGTNFVDALIADNATGIVDQPRLP
FT                   RFKGVTNFDNFCPAGTWTKIAINDLEYNEQAVFDAATNQFIVPVDGTYQLGALLTFKAD
FT                   SSTAARMGAQLLINGVTPISGSQVENTAAHFNGRTTISIQTLASLSAGSTVELHGIMRS
FT                   QPGYFMADRTDFWGFKVG"
FT   gene            465491..466639
FT                   /locus_tag="RD1_0478"
FT   CDS_pept        465491..466639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV5"
FT                   /protein_id="ABG30188.1"
FT                   /translation="MHATVRDTQKATLQLTKRTPSKSGGENGCVAPSALPALQGRANSS
FT                   LPVSRLEMLQARANHGAASRFPTTRQPVAQRHVSSQPVLQRDRVSTKLGDQTVSADQSG
FT                   APETLAFLEPGRSHGGKYAPVHLTKKIKMAGAGLINAGGLTHGALNAQNAVTPDYHFTI
FT                   TSGFMTAALVNSPIKNYLVKHHKASQIWTIGAVSNEDLAQNKLKANQIVSAFNADLELA
FT                   AGANFDNLMLTYDPDGEGPTFDDVVRFHEGVKNTLFAIPTVNPGGDLPFTSIKFSQLKT
FT                   HITAGADQLAAQWSKWTNNGAAATRNDFRISAGKWTDLAKAVNILNRIRSKALKLETPG
FT                   AATPAVFDDAFINDQLADYDAAKTAIKANMRTDQVAHADEFT"
FT   gene            complement(466790..470086)
FT                   /locus_tag="RD1_0479"
FT   CDS_pept        complement(466790..470086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0479"
FT                   /product="calcium binding hemolysin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30189"
FT                   /db_xref="GOA:Q16CV4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV4"
FT                   /protein_id="ABG30189.1"
FT                   /translation="MAIAVTGTDFRDTARIGSGAQVVELGAGDDRIITYGDSGEPDPAQ
FT                   TTGAQGRVTPPNAQPGNDILTGGAGADLFEFRALLNATPEVITAHSRPSGQVDWAGVAG
FT                   ENDDVHDHWVESFGLDTITDYSRAEGDQIKITGHTMTLESITYGADAGGSYSLITLFSQ
FT                   QGNGAAGGANTATGAHDEDPLGQIKVYGDRVFRGDLDIERTNDGIDRLTHTDSVFAPLN
FT                   AGVTRVVASNTDDTNYTGSAFKQVDRVTIGEGSQVVDTGGGNDVIFSFSDGGEPDPAQT
FT                   NGAAGRVTPAIGAGQSNDVISGGQGQDTFAFRLLLNAKDDVLDAYTRADGSVNWRGVAG
FT                   ENDNVHDHWVEGIGKDVILDFSDQDGDSINIRGHTVEVAAITYGADTLGDFSLITLRSQ
FT                   QGDGRAGGINTATGAHDEDPLGTIKVYGDKVTMQDITVRANVFYGIDALEDIKASERDG
FT                   FADNSTPDLANPLWGLDSPWTINSTFTGTQHSNQFHAGSGTQTVLAGDGNDRIISYGDA
FT                   GEPDPAQTVGSAGRANPKLGSGASDDYLTGGGGADRFEFHALLNATAEVIAQHTSVTGH
FT                   IDWRGVTGENDNVHDHWVEGFGRDTILDFSRSEGDTILIRGHTVELDSITYGQDARGSF
FT                   STLTVISQQGNGGAAGANTATGAHDEDPLGTIKVYGDRVTQSDVTVQRDGIFDGGERLT
FT                   MADRLLEYNGGAQNFQSARHQEVIITAPTDIKTVDRVETGSGAQQVYAGSGNDVIRIYA
FT                   DGGEPVPAQTGGAGRVTIPVAPALSRDVVSGGQGSDTFIFNYLLDATDVVLARHTRDDG
FT                   TINWRAVAGENDALHDHWVTSGGNDVLLDYSKQDGDAIELRGHTVELARITYGEDGGGD
FT                   FSMLHVRSQQGPGGGAHDEDLLGTVKVYGDKVTKSDVKVTAKGVFDGVDLFEPIPNQPN
FT                   HVVGNDGANKLSGTGNADNIHGKRGSDFITGGDGNDFIFGGAQNDRLFGGNGNDWIEGG
FT                   QGMDALFGKLGIDTLVSTNGRDDMTGGGGSDTFMFMETSRGGQILDWEDGADTIDFSRM
FT                   DAVQSLGDLKWDRLSDSSIRIEFTNDAGVDSGVTVFSTNNFSLTAEDFAF"
FT   gene            complement(470358..471020)
FT                   /locus_tag="RD1_0481"
FT   CDS_pept        complement(470358..471020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30190"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV3"
FT                   /protein_id="ABG30190.1"
FT                   /translation="MRIIRSTYPPIDLFEDIADPEDWPLLISAEQKTNPRLMESIGTLD
FT                   LIPPDRRVGGPGASYLMAPFTHSSPDRPSRFSDGKLGVLYIASDFETAVHETAYHHAAF
FT                   MLATGEPPGWTSQFRELFIGVHADLHDIRTVNDAIAPLLHPDDYLPAQNFAAQLRTSGS
FT                   QGIVYPSVRGDGECVGLFYPDLAHSPVQGRHLDYHWNGDCVDLVRDAGSGDVFRIIR"
FT   gene            complement(471056..471460)
FT                   /locus_tag="RD1_0482"
FT   CDS_pept        complement(471056..471460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30191"
FT                   /db_xref="InterPro:IPR020358"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV2"
FT                   /protein_id="ABG30191.1"
FT                   /translation="MQPLETKAQEFAPQPITAEEGAAMLRAVLRLFGKWAITDEDAATL
FT                   LDLPVRTYRRWKAGQPGRLGRDTKARLSNILGIHKALRIIFRDTERVYAWVKAPNTAFG
FT                   GHSALEIMRGGELTDLMRVRRYLDAERGAW"
FT   gene            complement(471677..472846)
FT                   /locus_tag="RD1_0483"
FT   CDS_pept        complement(471677..472846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30192"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV1"
FT                   /protein_id="ABG30192.1"
FT                   /translation="MNKTPKDAAGFYTEAGCDLSDFVALTRQQTAPETVPMAAEVSHKI
FT                   PVYDMAQRRDMLEKPLTRRALMAEWAQVLQHGAGVFVLRHAYADTSVIDAATALYDRII
FT                   ADEKVAKGTAADHFAAAGSNDRIWNSLQKLCEADPDVFVRYFANPTIDAACEAWLGPNY
FT                   QMTAQVNVVHPGGSAQQAHRDYHLGFQTTQACAAYPAHVHDLSPLMTLQGGIAHGATPL
FT                   ESGPTKLLPFSQRYRPGYTAWRRDDFRSYFEEHHVQLPLEKGDALFFNPALFHAAGSNS
FT                   SRDIHRMVNLLQVSSPFGRAMETVDRTKTSLLAFGSLKDLPLADAELHAAIAATAEGYP
FT                   FPTNLDNDPPVGGLAPPSQQDVLKTAIAESWDQPRLEAALKAQEARKTA"
FT   gene            complement(472862..473674)
FT                   /gene="iolB"
FT                   /locus_tag="RD1_0484"
FT   CDS_pept        complement(472862..473674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolB"
FT                   /locus_tag="RD1_0484"
FT                   /product="myo-inositol catabolism protein IolB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30193"
FT                   /db_xref="GOA:Q16CV0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CV0"
FT                   /protein_id="ABG30193.1"
FT                   /translation="MSTLLHKPTGRSGKVHDITPERAGWGYVGFGLYHLSRGETAAEET
FT                   GDREVIIVLVEGKARLSVAGSAFGEMGARMSVFDRTPPHCLYVPGQINWTATATTDCVV
FT                   AICSAPCIEDYPAARLGPEGIELTPRGKGQNTRYINNIAMEGRDVASSLLVTEVFTPAG
FT                   NWSSYPSHRHDEDDYPRMTYLEETYYHRLNPAQGFGVQRVYTDDRSLDETMAVSDGDVV
FT                   CVPRGHHPCGAPYGYDMYYLNVMAGPLRKWRFENDPDHDWIAQRDADD"
FT   gene            complement(473671..474465)
FT                   /locus_tag="RD1_0486"
FT   CDS_pept        complement(473671..474465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0486"
FT                   /product="sugar ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30194"
FT                   /db_xref="GOA:Q16CU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU9"
FT                   /protein_id="ABG30194.1"
FT                   /translation="MNTQASPAPIVQMEEIEKHFGNVIALAGVSFDITPGECHCLLGDN
FT                   GAGKSTFIKTMSGVHKPTKGRIMFEGSEMSFASPRDSMEAGIATVYQDLAMIPLMSVTR
FT                   NFFMGREPTKGSGLFKRFDTDAANDITMAEMKKMGINLRAPDQAVGTLSGGERQTVAIA
FT                   RAVYFGAKVLILDEPTSALGVRQTSNVLATIDRVRKDGIGVVFITHNVRHAMAVGDRFT
FT                   VLNRGKTLGTAKRGDITADELQDLMAGGQEMAKLEGSLGGTV"
FT   gene            complement(474467..475567)
FT                   /locus_tag="RD1_0487"
FT   CDS_pept        complement(474467..475567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0487"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30195"
FT                   /db_xref="GOA:Q16CU8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU8"
FT                   /protein_id="ABG30195.1"
FT                   /translation="MPTDAAVDERIKEEPFFSRMMKRPELGAIAGVILVTVFFLITADP
FT                   AMFTLAGFMNFMSPAAQLGILAIGAALLMVGGEFDLSVGSMVAFTGLFFGACVVTFGLP
FT                   LIIAIPATLIFAAAVGACNGQIVLATGLPSFIVTLAFLFIFRGLSLVGLKWATDGSTQL
FT                   RGVRDATENDWLTPIFSGDAFPGFFTKLAEMGMIDTFRNGTPKVTGIPVEIIWFVIIAL
FT                   LATYVLQKTPFGNWIFASGGDANAASNSGVPVKRVKLILFMVTATCAALVAIITVLDSG
FT                   STDARRGFQKEFEAIIAAVIGGCLLTGGYGSAIGAFFGAIIFGMVLIGLTYTDIDQDWY
FT                   LVFLGGMLLVAVLFNNMIRKRVTGER"
FT   gene            complement(475630..476556)
FT                   /locus_tag="RD1_0488"
FT   CDS_pept        complement(475630..476556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0488"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30196"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU7"
FT                   /protein_id="ABG30196.1"
FT                   /translation="MKHFLKSTLAAAALAIATPALATDIIVVSHGQASDPFWSVVKNGV
FT                   EKAAADTGANVEYRAPETFDMVAMSQLIDAAVNQEPDGLVVSIPDADALGPSIEKAVAA
FT                   GIAVISMNSGSNVSKGLGALLHVGQEEFDAGKAAGEKMAEMGGTKALCINHEVGNVSLD
FT                   DRCAGFAEGFGGEVIVLPTTNDPSEIEAKVKASLDSDESIDTVMALGASLAGEPAVAAV
FT                   KAVGGEGSIRVGSFDLSAGFLESVSAGEAAFAIDQQQYLQGYLPVAFLALHAQYGLVPG
FT                   GNVPSGPNLITADKAAQVVELSAKGIR"
FT   gene            476714..477712
FT                   /locus_tag="RD1_0490"
FT   CDS_pept        476714..477712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0490"
FT                   /product="transcriptional regulator, LacI family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30197"
FT                   /db_xref="GOA:Q16CU6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU6"
FT                   /protein_id="ABG30197.1"
FT                   /translation="MTVTLKDVAERAGVSRSAVSRTFTAGASVSPKTRAKVEKAADDLG
FT                   YRPNALASSLTTGRTKLIGLISNNFHNPVFLEVFDLFTRCLQDRGLRPLLVNLTDETDP
FT                   ENSLRLLQQYSVDGVIVASSTLSQEFPLAFQTSRIPVVHSFGKFAHAPRVHVVGIDNIE
FT                   CGRMAARTLIARGYNRLGFLGGPADATSTVDRRTGFLEVIEAVDDVTVSDSFATAYSFD
FT                   AGRNEMLSLLRNTPADAYFCGDDVLSIGALSAIREAGLRVPEDIGIIGLNDMEMSRWQN
FT                   INLTTIRQPIPQIIDSSIDLVMALLEKPDHQPEARLFACDIIERGTLRPLP"
FT   gene            477955..478242
FT                   /locus_tag="RD1_0491"
FT   CDS_pept        477955..478242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30198"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU5"
FT                   /protein_id="ABG30198.1"
FT                   /translation="MERLQENAMKSRLILMIIAVWGLGACTATTGGNAGFIRNLPEEIV
FT                   AMAAPNQDLTAVQLKEDDGCYWYRHTGPVETTMLPLRTAEGRPICTRPQT"
FT   gene            complement(478389..479048)
FT                   /locus_tag="RD1_0492"
FT   CDS_pept        complement(478389..479048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0492"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30199"
FT                   /db_xref="GOA:Q16CU4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU4"
FT                   /protein_id="ABG30199.1"
FT                   /translation="MLTRRHFLQTSAALFSTSVLGAGTAASASSNWAVWDARVTPANYD
FT                   PATTNPWGLHPRFLPVRVEANSGLVPGDIHVDAVARYLYHVQGDGTAMRYGVAIARGNL
FT                   YEPGVFTIRRKARWPKWTPTAEMIRRDPELYTEFADGMPGGPDNPLGARALYLYEGNRD
FT                   TYLRIHGTPSPRSIGSRASSGCVRMVMAHIIGLYDEVTPGATAHLYPAESYVTANS"
FT   gene            complement(479172..479681)
FT                   /locus_tag="RD1_0493"
FT   CDS_pept        complement(479172..479681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30200"
FT                   /db_xref="GOA:Q16CU3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU3"
FT                   /protein_id="ABG30200.1"
FT                   /translation="MTKPIPGTAVAQMTLPTVDGGTITLGQPKERWSMLFIYRGRHCPR
FT                   CKRFLNKLNAVLPAWTDRMDVAVVSADTRQKALEDQKEFGWNFELGFDLSEDQMRALGL
FT                   YVSEPLSGTETDRVFAEPGAFAIRPDGTLMLVEISNGPAARPDLEELLDGMIFNIENDR
FT                   PVRGTA"
FT   gene            complement(479855..480766)
FT                   /locus_tag="RD1_0494"
FT   CDS_pept        complement(479855..480766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30201"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU2"
FT                   /protein_id="ABG30201.1"
FT                   /translation="MLSLLGSTVLLASCAPAVVTRSSNDPFEGGIGGTGIVGVLTGFGS
FT                   LRINGVTVDVTRTTRYSTSFGATAVEALKPGMSLTIYAQRRGDGLVAKDVFVDHLLIGT
FT                   LRGHPGDLRVNGISLQAPDTAQTLIGTRVAVSGVWSTTGVIASRIDPTALDKDLIAGTL
FT                   TRLDDGHNGIGGLRLDAQGVRLATGQYAAVLGSSDADGFRVQSIANGRFARARDLRNLS
FT                   VEGYLEPIDTQPGFRIAGLGHSFARDLSLAAIGARRAVYFGRYDGLFGASKGYVLPEDS
FT                   AARRAILNRGISDGFEGPVIEV"
FT   gene            complement(480774..481628)
FT                   /locus_tag="RD1_0495"
FT   CDS_pept        complement(480774..481628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30202"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU1"
FT                   /protein_id="ABG30202.1"
FT                   /translation="MNATGSDGFLLLLKGLMRPLVRTMINRGITAPAFYKLLKTVYVDV
FT                   AYEEFRLDGTAPTDSRVTLLTGVHRRDVRAILSNEDDAWKTARGKSAAFATVLSQWMTR
FT                   PEYQDDAGHPMGLPRTSDDSPNFETLVREINTDIRPRTILDELMRQELVHESDDGLLRI
FT                   SDGAFSGPVSDHDKLVFFASNVGDHLAAASQNLLSEDAPFLERAVFYNRLSPGSVDQIE
FT                   QHAGQLAQNMLETLNAQSSRLQQADQNETEPKERYRLGVYFYRESTNAGLDRAKDETGE
FT                   TEN"
FT   gene            481757..482263
FT                   /locus_tag="RD1_0496"
FT   CDS_pept        481757..482263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30203"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CU0"
FT                   /protein_id="ABG30203.1"
FT                   /translation="MAHLISRRGALKAGLGFAGLAGLSACGMATGRTPDIVDTAVAAGS
FT                   FTTLVAAVQAADLVDTLKSPGPFTVFAPTDEAFAALPAGTVEDLLLPENKDKLVQILTY
FT                   HVVAGRIPAANIVGKRGSVTTVEGSDLHYDGRNGVKINKATVITPDVMASNGIIHVIDG
FT                   VLLPS"
FT   gene            complement(482746..483201)
FT                   /locus_tag="RD1_0497"
FT   CDS_pept        complement(482746..483201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30204"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT9"
FT                   /protein_id="ABG30204.1"
FT                   /translation="MQDSAAESIAEELLYITGKALLEADFRMFSECFRLPQMMETVDGR
FT                   RLIATESEFLYTFNSVRRHLHKCGVVDFARTVVSAKFLDADTIGSTHVSILLGADGQER
FT                   GRPYPVYSVIRRHGNIWQIVSSLYAILDNPAYNEALMATPGFHSTDH"
FT   gene            483527..485047
FT                   /locus_tag="RD1_0498"
FT   CDS_pept        483527..485047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30205"
FT                   /db_xref="GOA:Q16CT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT8"
FT                   /protein_id="ABG30205.1"
FT                   /translation="MSKDQMDALQEIFDTQPWFVRIGRRFWGMDPFVVLFIALFLGVVP
FT                   IVAAVYVLNLGDVTHFILRGTAEAAPCPVDLVGSDQCLEKQVGYGHALNWWPSLSIMMP
FT                   LAFFFAFTSVQNLQRTFRQMIQDRMFCNRDWHFDLTDQSSEMNRGVFRMVRLIWTCFSL
FT                   AGLVVALLVGTVVVLDWYCVVHMPLMTGDLLTASGVTIPAVCQDTSGQEVDWSIAAIFA
FT                   QATQITAPADMRSPSFAMNWGFSAYVYAVMLIELCLLMVYYCYVLALALTIQRLRNGAF
FT                   DLWLVPKLSSQDPNGRMGFENLEQIFRPCIYVTIISFLVAFAMRIQNEFLRQTDFENIY
FT                   QFLFQDFILALRDMFTPSVDSFAGFFADLFGDIQTFTSAIDVTGFRDPNSLVGGPLVLI
FT                   VLSMVTVVLAVILRDTAKEARDRVSRALDDPDKKQAVIDFYGLDEAALRDKLGDMKVWP
FT                   LSWPKMQQSIRMLILGVVCFVLYQVAFIWAGLMLIQMLKGRLGREVEG"
FT   gene            complement(485058..485819)
FT                   /locus_tag="RD1_0499"
FT   CDS_pept        complement(485058..485819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30206"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT7"
FT                   /protein_id="ABG30206.1"
FT                   /translation="MTGSEKKPLRVLSWNVFNENPDPARIAEALATLNPDIALLQEALP
FT                   AHIDEIKASFPHVSVARDYALKGELCHLVIASRFPTRRETTLFHADTSKPAPTRWARHA
FT                   GWVEFLDSLSVDVVVPGTRPFRVVNLHTSAGVSPSVRQAELAETQRHFDHEGPCLVAGD
FT                   FNSYAVPWLAPLLAIPLHYRPKDWLIFERRALNAWFRRRGFAPALHGVTFPKFRLQMDQ
FT                   VFTRDIMVETAAIERRLWGSDHRPILLDISV"
FT   gene            486154..486681
FT                   /locus_tag="RD1_0500"
FT   CDS_pept        486154..486681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30207"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT6"
FT                   /protein_id="ABG30207.1"
FT                   /translation="MYHRLKLARPTIAFASAWIGLMIAAMPVQADQTCAWSALTSPNRQ
FT                   QITCGDALMVEREPGTDVTIFERAGDAPPRAIELKNGAILIEVTPGSAPTQIRTPHAIA
FT                   AVRGTTYVVDARQDSTSVFVIEGSVSVSKVSDASTVTLGPGEGVDVGDAVEFAVTAWPS
FT                   DRAASLLSRFGR"
FT   gene            486633..488504
FT                   /locus_tag="RD1_0501"
FT   CDS_pept        486633..488504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0501"
FT                   /product="putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30208"
FT                   /db_xref="GOA:Q16CT5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT5"
FT                   /protein_id="ABG30208.1"
FT                   /translation="MAQRPRGILALPIWQMISGRARRWALPLGAVTLALFWVLTLIIPY
FT                   MSGRAGFFDPLEYRLLDVRHVLIGPRAAASDIVIVAIDDETLAAAPAELQSRRQLLARI
FT                   ISNIAQSDARVLALDVLLADPGPAEDDAALAAALGEIPSSIAAAARFGADSASADSIIW
FT                   PQAAFGEVAEAGLVNLSTDASGTPRYAPLLIDAGGSLVPSLPLLASLSFGGEKAVFGET
FT                   QLTLGTRDVPLDFGFNMPLRHIGPEGSVPTYSARDLISGTLPDALSDKLVVLGFSASAM
FT                   GDRFATPFDENTPGMEVIATAISQLSGGETLRRDAQTRQWDAALAVALTLICVTSVLVW
FT                   PLSRGVPVAAGFVLVFLASITLAFASGLWLSGALALAVALPPAIAASGLRYMQENLQAR
FT                   KSEQSVASLRQFQSPALAAKIESDPNYLMEPIEQDLVVLFVDLTGFTGHSQRLGQDGTR
FT                   NLLAMFHKLTAQTVEARGGSVFNYMGDGALAVFGLERGGDASHADDALASAFDLVHSLS
FT                   HQSLPQTPDEPLSCRIGLHSGPVTLSRLGAQSHQQVTVTGDNVNLASRLMEVAKTEKAV
FT                   VVASSDFAAGLTDGGPQESAYTTDVAIRGRDGRVQVLVWAKDALERS"
FT   gene            complement(488501..489358)
FT                   /locus_tag="RD1_0502"
FT   CDS_pept        complement(488501..489358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30209"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT4"
FT                   /protein_id="ABG30209.1"
FT                   /translation="MRDFSKDLSALALNTASLGHNLDGYGAGWSTEAVIDACGARGFGG
FT                   IVFWRREIGTSAQQIGDRVRAAGLEVAGLCRSPFLTGPLVPGDDAAIMDDFHASIDMAA
FT                   GLGTEVLTVVTGGIDPGTKGPLESQKRVADRVARAAEYAAARNVKLALEPLNPMFGGNR
FT                   SCIFTVRDALHMCDWIGLDNVGLAIDVYHVWWDSTLTETMPRATGKVLGYHVCDWLAET
FT                   RDTLLDRGMMGDGVADLKALRQLVEETGYKGYCEVEVFSAEDWWKRDPNEVLDVIAQRF
FT                   RSLC"
FT   gene            complement(489358..490521)
FT                   /locus_tag="RD1_0503"
FT   CDS_pept        complement(489358..490521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30210"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT3"
FT                   /protein_id="ABG30210.1"
FT                   /translation="MRFSMKIALPDPAGTLSDYALQGTPIAQATLTPDAARVVFSAAHV
FT                   VADPFTSNDPMGPASVDWDATMAFRRHLAGLGMGIAEAMDTAQRGMGLDWPGALELIAR
FT                   TKSELPDALVFNGCGTDQLAPQDANTLDDVIAAYLEQIEAIQKLDGRIILMASRALARV
FT                   AQSPDDYLSVYAKVLDACDHPVILHWLGPMFDTQLAGYWGGATFEECLETCLNMIAANT
FT                   SKVDGIKISLLDKDKEITMRKRLPEGVKMYTGDDFNYPELIEGDEMGYSHALLGIFDPL
FT                   APAAAYAVSQLTRGNAAQFRATLDPTVPLARQIFRAPTQHYKTGVVFLAWLNGFQDHFI
FT                   MLNGAQAARPLPDFVTIFKQADACGLLQDPELAVARMKRLLAIYGVL"
FT   gene            complement(490518..491285)
FT                   /locus_tag="RD1_0504"
FT   CDS_pept        complement(490518..491285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0504"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30211"
FT                   /db_xref="GOA:Q16CT2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT2"
FT                   /protein_id="ABG30211.1"
FT                   /translation="MRQVALVTGSSRGIGLAAAKALAREGFSIALNGPEDDDELAAAVA
FT                   AIKEIGVPNVAVPFDVSDLTAHHAALTKAEEALGPLTTLINNAGVGVINRGDMLDVTEE
FT                   SYDRCMAVNTKAVFFLSQCFAKRLCARSRPAQLFHSIVNVSSANAIAVAAPRSEYCVSK
FT                   AAAAMVTKTLAVRLGPENIAVYDVQPGLIETEMTAPVIAQYETRARAGLTLFPRVGQPD
FT                   DVGMIIASLASGKLPYTTGQAISADAGMLVPRF"
FT   gene            complement(491282..492427)
FT                   /gene="mmgC"
FT                   /locus_tag="RD1_0505"
FT   CDS_pept        complement(491282..492427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmgC"
FT                   /locus_tag="RD1_0505"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30212"
FT                   /db_xref="GOA:Q16CT1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT1"
FT                   /protein_id="ABG30212.1"
FT                   /translation="MFSTEVHAQVRQMTRQFADEVIRPVAEELDRDERFPTEIYAQMAQ
FT                   LGLFGICVPEAMGGPGMDTLAYAIVMEELSRGYASVADQCGLVELITTLLVTHGTQAQR
FT                   DMWLPDILAAKTKVAYCITEPEAGTDVSGIRTTAVRDGEGWRLNGGKIWIHNAPVADLG
FT                   FVLARTDPEAGHRGMSIFVVDLHADGVARGPKEHKMGQRASQVGPLHFDNVTLPAHALL
FT                   GAEGRGFHMMMSVLDKGRVGIAALAVGIGQAGLDAAVEYAAQRRQFDKAISEFQGVQWL
FT                   LADIAKDVEAARLLAHSAAHKIDIGADATKACSMAKCFAGDMAVARSADALQVFGGSGY
FT                   IKGFEVERLYRDAKITQIYEGTNQIQRMIIARELLAKGADA"
FT   gene            492572..493588
FT                   /locus_tag="RD1_0506"
FT   CDS_pept        492572..493588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0506"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30213"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CT0"
FT                   /protein_id="ABG30213.1"
FT                   /translation="MDHATRNKFGRVDLEVTAFGFGTAPVGNIFREIDEATSDGMFQAA
FT                   WDAGVRYYDTAPMYGHGLAELRTGQSLRWKNRDDLVLSSKVGRRLVPARRGDIDFAPWT
FT                   NAAPFNLEFDYTYDGTMRAFEDSLQRLALERMDICFIHDIDVFTRGDAQPDVFKQAMDG
FT                   AWKALAKLRDEGVVSAIGVGVNEWQVCQAALEARDFDCFLLAGRYTLLEQEAQDTFLPM
FT                   CEARGAAVVVGGGFNSGILATGARAGAKYNYAPAPAEIMARVAKIEAVCADHQVPLPAA
FT                   ALQFVVAHPSIPSFIAGTRTIAQLEQNLKWFRHEIPADFWAELKHEGLLRTDAPVPV"
FT   gene            493585..494031
FT                   /locus_tag="RD1_0507"
FT   CDS_pept        493585..494031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0507"
FT                   /product="MaoC-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30214"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS9"
FT                   /protein_id="ABG30214.1"
FT                   /translation="MNLSPGRYGYHDLASGDCLVTGARVISAELIDDFARVSGDTYEIH
FT                   MSDAAAQAKGFERRVAHGLLVLAVIDGLKNNAPARFDALASLGWTWRFVAPVLVGDTIS
FT                   ARFVIREKRLTANGKRGITKITAQAMNQHGAIVQEGENGLIFDL"
FT   gene            complement(494141..494452)
FT                   /locus_tag="RD1_0508"
FT   CDS_pept        complement(494141..494452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30215"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS8"
FT                   /protein_id="ABG30215.1"
FT                   /translation="MIRHSVHLRFRADVTEAEKMSLYDALAGLSGHIDGIVDFQHRKNV
FT                   SVETPLVRGFLDMFWFDFRDTSVRDTYLVDPEHQAIGARIVAALEGGPEGVFVCDVEL"
FT   gene            complement(494465..495220)
FT                   /locus_tag="RD1_0509"
FT   CDS_pept        complement(494465..495220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0509"
FT                   /product="putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30216"
FT                   /db_xref="GOA:Q16CS7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS7"
FT                   /protein_id="ABG30216.1"
FT                   /translation="MIDLSVRDGIARLVLNRPDKLNALTAEMCDMLAARCREIERGTAR
FT                   VVILSGAGKAFCAGGDIEAWAGETPEAFGDHWVRDGHAAFDALARLTVPVIAQLDGHAL
FT                   GGGLELAACADLRIAEQHIKIGQPETGLGIIPGWSGTQRAVRRFGAQVVRRMALFGEVF
FT                   DAEEARRLGLVDHVIATGAAHVLAEDLAARVLSRGPQATKLTKMLINAADREDPERIAE
FT                   ALAGRIAAGTDELREGLSAFREKRKPDFS"
FT   gene            complement(495217..496800)
FT                   /gene="pct"
FT                   /locus_tag="RD1_0510"
FT   CDS_pept        complement(495217..496800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pct"
FT                   /locus_tag="RD1_0510"
FT                   /product="propionate CoA-transferase"
FT                   /EC_number="2.8.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30217"
FT                   /db_xref="GOA:Q16CS6"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS6"
FT                   /protein_id="ABG30217.1"
FT                   /translation="MPKIMTARDAADLIPDDATVAVNSSSGLCCPDAVLKGIGDRFDAV
FT                   GHPRNLTTIHPIAAGDFFGTKGVDHIAKKGCLSRIIGGSYPSGPTKAEPPLIWQMIVAD
FT                   EVAAYNVPSGIVFDMLREGAAKRPGVLTKVGMETFVDPRLEGCAMNGEARKTPIVQLRD
FT                   FEGEEWLYFKSIQPDVAIIRATTADTRGNLSFEHEGAYLGAMEMALAARNSGGTVIAQV
FT                   KRIAAAGSIRPHDVTVPGILVDVIVEAPDQLQTTATQYDPAISGELIRPMDSFDTVDFN
FT                   IGKVIARRVALELQRGWAVNIGFGISANVPRIFVEEGCHNDVTWMIEQGAVGGVPLLDF
FT                   KFGCAANAEAFVASPHQFCYFQAGGFDCSLLSFLEVGADGSVNVSRLSAVPHRTAGAGG
FT                   FVDITARAKKIVFSGMFNAGAKMRVENGEIVIEHEGKVAKFVDQVDQVSFSGKRAIAQG
FT                   QHITYITERCVMRLDEQGLIVTEVAPGLDIDRDVVGQAATPLRVAPDLKVMDAGLFRDA
FT                   PIDLAGRLSA"
FT   gene            496950..497768
FT                   /gene="dkgB"
FT                   /locus_tag="RD1_0511"
FT   CDS_pept        496950..497768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="RD1_0511"
FT                   /product="2,5-diketo-D-gluconic acid reductase B, putative"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30218"
FT                   /db_xref="GOA:Q16CS5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS5"
FT                   /protein_id="ABG30218.1"
FT                   /translation="MNIYFKHSNQRSFGTYPLKGTACRDAILTAAEVGYRAFDTAQMYR
FT                   NEAETGAALKETGIPRDTLCVTTKVENDNYDESKFLASVEASLKALQLDYVDVLLLHWP
FT                   PADFQIEGSLTLLEQAHKRGMARNIGVSNYTVQMMRDATRIIETPLVTNQIEFHPLLNQ
FT                   DVMLAAASETGIPLSSYCSVARGEVFKHPIFAEIGAGYGKTAAQVVLRWILQKGVSINT
FT                   MSTKPENIAANFDVMDFTLSSVDMARIERMTHMNYRIVSKDIVPWAPDFD"
FT   gene            complement(497788..499392)
FT                   /gene="betA"
FT                   /locus_tag="RD1_0512"
FT   CDS_pept        complement(497788..499392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="RD1_0512"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30219"
FT                   /db_xref="GOA:Q16CS4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS4"
FT                   /protein_id="ABG30219.1"
FT                   /translation="MAQGYDYIIVGGGSAGCVLANRLTEDASVRVLLLEAGGSDRHPFI
FT                   HMPVGFAKMTTGPHTWGLMTAPQKHANNREIPYAQARVIGGGSSINAEVFTRGHPSDYD
FT                   RWAREEGCDGWAFDDIRKYFIRSEGNTVFAGEWHGTDGPLAVSSLNAQPMTLAFVRSCQ
FT                   ERGIPFNPDFNGAVQEGAGVYQTTTRNARRCSAAVGYLKPVMHRPNLTVRMNVLVKRVV
FT                   VEKGRATGVDIWSAKTGSETVHADQEVIVTTGAIGTPKLMMLSGLGPAAHLKAHGIDVQ
FT                   ADLPGVGENLTDHFGIDIVAELTGHDSLDKYNKPHWALWAGLQYLAFRTGPVASNVVEG
FT                   GAFWYADPDAATPDLQFHFLAGAGAEAGVPSVRPGASGITLNSYTLRPKSRGTVRLRSA
FT                   DPKDTPIIDPNFLGHPEDLKTSVEGVRISREIFAQPSLQKYIRAVRFPDDSVQTQAEYE
FT                   AYARAFGRTSYHPTCTCKMGSSDDPMAVVDPRLRVRGVDGLRLCDSSVMPSLIGSNTNA
FT                   PTIMIGEKAADMIRGNH"
FT   gene            complement(499571..500140)
FT                   /locus_tag="RD1_0513"
FT   CDS_pept        complement(499571..500140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30220"
FT                   /db_xref="GOA:Q16CS3"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014500"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS3"
FT                   /protein_id="ABG30220.1"
FT                   /translation="MPITTESYTSAPNGKIPNSRFPLLVHRNAVPGGGAEAIKTRFREN
FT                   GWSNNWDYPGVYEYAHFHSTTHECLGCARGWMEFNLSVGDGGWTKVRIEAGDVIVMPAG
FT                   VSHEMIGQSEDIHMCGGYPDGRDWDDIQEEFLSNEDYKRACKRIMMLPIPARDPATGKA
FT                   MPEWHGAPSSVDGGWNDWRHALDKRE"
FT   gene            complement(500156..501184)
FT                   /gene="gutB"
FT                   /locus_tag="RD1_0514"
FT   CDS_pept        complement(500156..501184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutB"
FT                   /locus_tag="RD1_0514"
FT                   /product="sorbitol dehydrogenase, putative"
FT                   /EC_number="1.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30221"
FT                   /db_xref="GOA:Q16CS2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS2"
FT                   /protein_id="ABG30221.1"
FT                   /translation="MTRAAVLSKPGHFEMQERPTPTPGRGEVLIRVARVGICGTDIHIF
FT                   NGHYATDNLPMIPGHEFTGTIEALGPDVTGLRLGDKAVVDTNVGCGTCYWCRRSEILNC
FT                   PDMRQMGISMDGAFAEYIVVPARLVIPAPAHMPFEVLALTEPLACVVRAARKADVSFGQ
FT                   SVAVLGAGPIGHLHVQLLRTIGAAPIIVTDISPDRVALALRHGADVGVSDPADVKACVM
FT                   QATEGRGADIVIESVGLPALYQQALHLIRKGGHVAAFGLTGAGEVLPVDILTTILQENS
FT                   IKGSVAGSGQDMHDALNFLVHGRIDPAPFLGAEYPLKDIQTAFDTFGDRPDDLKTQIVM
FT                   SD"
FT   gene            501353..502024
FT                   /locus_tag="RD1_0515"
FT   CDS_pept        501353..502024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0515"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30222"
FT                   /db_xref="GOA:Q16CS1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS1"
FT                   /protein_id="ABG30222.1"
FT                   /translation="MFRTNDQGRSEVTEKRKTRDADATRLRIMQAAKKEFAKHGLGGAR
FT                   VDEIAERAKANKRMIYHYFGSKEKLFKAVLEAAYLDIRNAEQKLDLDSMPAEKALEHLV
FT                   RFTWDYYLKNPEFITLVNSENLHRARHLKKSEVIAVASRKFVSMMQNLLDRGVQEGVFR
FT                   PGIDATQLNITIAAIGYYYLTNRFTGAIVFERDLMTPDALEERLAFNLDTIMRLVRADG
FT                   L"
FT   gene            complement(502021..502146)
FT                   /locus_tag="RD1_0516"
FT   CDS_pept        complement(502021..502146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30223"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CS0"
FT                   /protein_id="ABG30223.1"
FT                   /translation="MIGFFRALERLTKYLNHHVSRNKLNFDFRQRYVIEVFRMTL"
FT   gene            complement(502143..503246)
FT                   /locus_tag="RD1_0517"
FT   CDS_pept        complement(502143..503246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0517"
FT                   /product="sugar ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30224"
FT                   /db_xref="GOA:Q16CR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR9"
FT                   /protein_id="ABG30224.1"
FT                   /translation="MGFLDIENVTKSYGSTEVLHRVDVSVAEGEFLVLVGPSGCGKSTL
FT                   LNMIAGLEDITSGTIAIKGQPMNGVHPSKRNIAMVFQSYALYPNMTVAQNITFGLEMHG
FT                   VPKAERAAAMDKVADMLQITPLLNRKPGQLSGGQRQRVAMGRALVRNPDVFLFDEPLSN
FT                   LDAKLRVDMRTEIKKLHQRLGTTIVYVTHDQIEAMTLSTRIAVMNGGYVQQLGTPKEIY
FT                   DNPANVFVASFMGSPSMNLIPAILRRKGAAAMVEITDATGAPVLLPVAVDQGADGAAVL
FT                   LGIRPEAVTDPDGADKKARNVVLARNRIDVTEPAGSDTFITTCFAGKDVVGRMRADAEA
FT                   HPGEMAELALNMDKAVLFDPKTENRLR"
FT   gene            complement(503250..504131)
FT                   /locus_tag="RD1_0518"
FT   CDS_pept        complement(503250..504131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0518"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30225"
FT                   /db_xref="GOA:Q16CR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR8"
FT                   /protein_id="ABG30225.1"
FT                   /translation="MAIASSENAMRSGRFARTLIYLLLLLFALFYLLPLFVMLVNSLKP
FT                   LSEITGGNMMALPDVWTIQPWLSAWSTAQIGVDPTGLKPYFLNSIAMALPAVLLSTFFG
FT                   ALNGYVLTKWQFRGHNIVFGLLLFSCFIPFQIVLIPMAQSLGVLGLAGSTTGLILVHFV
FT                   YGIGFTTLYFRNYYAAFPTELVRAAQIDGAGFFRIFWRILLPSSGPIIAVSFIWQFTNI
FT                   WNDFLFGASFADADSQPMTVALNNLVSSSTGVKEYNVHFAGAIMAALPTLVVYVVAGRY
FT                   FVRGLMAGSVKG"
FT   gene            complement(504131..505024)
FT                   /locus_tag="RD1_0519"
FT   CDS_pept        complement(504131..505024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0519"
FT                   /product="sugar ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30226"
FT                   /db_xref="GOA:Q16CR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR7"
FT                   /protein_id="ABG30226.1"
FT                   /translation="MADTSSPDMRTRLQNWLPKLVLAPSFALVLFFVYGFILFTIYLSF
FT                   SDSRLLPSYGLVGWENYSKLFRLSHWETAITNLAVFATLYIVICSVIGLLLAILLDQKI
FT                   RGEGVLRPIYLYPMALSFIVTGTAWKWMLDPGIGIENTMHLWGWESFAFDWIKNRDYAI
FT                   YTVVLAAVWQSSGFTMAMFLAGLRGIDNEILKAAQMDGASNWQLYRRIIIPQLRPAFLS
FT                   AFVILSHLAIKSYDLVIALTGGGPGRATELPATFMYSYTFSRNQMGIGASSAVIMLMTV
FT                   AAIMVPYLYAELKEKK"
FT   gene            complement(505080..506330)
FT                   /locus_tag="RD1_0521"
FT   CDS_pept        complement(505080..506330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0521"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30227"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR6"
FT                   /protein_id="ABG30227.1"
FT                   /translation="MKKMIKGALIASTCLMGAAQIAQAEDVEVLHWWTSGGEASALNVL
FT                   KQDLEGQGIGWTDMPVAGGGGEQAMTVLRARVTAGNAPTAVQMLGFDILDWADQGALAD
FT                   LNATAAEQGWDDVVPDALKAFAKVDGKWVSAPVNVHSTNWVWANKSVLDANGIAVPETW
FT                   DDFVAAVDTLSAAGITPIAHGGQAWQDATVFDAVVMSTGGPEFYKAAFVDLDPEALNSD
FT                   TMVEAFNRMAFIRENVDDNFSGRDWNLATAMVMNGEAGFQMMGDWAKGEFLNAGKVPGE
FT                   DFLCFRFPGTQDQVTFNADQFAMFDQGGEVSAEQSALASAILSPSFQVAFNKVKGSVPA
FT                   RTDVDGSDLDACGQQGMKDLAAAASSGNLFGSMAHGHAAPASVKNAVYDVVTAHFNGEY
FT                   DAATAAEELATAVEIAQ"
FT   gene            complement(506487..508424)
FT                   /locus_tag="RD1_0522"
FT   CDS_pept        complement(506487..508424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30228"
FT                   /db_xref="GOA:Q16CR5"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR5"
FT                   /protein_id="ABG30228.1"
FT                   /translation="MFRFNLCVLLFATLATLSAAQEQTPAYVGSAECRDCHTKAAEAWE
FT                   GSHHAKAWTAPTAENIVADFNDTEFRHDGTLTRFRVEDGRHYITVTEKDGVTTDYPVHS
FT                   VAGIEPLQQYLLETEPGRIQSFDVVWDTIKQEWFHLYPDQDLPPDDGLHWTGPYKNWNA
FT                   RCAECHATGFEKNYSPVTRSYSSVPVEIGVGCEACHGPGSAHIAWATGKSLEEPLTGLS
FT                   EYRLTIDYDAGTETVLQQCASCHSRREAHFDGNPVPGIPFNDAYALALLRPGAYHADGQ
FT                   ILDEVYVYGSFLQSKMYQQGVSCSNCHEVHSAELKAEGNGVCTQCHSPAGNPSFTTLDS
FT                   KNYDDPSHHYHEAGTEGAQCKSCHMIERVYMGVDGRRDHSFRIPRPDISLETDSPNACT
FT                   DCHSDQSSAWAAAAIEEWYPDSENRGLHYGQVLAAGRANAVAARVPLTDLAGDTTQPGI
FT                   ARATALWLLEQSGDATLGAELSSMLTDTDPLVRAAAASAHGLFPPAERAAALEPALDDP
FT                   RRMVRIAAGKTLLDVPRSALTPSASERLGAALREWQAGLLNRADFPETHIILAGTALTM
FT                   RNFEGAERAFREVVLMDPQREEAWVMLVRIADAMRGPQAAAQVLDEALQAVPGSDTLNS
FT                   MRSESLLPPQ"
FT   gene            complement(508443..509720)
FT                   /locus_tag="RD1_0524"
FT   CDS_pept        complement(508443..509720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30229"
FT                   /db_xref="GOA:Q16CR4"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR4"
FT                   /protein_id="ABG30229.1"
FT                   /translation="MMQRRALFLAVLFGLWAGMALAQDPLVEVEFEENTTIPGQPLSLR
FT                   VTVLVPTWLPKPVVFPTLEAPNILVQLPEGATGPASRTIDGETWSGVSRRYRVTPMVPG
FT                   RVQIPAQELSVTWAEPGKPDPLQQTFTLDPIVVEGRVPEGAEDLSPFIAAQNLTLTQEV
FT                   SEADMPLQAGDSVTLTLTAQIEGTSAMFLPSLMPEIDIKGVAVYPSEPTIQDKEERGKL
FT                   SGTRTQSVTLVAQSGGGGAFPALELGWFNLTSQAVEIARTEGFDVTVDAPPALVQNTDP
FT                   RVLAAYVAGGLAALALCLLALRRLSPRLRAMMAARRRHMEASEHWAYAKAVEAAKARDF
FT                   DGLLRHLDIWAARCRVDPTAQATLQSALCALGAARYGPGGTSQNDAWKRVLTALPQVRA
FT                   AALKADRKKPELPPLNPTDAQSQRTA"
FT   gene            complement(509717..511261)
FT                   /locus_tag="RD1_0525"
FT   CDS_pept        complement(509717..511261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30230"
FT                   /db_xref="GOA:Q16CR3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR3"
FT                   /protein_id="ABG30230.1"
FT                   /translation="MGDFLFITVAEMLRAFDFIRPFVLLAVPVVLGLWWMVRRGSVRKD
FT                   QNTKGISPHLRKALTVGEAQGRRLTPIDGVAAAMILTVLAAAGPTWSRMPDPFVSPTAP
FT                   VVIVLKNTASMEQTDVAPSRLELAKFKIRDLLEMRAGARTALVAYAGSAHRVVPFTEDV
FT                   QIMVPYLEGLTPDVMPQEGNNAQDALALAMDILATEDAPGGILFLLDDLDVQDASAITQ
FT                   AGANAVVLHQILPSGTNSRGLDMVDGAPVIPVSVDDADLRQIDRTLNAAYRAAVLETST
FT                   QPWQDRGWIFAIPAALLCLIWFRRGWTMKWAIVLLITMTGINQPQRTAAEGVADWFLTP
FT                   DQQGQLAYNRNDFKRAAELFQDPMWQGYTMMRDGQYDKAVEVLARLETAEAAFAQGLAH
FT                   IRNRQYRDGVRAFETVLERDPDYPGAAENLATAREIVDYIETVQEQSDTGEEAGIGADD
FT                   TVFDNESGRGAETEIETSDPDEMGMLSTEQWMNTVDTRTGDFLRQRFLIEQSRSSE"
FT   gene            complement(511261..512244)
FT                   /locus_tag="RD1_0526"
FT   CDS_pept        complement(511261..512244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30231"
FT                   /db_xref="GOA:Q16CR2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR2"
FT                   /protein_id="ABG30231.1"
FT                   /translation="MISFVFPWAFLALPLPWLIWRFVPAHKETVPAIRFPFFRQVIAEA
FT                   KLTPAKGAVIMRRNWLQIIAASLIWILLVIAISQPERLGAPIETSKSARDLILAIDISG
FT                   SMDTRDFTDASNENLQRLAGVRDVVRAFVEGREGDRMALIVFGSKAYLQSPLTEDTGTI
FT                   VELLDQTEVGMAGPHTAIGDAIGLSIRTFEASEIEQRLLILLSDGADTASRMSPLNAAE
FT                   IARGAGVEIFTIAVGDPDGTGENRVDVAALQDIANRTSGSYFFAADQAALDEIYARIDE
FT                   LAPRLTETQSFRPRQTLHHIPLILAMFIGIGSVALLQLTSHRKTSV"
FT   gene            complement(512241..512729)
FT                   /locus_tag="RD1_0527"
FT   CDS_pept        complement(512241..512729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30232"
FT                   /db_xref="GOA:Q16CR1"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR1"
FT                   /protein_id="ABG30232.1"
FT                   /translation="MSEKTPSTNAPTSLVDLINKLVEPVEPAPISMVPQTGGWVVLAIV
FT                   LIVLALYGVLRIRAHLRRNAYRKAALSALEQAGDDAAAIATILRSTALAAFPRAQVASL
FT                   SGPEWLAFLDRCAGMDDFTNGAGQVLATAPYASCARADPALREAAKNWVRRHQRQVSA"
FT   gene            complement(512726..513709)
FT                   /locus_tag="RD1_0528"
FT   CDS_pept        complement(512726..513709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30233"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CR0"
FT                   /protein_id="ABG30233.1"
FT                   /translation="MRDIPARIRTNTLPDPAPVPKGLDTRIHVTLPHLRGLEGPARGLH
FT                   FLPRQPARSVLNGRHTSRLRGRGLNFEELRDYMPADDVRSIDWKVTARTGKPYVRVFTE
FT                   ERDRPTLIVVDQRMSMFFGSVLNMKSVTAAECAALAAFAILEQGDRVGGIVFGDDLRAE
FT                   IKPARSRAALNRFLSALASANQLLRPEAPTVPPQSINQVLGAVARIAPRNHLVIVLSDF
FT                   DVIDDQTRKLVRGLSRHNDLILGLVTDPFADNLPPDAKLVITDGVLQAAVDMSDSQVHR
FT                   DLTEFAKRRVAEIVDWQRQFGISVLPLTSAEDSLVQMRRLMGLGRR"
FT   gene            complement(513720..514709)
FT                   /gene="moxR"
FT                   /locus_tag="RD1_0529"
FT   CDS_pept        complement(513720..514709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="RD1_0529"
FT                   /product="MoxR-like ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30234"
FT                   /db_xref="GOA:Q16CQ9"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ9"
FT                   /protein_id="ABG30234.1"
FT                   /translation="MSARTDIDTLIERMGEAIIGQRDVIERLVIGLLANGNLLVEGLPG
FT                   LAKTRAIKALAKNLQCDFSRIQFTPDLLPSDVTGTEVYYHKEGGSEFKFEPGPIFANIV
FT                   LADEINRAPAKVQAALLEAMEERQVTVAGTTHPMEPLFMVMATQNPVEQEGTYPLPEAQ
FT                   MDRFLMHVNITYPPVEDEVLVIRLVRGEEAAASAAPDDKVKSEKPAPISQSTVFEARRE
FT                   IVAIHVSDAMERYMADLVNATRIPEAFGDDLKRWIEIGASPRASLALDKCARTHAWLKG
FT                   RDYVDPQDVRAIAPDVFRHRLGLTYEAQGEGVSPDQVVAEILTQVALT"
FT   gene            complement(514706..515662)
FT                   /gene="napD"
FT                   /locus_tag="RD1_0530"
FT   CDS_pept        complement(514706..515662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="RD1_0530"
FT                   /product="nonspecific acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30235"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ8"
FT                   /protein_id="ABG30235.1"
FT                   /translation="MRGLLFSAAICLATSPALSDPLPSWGSTENKSTIISFVESVTDPT
FT                   SPDYVTPADRIAVFDNDGTLWGEQPVYFQLIYALDRLKAKAEADPSILTSDILRAGAEG
FT                   DLETIAAGGVEGLLEILAVSHSGMSVEAFQNDVRDWLDEARHPTTDMRYDAMVYQPMLE
FT                   LLSYLRDEGFQTWIVSGGGVHFIRAFAESAYNIPPEQVIGSAGPTEYLDGQVMKLPGID
FT                   FVDDKEGKPVGIDNRIGKRPIIAGGNSDGDFAMLEYTTAGDGPRLGILVHHTDAEREFA
FT                   YDREGHIGVLNRGLDEGPDRGWVIVDMARDWEQVWPE"
FT   gene            complement(515751..517349)
FT                   /locus_tag="RD1_0531"
FT   CDS_pept        complement(515751..517349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0531"
FT                   /product="arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30236"
FT                   /db_xref="GOA:Q16CQ7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ7"
FT                   /protein_id="ABG30236.1"
FT                   /translation="MRFTKHLTIKALAVTALTFASSAAMAQDEKPNILVIWGDDVGQSN
FT                   ISAYTMGLMGYRTPNIDRIAEEGMIFTDYYGEQSCTAGRSSYIMGQSVFRTGLSKVGLP
FT                   GAELGMQEEDPTIAGLLKAQGYATGQFGKNHLGDRDEHLPTNHGFDEFFGNLYHLNAEE
FT                   EPENYDYPGDAVMPDGRTFRETFGPRGVIRSSADGEIEDTGPLTKKRMETVDDETVAAA
FT                   IDFIKRKEAEGTPWFLWWSGTRMHFRTHVSDGRQQAANELVGKPVDEYTAGMIEHDMHI
FT                   GQFLDVLDELGIADKTIVHYSTDNGPHMNTWPDAAMTPFFGEKNTNWEGGWRVPSMVRW
FT                   PGLIEPGSVSNSIMHHMDWLPTYLAAAGRPTIKEELLEGITVAEVGGGRDYRVHLDGYN
FT                   FLPYFSGEVDTGPRQEIFYFSDDGDLTALRFNDWKLIFLEQKAYTTLRAWAEPWTELRL
FT                   PLIFNLRRDPYERSYRTSNTYWDWLIDRAYMLVPAQAYVGQFLETFQEYPPRQKAASFS
FT                   LEQVMEKLTETPGTP"
FT   gene            complement(517512..517958)
FT                   /gene="coxG"
FT                   /locus_tag="RD1_0532"
FT   CDS_pept        complement(517512..517958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="RD1_0532"
FT                   /product="carbon monoxide dehydrogenase G protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30237"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ6"
FT                   /protein_id="ABG30237.1"
FT                   /translation="MDLKDEIVINAPRQVVYDALNDAEILKECIPGCEELHKHSDTELE
FT                   AKVVLKIGPVKAKFNGNVTLSPDAPPEHFSLKGEGNGGAAGFAKGGADVTLEEHEEGTL
FT                   LRYDAHADIGGKLAQLGNRLVQGTAKKLAGKFFANFAEHVGEKS"
FT   gene            complement(518053..518931)
FT                   /locus_tag="RD1_0533"
FT   CDS_pept        complement(518053..518931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0533"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30238"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ5"
FT                   /protein_id="ABG30238.1"
FT                   /translation="MPAVYMDQHPDVTAFFDAQSNTISYLVKDPASTACAVVDAVMQFD
FT                   YASGRLSYDSADEIIAAIQAQGLTLEWIIESHVHADHLSGAPYIQQKLGGKIGIGEHIT
FT                   EVQDTFGKVFNEGTEFERDGSQFDKLFKDGDRYHVGEMACFALHTPGHTPACMVHVMGN
FT                   AAFTGDTLFMPDGGSARADFPGGDAGQLYDSIQRVLSLPDDVRLFVCHDYGPGGRAISW
FT                   ETTVGEQRASNIHIGGGTSREEFVKMREARDAQLSMPALIIPSLQVNIRAGEVPRDAQG
FT                   NMTLKIPVNKL"
FT   gene            complement(518992..519393)
FT                   /locus_tag="RD1_0534"
FT   CDS_pept        complement(518992..519393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30239"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ4"
FT                   /protein_id="ABG30239.1"
FT                   /translation="MQKFKISAADLVSAARARIKEIETPDLIAMMDDPDVVIVDIRDPR
FT                   ERERSGFIPGSYHAPRGMIEFWVDPESPYFKDIFGQSKTYVFHCASGWRSALTVAQLQD
FT                   MGFDAAHLREGFSTWEKQGGPATFADKND"
FT   gene            complement(519428..520498)
FT                   /locus_tag="RD1_0535"
FT   CDS_pept        complement(519428..520498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0535"
FT                   /product="amine oxidase family, flavin-containing"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30240"
FT                   /db_xref="GOA:Q16CQ3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ3"
FT                   /protein_id="ABG30240.1"
FT                   /translation="MTPRHRADVVIVGGGIAGLYLADRLHQAGRDYLLVESRDRLGGRV
FT                   LSETVNGAAYDLGPAWFWAGQPRIAGLISRFALPVFEQYAQGEFRFEDAQGRIQQGRGA
FT                   ASMQGSFRIDGGMSTLCAALAGQIDPSRILLNTKVRHLSQADGNILVSCAAGVDIEARS
FT                   VVLAIPPRVAACLDFSPALPTAATKTMAAIPTWMASQAKAVILYDTPFWRDMGLSGDAM
FT                   SHKGPMVEVHDASTASGSGAALFGFIGVPPDRRDQQVLKAAIVDQLIRLFGSQAASAHA
FT                   VLIKDWAADTNTATPADHAPLTTHPRYGLPPALAGLWDGRLIFGGSEVAATFGGYLEGA
FT                   LEAADAALVESMPHRP"
FT   gene            complement(520495..521172)
FT                   /gene="chrR"
FT                   /locus_tag="RD1_0536"
FT   CDS_pept        complement(520495..521172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrR"
FT                   /locus_tag="RD1_0536"
FT                   /product="transcription negative regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30241"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ2"
FT                   /protein_id="ABG30241.1"
FT                   /translation="MDLHADFSQRVVVHSDEVEWRASPMPGVDRRMLDRIGGEVARATT
FT                   IVRYAPNSRFSEHTHTGGEEFIVLDGVFSDEHGDFPAGSYVRNPPTSAHSPHSDTGCTI
FT                   FVKLWQFQPEDRTHVVIDMNKMEFIPDATRAGVSVMTLFHDNQETVRAEKWAAGASVAM
FT                   DLPDGGEFLVLEGSMTEGGDQLQQGSWLRLPCASTLNATAGPKGVRLWAKLRHIQHAKP
FT                   PAP"
FT   gene            521314..522093
FT                   /locus_tag="RD1_0537"
FT   CDS_pept        521314..522093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0537"
FT                   /product="creatinine amidohydrolase"
FT                   /EC_number="3.5.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30242"
FT                   /db_xref="GOA:Q16CQ1"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ1"
FT                   /protein_id="ABG30242.1"
FT                   /translation="MVGVIYWEDLRAPDFKSLPERAIAVLPMGASEQHGPHLAVSVDSD
FT                   LVEAVLARTQVADGCTVLVLPTLRVTKSAEHDRHPGTLSLTGDTLLAVLRDIAASVHRA
FT                   GIDRLCLFNGHGGNTALLEVAVRDMRITHDMIAVHCGWFGFAQAQAHFDAQALAMDVHG
FT                   GDIETSAMLAAAPEKVDMAKARDFRPAMQDWPQKWIGLTGQVARPGWLIDDLNADGACG
FT                   NAAAATVEKGEALLSSAARNFSDFLGELAAFDHRASL"
FT   gene            522162..522704
FT                   /locus_tag="RD1_0538"
FT   CDS_pept        522162..522704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0538"
FT                   /product="hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30243"
FT                   /db_xref="GOA:Q16CQ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CQ0"
FT                   /protein_id="ABG30243.1"
FT                   /translation="MSEIKRQFRRTVYENRWMKVHEDAVTFPDGSDGIYGVVDKEDFVL
FT                   IVPQHADGRFQLVQQFRYPVGGRYWEFPQGSWETRPGTDPEKVALAELEEETGFRAQSL
FT                   IRLGHLFEAYGFSNQGFHAFLATGLQAGRVNRDKEEQDMQTASFSLEAIHDMIRAGQIK
FT                   DAPSIAALGLLAISEHG"
FT   gene            complement(522774..523604)
FT                   /locus_tag="RD1_0539"
FT   CDS_pept        complement(522774..523604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30244"
FT                   /db_xref="GOA:Q16CP9"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP9"
FT                   /protein_id="ABG30244.1"
FT                   /translation="MQDPDCPRNCKQRKRPARPEAVSQDTNHQSATAGKFRPFKCVGWT
FT                   RKEVNMHIEPGVVDGAKMVLAYGTAAAAAGYSLKLINDDLKTHSVVSFALRSVIAAIGV
FT                   FIFFEVFPHFAVGISEVHIILGTTLFLLLGSGPAALGLAGGLAIQGLFFAPSDVPMYFV
FT                   NVSTLLFPLFAVDALAKRVIPQTTAYVDLRYVDVLKMSAVYQGGVVAWVAFWAIYGQGV
FT                   GADNLSAVTSFGVAYLLVILIEPLADLAALAGAKGLRAMTDRGIFTHRLHNAAT"
FT   gene            523935..525065
FT                   /locus_tag="RD1_0540"
FT   CDS_pept        523935..525065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0540"
FT                   /product="ABC transporter substrate binding protei"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30245"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP8"
FT                   /protein_id="ABG30245.1"
FT                   /translation="MKSLILSAALAALAGGASAEGVKVGMITTLSGGGAGLGIDVRDGF
FT                   MLAVKQSGRDDIEVVIEDDQRKPDIAVQLADKMIQSEKVDVMTGIIWSNLAMAVVPATV
FT                   AQGKFYLSPNAGPSALAGKGCHPNYFNVAWQNDNLHEAAGAYATSAGYSNSFILAPNYP
FT                   AGQDALTGYKRTFGGELAGELFTKLGQTDYAAEIAQIRASGADSVFFFLPGGMGISFLK
FT                   QYADSGIDIPVVGPAFSFDQGILQAVGDAALGVVNTSQWSKDIDNPTNAAFVETFQAEY
FT                   GRLPSLYASQGFDTANLLISALATASPADADAFRAALKAADFDSTRGDFAFGPNHHPIQ
FT                   DIYAREVIKEGDVFTNKIIGVALEDHADAYAAECKM"
FT   gene            525117..526037
FT                   /locus_tag="RD1_0541"
FT   CDS_pept        525117..526037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0541"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30246"
FT                   /db_xref="GOA:Q16CP7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP7"
FT                   /protein_id="ABG30246.1"
FT                   /translation="MSTILIIEQVLNGLQFGVMLFLMAAGLTLIFGVMGLINLAHGSLY
FT                   MIGAFAAAAVAGLTGSFLLALFAAMAAAAMAGVLIETVVIRRLYATDHLDQVLATFALI
FT                   LIFSEGTRWVFGSFPLFLDIPDAVSGPVSLPGGIQYPLYRLVLIAVGLAVGLGLALLIN
FT                   RTRNGVQIRAGENDREMIAALGVDISRLYTLVFALGAALAGLAGALVGAIQSVQVGMGE
FT                   PVLILAFVVIVIGGIGSIKGAFVGALLVGLTDTLGGIFLPELFKLFTDAATATSAGSAL
FT                   ASMAIYILMGAVLIWRPTGLYGARA"
FT   gene            526037..527017
FT                   /locus_tag="RD1_0542"
FT   CDS_pept        526037..527017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0542"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30247"
FT                   /db_xref="GOA:Q16CP6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP6"
FT                   /protein_id="ABG30247.1"
FT                   /translation="MSERMVNSVVLIGLCAVPIWALLVDEPFTITLATRAVIFALAAVG
FT                   LNIALGWGGLVSLGHAVFFGLGGYAMGILAHHAQTFTPVMEWPFLIEGTKSMPVIWLVA
FT                   MISAGVAALVIGLLSLRTAGVYFIMITLAFGQMFYYFAISWAEYGGEDGLSIYVRNDFP
FT                   GLNTLVPIHFFALCFVILCIVLFINARLIKSPFGLALNAARQVPTRVETVGMDPVRLKL
FT                   VAFVISGVITGLAGALFADLNRFVSPTMFSWQMSGEIMIFVILGGVARLFGPVVGAVLF
FT                   VVLEHFLGGLSNYWHIYLGLLLLIIVLFARGGIIGLLCGRGRLHD"
FT   gene            527010..527759
FT                   /locus_tag="RD1_0543"
FT   CDS_pept        527010..527759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0543"
FT                   /product="ABC transporter subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30248"
FT                   /db_xref="GOA:Q16CP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP5"
FT                   /protein_id="ABG30248.1"
FT                   /translation="MTNPVLATHNLSKSFGALTATDDVTLDLRAGEIHAVIGPNGAGKS
FT                   TLIAQICGGLTPDRGRIEFLGRDVTQEPTRLRARAGLGRTFQISALAMEDSVLQNVMLG
FT                   ALGAMGRPWQFLRPALRDNALRDRAEAALARVGLTDARAKRTAELSHGQRRQLEVAVAL
FT                   SLQPKAFVMDEPMAGLGSEGSRQLTGFLDSLRADAPILLVEHDMDAVFALADRISVLVY
FT                   GKVIETGTVAEIRASKAVRDAYLGGEA"
FT   gene            527756..528442
FT                   /locus_tag="RD1_0544"
FT   CDS_pept        527756..528442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0544"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30249"
FT                   /db_xref="GOA:Q16CP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP4"
FT                   /protein_id="ABG30249.1"
FT                   /translation="MTLLTLRNVEASYGVSPALFGVDLSLQPGEVMALMGRNGMGKSTT
FT                   VKAICRMVPTRGTLQFDGHDLSRLPSHRAARLGIGLVPEGRRCFSSLTVSQNLSAAARP
FT                   GHWTFETVTKLFPRLAERRDQKAATLSGGEQQMVAIARALMTNPRLLILDEATEGLAPL
FT                   VRQEIWAALTELKRSTGMSIILIDKSLGELSRICERATILERGTTVWSGAMSDVTPEIS
FT                   TRYIGV"
FT   gene            complement(528533..529450)
FT                   /locus_tag="RD1_0545"
FT   CDS_pept        complement(528533..529450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0545"
FT                   /product="glyoxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30250"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP3"
FT                   /protein_id="ABG30250.1"
FT                   /translation="MDKKRMNGLHHITAISGPPQANADFFTKVMQQRLVKKTVNFDDPG
FT                   TYHLYYGNETADPGTILTFFPFVNAGPGRAGPGMASAYAYAVGRGGFDTWMERLALETL
FT                   DFDGPTERFGSRVIRITDPDGAKVELIEVDGDDGPTLDGFHSVTLQLNDLEPTQRLLTD
FT                   VMGYDEVAHKTGNGEERLRLQLPGDARGRIVDLMRADVPSIGRQGAGSIHHVAFRALDD
FT                   EDQLDWRERLLSAGMDVTPVIDRQYFNAIYFREPGGVLFEIATDPPGFTRDEDLAHLGR
FT                   SLQLPAQYESARDRIEQVLPPLVA"
FT   gene            529666..531387
FT                   /gene="fadD"
FT                   /locus_tag="RD1_0546"
FT   CDS_pept        529666..531387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="RD1_0546"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30251"
FT                   /db_xref="GOA:Q16CP2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP2"
FT                   /protein_id="ABG30251.1"
FT                   /translation="MTAQERPWTAFYGVGVRPDLPEASYRTIGDLVHSVANTYGKAPAF
FT                   TACMPNGMNGTLTFEQVDQMSDAFAVYLREVAGLQQGDRVALQMPNCLSFPIAAFGILK
FT                   AGCVLVNVNPLYTADEMAKQFVDAEPHALIIVDMFADKIPQATRGHPIPNIIVTRVAEF
FT                   LPTLPKWIIGLVQKHWDKSVKAIEVPHIRLPDAIAAGRVHMQSEKIEVYAYRRNVQPDD
FT                   IACLQYTGGTTGVAKGAMLTHANLIMNMEQVMELISGVEKGKEVALTALPMYHIFAFTV
FT                   NLLGFYWLGARNILIPNPRPLVSLKRAMENYKITWMSGVNTLFNGLTNEVWFTDSPPKH
FT                   LKFASAGGMALQTAVEERWQEITGKPVVQGYGLTETSPALTFEPLGKKRSGTIGVPVPS
FT                   TLVACLDEYGHEVPVGQSGEIAAKGPQIMAGYWNKPEETAAVMKDGWFLTGDIGVMDAD
FT                   GYFTIVDRKKDMVVVSGFNVYPNEIEECLATHPAIVEAAVIGVPDDATGEAVKAFVVKR
FT                   DPSLSEAEVRAHCKAHLTAYKIPKRVEFRDELPKSNVGKILRKDLRASEIAHQAQE"
FT   gene            531393..532274
FT                   /locus_tag="RD1_0547"
FT   CDS_pept        531393..532274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0547"
FT                   /product="putative sodium/bile acid symporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30252"
FT                   /db_xref="GOA:Q16CP1"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CP1"
FT                   /protein_id="ABG30252.1"
FT                   /translation="MVGAFEQAILALMIFVIMLGMGASLTPRDFYLALRRPYGLAIGVV
FT                   AQYGFMPLIGFLLATLLNVPPAIAIGILIMSCMPGGTTSNIFTYFSKGNLALSVLMTVT
FT                   STVTGVIMIPIVLLVYATALELEIPRENIIATLVLLLVPVAIGMVLRKISANVGAVTEF
FT                   FGSALALFFILFLIVSWIPRNWQFLLETSAATYFASIALGVFGITIGYIFARALRLHPR
FT                   NARTVALETGIQNGPLAIAIIVFTFSGAEQQAVTAVPVLYSLFIVIVATLVTLVFRRAN
FT                   TAAEQKMPDSLI"
FT   gene            complement(532374..534302)
FT                   /gene="dxs"
FT                   /locus_tag="RD1_0548"
FT   CDS_pept        complement(532374..534302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="RD1_0548"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30253"
FT                   /db_xref="GOA:Q16CP0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CP0"
FT                   /protein_id="ABG30253.1"
FT                   /translation="MTDMPKTPLLDLVHRPADMKGLSDRQLVQLADELRSETVSAVSVT
FT                   GGHLGAGLGVVELTVALHAVFDTPRDKIIWDVGHQCYPHKILTERRDRIRTLRMKGGLS
FT                   GFTKRSESPYDPFGAAHSSTSISAALGFAVARDLGGVVPEGLGDAIAVIGDGSMSAGMA
FT                   YEAMNNAGHLKKRMIVILNDNEMSIAPPTGAMSSYLSRLYSGEPFQDFKAAAKGAVSLL
FT                   PEPFREGAKRAKDMLKGMAVGGTLFEELGFSYIGPIDGHDLDQLLPLLRTVKARATGPI
FT                   MIHALTKKGKGYAPAETARDKGHATAKFDVLTGQQTKAPSNAPSYTKVFAQSLLEEATK
FT                   DDKICAVTAAMPDGTGLNLFAERFPSRCFDVGIAEQHGVTFSAALAAGGMKPFCAMYST
FT                   FLQRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGATHAGSFDIAYLANLPGFVVMAAAD
FT                   EAELKHMVATAVAHDDGPIAFRFPRGEGNGVDMPEVGEVLEIGKGRIITEGTRVAILSF
FT                   GTRLAEVQKAGEALAARGITPTIADARFAKPLDREMILDLVANHEALITVEEGAIGGFG
FT                   SHVAQLLSDEGVFDTGFKYRSMVLPDIFIDQSSPADMYAVAGMNAADIETKVLSVLGIA
FT                   QIGEARA"
FT   gene            complement(534312..535181)
FT                   /gene="ispA"
FT                   /locus_tag="RD1_0549"
FT   CDS_pept        complement(534312..535181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="RD1_0549"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30254"
FT                   /db_xref="GOA:Q16CN9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="PDB:4LLS"
FT                   /db_xref="PDB:4LLT"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN9"
FT                   /protein_id="ABG30254.1"
FT                   /translation="MFTQRLDAAAAAVQAHFDKVLAAFEPLPIVEAMAHATSGGKRLRG
FT                   FLVLETARLHDIAAGEAIWSATAIEALHAYSLVHDDLPCMDNDDMRRGQPTVHKKWDDA
FT                   TAVLAGDALQTLAFELVTHPGASASAEVRADLALSLARASGAQGMVLGQALDIAAETAR
FT                   APLSLDEITRLQQGKTGALIGWSAQAGARLAQADTAALKRYAQALGLAFQIADDILDVT
FT                   GDSAQVGKAVGKDASAGKATFVSLLGLDAARARAMSLIDEACDSLATYGAKADTLRETA
FT                   RFVVRRTH"
FT   gene            complement(535185..535445)
FT                   /gene="xseB"
FT                   /locus_tag="RD1_0550"
FT   CDS_pept        complement(535185..535445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="RD1_0550"
FT                   /product="exodeoxyribonuclease VII, small subunit,
FT                   putative"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30255"
FT                   /db_xref="GOA:Q16CN8"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN8"
FT                   /protein_id="ABG30255.1"
FT                   /translation="MQDTDAMTDTPVTEMSFEQAMSELEKVLGQLERGDVALDESIALY
FT                   ERGAALKKRCEEKLKEAEEKVAAITLDADGAPTGTKPVTGL"
FT   gene            complement(535521..536222)
FT                   /gene="petR"
FT                   /locus_tag="RD1_0551"
FT   CDS_pept        complement(535521..536222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petR"
FT                   /locus_tag="RD1_0551"
FT                   /product="DNA-binding response regulator PetR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30256"
FT                   /db_xref="GOA:Q16CN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN7"
FT                   /protein_id="ABG30256.1"
FT                   /translation="MSDFDAHLLIVDDDERIRTLLQKFLMRNGFLVTAARDAAHARRIL
FT                   LGLDFDLIVLDVMMPGEDGLAFTRALRETNAVPILLLTAKGDTDNRIEGLEAGADDYLP
FT                   KPFEPKELLLRINAILRRVPEVLEDATAPKVLSLGPIRYDLERGELWQGEDLVRLTATE
FT                   MHLMKIFSASCNEAISRAKLVEELGRDRGQAQERAVDVQITRLRRKIESDPKQPRYLQT
FT                   VRGAGYMLAPD"
FT   gene            complement(536219..536731)
FT                   /gene="marR"
FT                   /locus_tag="RD1_0552"
FT   CDS_pept        complement(536219..536731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="RD1_0552"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30257"
FT                   /db_xref="GOA:Q16CN6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN6"
FT                   /protein_id="ABG30257.1"
FT                   /translation="MADGRAGSAHHGENLLFLTDEQLRQGIEAMFFAYRGFTADPDRIL
FT                   SDMAYGRAHHRAIHFINRAPGTTVNNLLNILGVTKQSLNRVLRTLIEDGLVESRVGKND
FT                   KRERHLFLTPDGRALEQKLSDAQRARMRMAFRDAGPDAVAGFRRVLEAMMDREMRYAYT
FT                   RLKDSGT"
FT   gene            536900..537769
FT                   /gene="ilvE"
FT                   /locus_tag="RD1_0553"
FT   CDS_pept        536900..537769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RD1_0553"
FT                   /product="branched-chain amino acid aminotransferase,
FT                   putative"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30258"
FT                   /db_xref="GOA:Q16CN5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN5"
FT                   /protein_id="ABG30258.1"
FT                   /translation="MAGAYNDRDGHIWMDGQMVDWRDANVHILTHAMHYASSVFEGERA
FT                   YNGKIFKSREHSERLKRSAQMIDFEIPYTVDEIEAAKVEVLEKSGLQDAYVRAIAWRGA
FT                   GEDMGVASARNPVRLAIAAWEWGAYYGDAKMKGAKLDISKWKRPSPETIPSHAKAAGLY
FT                   MICTMSKHAAEAKGCSDAMMFDYRGYVAEATGANVFFVKDGEVHTPDPDCFLNGITRQT
FT                   VIGMLREKQIKVHERHIMPEELEGFEQCWLTGTAAEVTPVGQIGDYNFEVGNLTRDIAQ
FT                   SYETLVRA"
FT   gene            537729..538130
FT                   /locus_tag="RD1_0554"
FT   CDS_pept        537729..538130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30259"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN4"
FT                   /protein_id="ABG30259.1"
FT                   /translation="MTSRKATKPSFGPDRMDYAAFAVEWEAAWNSHAIDRIMAHYALDV
FT                   VFRSRKAMRLVGQGEIRGRDALRDYWIKALDQQPGLSFIVTNVFIGHAMIVITYRNQND
FT                   VEAAETLRFGPDGLVIEASACHRVPSHSL"
FT   gene            complement(538166..539140)
FT                   /locus_tag="RD1_0555"
FT   CDS_pept        complement(538166..539140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0555"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30260"
FT                   /db_xref="GOA:Q16CN3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN3"
FT                   /protein_id="ABG30260.1"
FT                   /translation="MATDLTQNKPGRAIALKLCAVFLFMVMAALIKSVSPHVPPGQAVF
FT                   FRSFFALPVLVLWLWQRGQLRQGLVPSNLMGHVWRGIFGTSAMGLTFAGLGLLPLPEVT
FT                   AIGYATPLFAVLFAAIFLGERVRIVRLSAVALGLIGVMIVIAPRLSVGADNVTSAATIG
FT                   AILVLIASILRAMVQIHVRRLVQTDTTASIVFYFSITASTLGLLTLPLGWATGLDVLAW
FT                   TAPPAWVIWMLILSGLIGGIAQIMVTASYRFGSASMLAPFDYASMIFASFIGYIAFGEL
FT                   PTGPILIGASLVIAGGVLIIWRERQLGLDRSKSKPNVPPSGTP"
FT   gene            complement(539207..540307)
FT                   /gene="aroC"
FT                   /locus_tag="RD1_0556"
FT   CDS_pept        complement(539207..540307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="RD1_0556"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30261"
FT                   /db_xref="GOA:Q16CN2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CN2"
FT                   /protein_id="ABG30261.1"
FT                   /translation="MSMNSFGHLFRVTTWGESHGTALGATVDGCPPGVAIDAGKIQHWL
FT                   DKRKPGQNKYTTQRREADEVKILSGTFEGVTTGTPVQLMIENTDQRSKDYGDIKDKFRP
FT                   GHADITYFQKYGVRDYRGGGRSSARETAARVAAGGLAREAIKSIAPGIDIKGYMTRMGA
FT                   HEIDRSRFDWDQIDANPFWTPDAQAADEWASYLDGLRKSGSSVGAVIEVVARGVPAGLG
FT                   APIYAKLDTDLAAAMMSINAVKGVEIGEGMSAAMLTGELNADEISMGRDGPQYSSNHAG
FT                   GILGGISTGQDIVVRFAVKPTSSILTTRKTITKSGEDTEIITKGRHDPCVGIRAVPVGE
FT                   AMMACVLLDHLLLHRGQVGQNQGHIG"
FT   gene            540540..541520
FT                   /locus_tag="RD1_0557"
FT   CDS_pept        540540..541520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0557"
FT                   /product="thiamin ABC transporter, periplasmic
FT                   thiamin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30262"
FT                   /db_xref="GOA:Q16CN1"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN1"
FT                   /protein_id="ABG30262.1"
FT                   /translation="MRRTLITAGIVLASQAAAETPVLTVYAGDYFTSEWGPGPMIETGF
FT                   EEICGCDLQFSTGDLVPRLLLEGARTKADVVMGLTSDVTSKARATGLFAPHGQDNGALT
FT                   LPVDWTDDTFLPFNYGHAAFVYNTATVANPPASFEAMLDMPDDVKIVIQDPRTSLSGLA
FT                   LVLWVQSVFGDDAGAAWEKLAPNILTVTKDWSASYGMFTDGEADMVLSYTTSPAYHMFA
FT                   EDDFTRKAAIFPEGHYFMVETVGKIAATDQPELADAFMAYVMSESFQSSIPQANWSLPS
FT                   ALPQDQWPEGWAQLPLPDKVLFYSEADATALQAEAIETWRAALSQ"
FT   gene            541496..543052
FT                   /gene="thiP"
FT                   /locus_tag="RD1_0558"
FT   CDS_pept        541496..543052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="RD1_0558"
FT                   /product="thiamine transport system permease protein thiP"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30263"
FT                   /db_xref="GOA:Q16CN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CN0"
FT                   /protein_id="ABG30263.1"
FT                   /translation="MARSAQPISGHAGIVAGTLVVAAVLLAFLGIGLRAEASAGFGAAE
FT                   WQAIRFTVVQSVLSALISVALAIPLARALARRDLPGRQLLITLLGAPFILPVIVAVLGL
FT                   LAVFGRNGWVNAAFGTLGLPPVSIYGLHGVVLAHVFFNLPLATRLLLQGWQSIPAERFR
FT                   LAAQLNLSPWVIFRTIEVPLLARILPGAAALIFVICLTSFAVALTLGGGPRATTIELAI
FT                   YQAFRFDFDLSKAALLSVIQLVLAGGAAVLALWIIPQISLTGGMDRPVQRWDGRGGLQR
FT                   FGDGVAILLGAGFLLLPLFSVAVSGLIGLPEVPASVWRAALTSLWVAGISVCVLLAVAL
FT                   PLAGWIAIHARGSVEAIGLLGLSASPLMIGTGWFILINPIADPVSLSLLVTAVVNALMA
FT                   LPFALRIVVPGIREALQSHGRLCMTLNMTGWTTWRWVILPRALPQIGFAAGLTGALSIG
FT                   DLGVIALFADPDRTTLPLQMYRLMGAYKTEAAAGAALILLAMALGIFWSFDRGARWYAR
FT                   T"
FT   gene            complement(543269..543583)
FT                   /locus_tag="RD1_0559"
FT   CDS_pept        complement(543269..543583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30264"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM9"
FT                   /protein_id="ABG30264.1"
FT                   /translation="MAPVSPASAATRSSISCRKAGPSAAKGSSNSTSGLFCTRTRASAA
FT                   RLCCPPDKAPGRRASNPARPTRRMAAATCALSSALSLRLGRKPRLTFCATLRCGNRLLS
FT                   "
FT   gene            complement(543831..544277)
FT                   /gene="ribH"
FT                   /locus_tag="RD1_0560"
FT   CDS_pept        complement(543831..544277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="RD1_0560"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase,
FT                   putative"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30265"
FT                   /db_xref="GOA:Q16CM8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM8"
FT                   /protein_id="ABG30265.1"
FT                   /translation="MTHTRFTFVKAQWHADIVDRALDGFTEIIPAAQVDVFDVPGAFEM
FT                   PLMARDLAATGRYDAVVCAAFVVDGGIYRHDFVAQSVVDGLMRAGLDTGVPVLSVSLTP
FT                   HHYQETDHHNEIYRSHFVTKGREAAQAALGILKTRQSLSARNAA"
FT   gene            544574..545200
FT                   /locus_tag="RD1_0561"
FT   CDS_pept        544574..545200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0561"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30266"
FT                   /db_xref="GOA:Q16CM7"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM7"
FT                   /protein_id="ABG30266.1"
FT                   /translation="MHPNPAFHTRQEIENLAFARERGFGVLAVNGEDGPLLSHIPFLVD
FT                   EDGKTVWLHLVRSNPIVRALSEKRPAKIAVSGPDSYISPDWYGVIDQVPTWNYVAVHLT
FT                   GELELRPQEELHGILDRQSAHFEDRLVPKTPWTTDKMSDGVMTRMMRAIVPCRMVLSAV
FT                   EGTWKLNQNKAPEVRQSAADHVDAYGQGTELKLLSALMRAVDGQT"
FT   gene            545243..545845
FT                   /locus_tag="RD1_0562"
FT   CDS_pept        545243..545845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0562"
FT                   /product="glutathione S-transferase family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30267"
FT                   /db_xref="GOA:Q16CM6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM6"
FT                   /protein_id="ABG30267.1"
FT                   /translation="MRLYHSPASPFVRKVTVLLHELGQTDAVTLKTVTTTALASDEALK
FT                   TANPLARLPALERDDGITLYDSRVITAYLNDLFNGGFYPQNSSRWETLTLEATGDGMMD
FT                   SGVAMVYETRLRDAEQVSQAWIDAQWAKIERTLFALNTRWISHLSGPLTMGQISVACAL
FT                   SYLDFRHDTRNWRQGNEALAKWHAGFDSRPSMRATHP"
FT   gene            546052..546612
FT                   /gene="petA"
FT                   /locus_tag="RD1_0563"
FT   CDS_pept        546052..546612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="RD1_0563"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30268"
FT                   /db_xref="GOA:Q16CM5"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM5"
FT                   /protein_id="ABG30268.1"
FT                   /translation="MSHAEDHEGTRRDFLYYATAGAGAVTAGAAIWPLVNQMNPTADVL
FT                   ALSSIRVDVSGLEPGTQLTVKWLGKPVFVRRRTQEEIDAARAVDLADLPDQLAENANIA
FT                   PDADASDENRSLDESGEWLVMMGVCTHFGCVPLGDAGDYGGWFCPCHGSHYDTSGRIRK
FT                   GPAPTNLPVPTAVFVDDTTIQLG"
FT   gene            546625..547968
FT                   /gene="petB"
FT                   /locus_tag="RD1_0564"
FT   CDS_pept        546625..547968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="RD1_0564"
FT                   /product="cytochrome b"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30269"
FT                   /db_xref="GOA:Q16CM4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM4"
FT                   /protein_id="ABG30269.1"
FT                   /translation="MGGIPHDHYEPKAAWEKSLAKRLPIVGLMYDTLMIPTPKNLNWMW
FT                   IWGIVLTFVLVLQIVTGIVLAMHYTPHIDHAFASVEHIMRNVNGGYMLRYMHQNGASLF
FT                   FVAVYAHILRGLYYGSYKAPREITWIIGMLIYVLMMGTAFMGYVLPWGQMSFWGATVIT
FT                   GLFGAVPFVGEALQTWLLGGPAVDNATLNRFFSLHYLLPFVILGLVIVHIWAFHTTGNN
FT                   NPTGVEVRRTSKEEAEKDTLPFWPYFVIKDLFALAVILAVFFAVVGFMPNYLGHPDNYI
FT                   EANALSTPAHIVPEWYFLPFYAILRAFDDTVWAVQLVSFLTGGIVDAKFFGVLAMFGAI
FT                   VVMALAPWLDTSSVRSARYRPMLKWWFWVFVVNFFVLMWVGAMPAEGIYPVIALIGSAY
FT                   WFAYFLIILPLLGVIEKPLARPETIEADVAAQKAAANGGSQPLATPAE"
FT   gene            547983..548771
FT                   /gene="petC"
FT                   /locus_tag="RD1_0565"
FT   CDS_pept        547983..548771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="RD1_0565"
FT                   /product="cytochrome c1"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30270"
FT                   /db_xref="GOA:Q16CM3"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM3"
FT                   /protein_id="ABG30270.1"
FT                   /translation="MFRRLILSAVATFGFATASMAAGAYDTHIEDFDFSFEGPFGTYDQ
FT                   NQLQRGLQVYTEVCAACHGLKFVAIRSLSEEGGPAMPEDQVRAYAENFEVYDEEIEDFR
FT                   PAKPSDHFPESGLENAPDLSLMAKARAGFHGPYGLGINQFFKGIGGPEYIASLMTGYTG
FT                   EEKEEAGIILYENTAFPGGWISMAPPLDDELVEYADGHPNDLHNLSADVSAFLMWTAEP
FT                   KMMARKQAGFVGVLFLTILSVLLYLTNKRIWAPVKGNKSA"
FT   gene            549751..550899
FT                   /locus_tag="RD1_0566"
FT   CDS_pept        549751..550899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0566"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30271"
FT                   /db_xref="GOA:Q16CM2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM2"
FT                   /protein_id="ABG30271.1"
FT                   /translation="MLVANTILGTAFPIQLILGGLAGLVLAPSPTLATLPASIQTLAGM
FT                   VAAAPISLLMGRMGRRAGFALGGLMTLMGATTATQALYADNFVLLCVAHFLMGAGWASF
FT                   QYFRFAAGEVVEKKWRPVAISLMLSSLLIAAIGGPQLFIAAKDILAPVPFAGAYVATGL
FT                   IAVLGLVPLLAVQMPQPKGSSQDTPARKFAPRAALRRPAIMHAVGIAAVSQGVMVFLMI
FT                   PTPIAMVGCGFSEDTAGDVVRWHIVAMFAPSFFTGFLIKRFGASTVAITGLIIIVAAAV
FT                   AATLGLSAMHFYGALIVLGVGWNFGFIGATAMLDAAVSENKKATVQGANDTIIALVSTI
FT                   CAFAAGFVVSSLGWVFLAMISGGVVVLALGVLFADRARVSHT"
FT   gene            complement(551138..552769)
FT                   /locus_tag="RD1_0567"
FT   CDS_pept        complement(551138..552769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30272"
FT                   /db_xref="GOA:Q16CM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM1"
FT                   /protein_id="ABG30272.1"
FT                   /translation="MLIILGHWIPYVIMGDGAYLTIHDYLDSSLLKAKVLADSGQVFAP
FT                   SSSIIAQYDIPRGALRSEFQMPTLLNMFLSPLATHIVLTLFMQAAAFLGMYLLLMRRIL
FT                   GREARVLCVGVALCYALLPFWTPGVLGVAGLPLVLYAFLGLREGERGWHLWAILLLFPF
FT                   FSSLVTVGFFFLCMVAGLFVYDMLVRRRFNVAFLFGMAAMSAVYLAVEYRLVLNSINPV
FT                   FTSHRQEASPVFVPLTAALDRAWDNFLNGQYHAHSLQSEVILPTILLALLLSLWKRQFR
FT                   DRHLWLLIATVSFCAAISLFYGLWSSVVLEPIRTSVPLLLKFNFSRFHWLHPLLWFVAF
FT                   ALALALIQRQIPYRRLGLACVCLAIALQAHWAGYKNHPILEAREKHGISYAAFFATPLF
FT                   SEIKRDIGQPVEDYRVVSLGIHPAIAAYNGFHTADWYLTYYPLEKKRAMRGVIAKELEK
FT                   SAGLKRYFDDWGNRLYLFSAELDRDFLARRRTDAIQMPEYDLDRLRALGVTYIFSRVEL
FT                   YDAPPLFGEYRHPGSHWDINVYKLTD"
FT   gene            553097..554263
FT                   /locus_tag="RD1_0568"
FT   CDS_pept        553097..554263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0568"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30273"
FT                   /db_xref="GOA:Q16CM0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CM0"
FT                   /protein_id="ABG30273.1"
FT                   /translation="MEWRIPFNKPALVGTESGEVQQVFAQGKFAGGGTFNKACNRWLRD
FT                   HLDASGVLITTSCTHALEMAALLCDLQPQDEVILPSYAFTSTATAFARCGAKLVFVDCE
FT                   AATMNLDANAVAAAITPRSKVIVALHYAGVSCDMRALRALADEHGLKIVEDAAQALFAS
FT                   YDGKPCGTLGDYGCFSFHETKNMHCGEGGALVLNRPEDVQKAEVLLEKGTNRMQFFRGE
FT                   TSRYEWVGMGSSYVPSELNAAFLLAQLKAGAQITQARLASWQSYERLLRPLEEAGHVAL
FT                   PNPPRDCQHNAHIFWIKLAGKPERDAMIAHLKAQGIAAVFHYIPLHSAPAGRVYGTFHG
FT                   EDINTTRESERLLRLPLYYAITQEEIAEVVHAVTAFFALTGETHSAVG"
FT   gene            554268..555290
FT                   /locus_tag="RD1_0569"
FT   CDS_pept        554268..555290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0569"
FT                   /product="sulfotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30274"
FT                   /db_xref="GOA:Q16CL9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL9"
FT                   /protein_id="ABG30274.1"
FT                   /translation="MSAPVFQPVFLLCSERSGSNLFIRLLDSHPVFCGPPPSHLIRTLA
FT                   LNLTRLGDVAQDEKAWQRLLDISARVMQHQLGIWQCSLDATALARRVTERSVRGVISAI
FT                   YTAEAHAQNKTRSVIKENRIHIFLPFLMQAFPDARYVWVVRDPRDMALSWKRSSNHPGD
FT                   VRRGTQIWLQDQERFRQIFGYLAPAGQIMRLRYEDILQEPVPTLTALCDFLQVTYDPAM
FT                   LNFHDKEDTKANAARIANWENLAKPLIGGNTGKFHEALTREEIAYIETACATEMHAHDY
FT                   TLTEEPGERKAAEQAMELRYGQEDLALQWRALTPEEQAIREGRQNVIDYINALPIRLAT
FT                   "
FT   gene            555377..556240
FT                   /locus_tag="RD1_0570"
FT   CDS_pept        555377..556240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30275"
FT                   /db_xref="GOA:Q16CL8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL8"
FT                   /protein_id="ABG30275.1"
FT                   /translation="MLGQMHWGYGFIGFAAFAATSALDMWRLRMASPSAAQVRWFAFAR
FT                   MHIESYAMAPLLPGHIGVDAYRVATIGRGTGQGYVEPAVILFGLRVFSLLTMLGLTFGL
FT                   FLGLPEWREVYKPLVLAVISFPVWGVVLTTVAALLSVVLAWLLWRRAGPRLLNRFAGVR
FT                   QAWAALTWPRLMRLLAMSIAMIILRIFTFLLTLQAFGIELDVWLGTSVALCAALAWLLP
FT                   LSPAGIGVREGVIVGLLVWLGIDYVPALAVALLNRVYFLLFAGIGGVSFLLPKTNATLA
FT                   TQENHS"
FT   gene            556309..557007
FT                   /locus_tag="RD1_0571"
FT   CDS_pept        556309..557007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30276"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL7"
FT                   /protein_id="ABG30276.1"
FT                   /translation="MPKSVAILQSNYIPWKGYFDLIRKVDLFIFYDDLQYTKNDWRNRN
FT                   KIKTPMGARWLTIPCGSSWNRLINEVRVDNASWQKKHFDTLKQHYAAAPYWKTYAPFLE
FT                   EVYLGENWEYLSDLNQTVIKRISQAFLGITTEFDNSERYHLTASKGERVLQLLERVGAT
FT                   HYVSGPAAKSYLVEDEFVTRGITLEFMDYAGYPKYPQLYPPFEPAVTILDMLLNLGPAT
FT                   LEYMQPADKR"
FT   gene            557015..558109
FT                   /locus_tag="RD1_0572"
FT   CDS_pept        557015..558109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30277"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL6"
FT                   /protein_id="ABG30277.1"
FT                   /translation="MTPFFITGFLRSGTTLLEKYLHNHPQMVVASQPFPFLFKALKETF
FT                   FRSLGMDVPRYPLGHLCGDAGYGRQAFLDFASTHHFTDAEVKAIFEQMRGYSGQLTPGV
FT                   FDLPLKGGTLQQVFVQCATQFPALFDAPAAEHVGVKEVFCEEFIPLFLQHRMPVLLILR
FT                   DPRAVVASIHCGRGGEYANAGLSVLHILRCWRKSVAYAMRFSGEQGFHWMTYERLAQDP
FT                   AACLQPIARAFGADPFPDAVLSGALLSQDASPWRGNSSFGAPDARNPRFRKLLDADTIT
FT                   FIDTLCQAEMQWLGMEHDAHSAKTVLESYQDLFQPGAPFLSQEDKQTEYHRLAALAAQV
FT                   IDPAEAENWCIYPSVQRRLHAVLH"
FT   gene            558164..559039
FT                   /locus_tag="RD1_0573"
FT   CDS_pept        558164..559039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30278"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL5"
FT                   /protein_id="ABG30278.1"
FT                   /translation="MKHTAMAAEPATSSALLEELRRADFPKKDISIAEAQFGFRYVAEY
FT                   LGELPENGKVLEVGCGSGILMGLLKEQYPTLNVEGVEPLGDGFAVLGSINRYIRNQGIE
FT                   IQKIGYEQIETQNRYDVIYCINVFEHLNDWRDFLHFVENHLTPTGVCLILCPNYGFPYE
FT                   SHFKIPVIVNKPITASVFRKTIDRHEERKESHGLWRSLNFVKLRQVRQALARTSLRLTV
FT                   RHRIIEDMIARTGNDAEFRKRQKVIGTLGRVAYKAGITKLFRYPLFQNVMPYMQLELRP
FT                   DTTRQTTSGT"
FT   gene            559039..559965
FT                   /locus_tag="RD1_0575"
FT   CDS_pept        559039..559965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0575"
FT                   /product="glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30279"
FT                   /db_xref="GOA:Q16CL4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL4"
FT                   /protein_id="ABG30279.1"
FT                   /translation="MQNPVYSTVIPVYNSTRTLGELVSRLDQVFTEIGAAHEVVFVDDG
FT                   SPNPETWPILKALAEEHEHVHATRLMRNFGKAGAVLCGLRQAKGEWVITIDDDLQHAPE
FT                   DIPILLEKKSHDVVIGAFASRKKHSVFQRVTSRIKSYVDTRVLGVPPGVRMSPFKLFHA
FT                   RVVQHMIAVDTTRPFIPALMLQSTQDIVQVEITHHPRLYGRSAFGLRRRIRQFSNLIFG
FT                   NASLVLRFLAVLGVTISCLSLLYGGWLVLSYFWKEQTVAGWTSLMVVTLTLGGLIMFSL
FT                   GVIGEYLIRIIERVENRAAYLEREKLR"
FT   gene            560565..560699
FT                   /locus_tag="RD1_0576"
FT   CDS_pept        560565..560699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30280"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL3"
FT                   /protein_id="ABG30280.1"
FT                   /translation="MRLRAKHLFLLRTMVELTPNRLASFVTAHSPFKAAIATLALSHG"
FT   gene            complement(560806..561909)
FT                   /gene="flgI"
FT                   /locus_tag="RD1_0577"
FT   CDS_pept        complement(560806..561909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="RD1_0577"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30281"
FT                   /db_xref="GOA:Q16CL2"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL2"
FT                   /protein_id="ABG30281.1"
FT                   /translation="MKRLILFIALAFSMVSTAYAGPVRIKDLVEFDGVRGNDLVGYGLV
FT                   VGLNGTGDGLRNAPFTEEIMSNILERLGVNVSGEQFRPNNVAAVFVTATLPPFARGGSQ
FT                   IDVTVSAIGDANSLLGGTLIMTPMNAADGQIYAVAQGTIIAGGAAVEGDGANVTRGVPT
FT                   SGVIPSGARVEREIEFDLSSLNELRLALRDADFTTAARIEAAINNDFGRPVAVMLDSGT
FT                   VRLNVDATEMASVAHALGRIENIPVEPERKARVVVDQRSGTIVMGEDVRISRVAVSQGN
FT                   LTLRIQEAPIAIQPNPFAEGETVVVPRTRAELEEEPGIGLAEVPDGTSLSEVIAGLNAL
FT                   GVSPRDMIDILKSIKAAGALHAEFIVR"
FT   gene            complement(561906..562910)
FT                   /gene="flgL"
FT                   /locus_tag="RD1_0578"
FT   CDS_pept        complement(561906..562910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="RD1_0578"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30282"
FT                   /db_xref="GOA:Q16CL1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL1"
FT                   /protein_id="ABG30282.1"
FT                   /translation="MSSVSLGDLSQAFMMQRRSVALRQDMTRLTDELSSGQVSDIKEVL
FT                   AGNHNYLSGLERSLETLQGFSVANSEAKYFTDAMQSSLDRVQDFSGQLGLDLLLASGGP
FT                   VGVIAGSPSENAKTQLQGILNSLNADIAGKSLFAGAATDRVPLENAETLLTELSIAIAG
FT                   QTTPDDIMTAAENWFADPAGFDTLIYTGSGTALAPFSLSETERVSLDVRANDQALKDVL
FT                   MNVAVAALTDDPALGLTVPQQAELFGTVGLGLKSNQDQLTDLRSRIGFTEARIEMIDAR
FT                   NQAEQTSTEVARNALLLADPFETATQLENVQFQLQALYSVTVRSSQLSLVNFL"
FT   gene            complement(562914..564359)
FT                   /gene="flgK"
FT                   /locus_tag="RD1_0580"
FT   CDS_pept        complement(562914..564359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="RD1_0580"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30283"
FT                   /db_xref="GOA:Q16CL0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CL0"
FT                   /protein_id="ABG30283.1"
FT                   /translation="MSISGALSNAMTGLRAAGRTSEVISANLANAMTPGYGVRNLSLSS
FT                   SQLGGVAIDGVMRNVDPSLLADLRLADASFGNANNRTKFLNDFENLLGTPEEANSLAGR
FT                   MAEFERTLITAASRPDAPERLNSVVDAARDIATLISKASDGVQQARSDADRAIQVQIDR
FT                   LNTSLQSVKELNSQITRTISTGSDASALFDNRQAIVDEINAIVPVRLVPRDNGQIALYS
FT                   TGGAILIDGGVAEIEFNAVNQVTPFMTLGGGTLSGLSVNGYPVRTDSARGALGGGTLGA
FT                   HFEIRDELGTSAQTQLDAFARDLIERFQDPAVDASLAVGDPGIFTDAGLAFDPVNEIGL
FT                   SARLSVNAAVDERQGGESWRIRDGVNALTPGDVGDARLIQALSDTLSAKRAPASGDFGA
FT                   GAFSAMNLISTFTSQVGADRSRAEQTLSFASSQFDELTQQVLANGVDSDQELQRLLIVE
FT                   QAYAANARMIEAADEMMQTILRI"
FT   gene            complement(564404..565714)
FT                   /gene="flgE"
FT                   /locus_tag="RD1_0581"
FT   CDS_pept        complement(564404..565714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="RD1_0581"
FT                   /product="flagellar hook protein FlgE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30284"
FT                   /db_xref="GOA:Q16CK9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK9"
FT                   /protein_id="ABG30284.1"
FT                   /translation="MSISSSLNAGVAGLQTNSQRLASISDNIANSSTFGYKRVQTDFES
FT                   MVLSSGGGAYAAGGVRANTQRLIDERGTLVSTSNSTDLAVRGGGMLPVAQAAQVQTAGT
FT                   DAPMFLTTTGSFRPDADGYLTSQSGLVLMGWPAAADGSIPVYPRDTADGLEPIRIATGQ
FT                   LAGNPTTSMSLGINLPATETEADSAGLVEQISVEYFDNLGTSQSVSITFTPDVPAPGNP
FT                   ATNTWTMEMFDSVNPAVSIGSYTLEFNDSRTGGGTLFDVTPIGASPAYSDTTGLITINV
FT                   AAGPIEVDIGALGDTEGLSQLSYSFAPISVTKDGSAIGNFVGVDVDPNGFVRASFDTGE
FT                   IRTIYQIPLINVPNPNGLQAFDSQTYLPSRQSGAFFLWNAGDGPTGDIVSFAREESTTD
FT                   VAGELTDMIKTQRAYSSNAKVIQTVDEMLQETTNIKR"
FT   gene            complement(565815..566654)
FT                   /gene="motB"
FT                   /locus_tag="RD1_0583"
FT   CDS_pept        complement(565815..566654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="RD1_0583"
FT                   /product="chemotaxis protein MotB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30285"
FT                   /db_xref="GOA:Q16CK8"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK8"
FT                   /protein_id="ABG30285.1"
FT                   /translation="MAAQSNLAPVIIKKKKKVVGGGHHGGAWKVAYADFVTAMMAFFMM
FT                   MWLLNATTEQQRQGLADYFAPTIPINRISGGGDGAFGGDSIFSEETLPQNGLGATSQHA
FT                   TRKQAASGESGNDDDGGERDTSDEELQALVEELMGRGGESTVMENALEHIVTRITDEGL
FT                   VIELFALDGLPLFEPNSDVPTPLMTQLVELVASVAFAATNDIAIGAHVPSRPIVVAQNP
FT                   VWDASTDRATRTRLMLQENGLEPERMQRVTGHADREPAHLNPMATRNSRVEIVLLRE"
FT   gene            complement(566835..567725)
FT                   /locus_tag="RD1_0584"
FT   CDS_pept        complement(566835..567725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30286"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CK7"
FT                   /protein_id="ABG30286.1"
FT                   /translation="MFIIAALYHFTRFENPAALKPALLELCKAQGVTGTLLLAPEGVNG
FT                   TITGSRAGIDAVLAHLKALPGCDGLEWKEAQSERANFGKMKVRIKREIVTMKQPDVDPR
FT                   AKTGHYVTPADWNALIAQPDVAVIDTRNDYEVEIGTFEGAIDPKTRSFGEFPAWWEANK
FT                   HRFHNKKIAMFCTGGIRCEKSTNYLLGQGVEDVFHLKGGILQYLEDIPQDQSTWNGACF
FT                   VFDNRVSVGHGLQEGPHLLCHGCRQPILPADKKRAEYEEGVSCHKCFDQTTSEDKARFR
FT                   ERQKQIELARKRARA"
FT   gene            567843..568451
FT                   /gene="pncA"
FT                   /locus_tag="RD1_0585"
FT   CDS_pept        567843..568451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="RD1_0585"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30287"
FT                   /db_xref="GOA:Q16CK6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK6"
FT                   /protein_id="ABG30287.1"
FT                   /translation="MSHALIVIDVQLDFCPGGALAVPDGDGIIAGINALMPQADAVVLT
FT                   QDWHPAGHSSFATSHKGHAPYDVIDMDYGPQVLWPHHCVQGADGARFHPDLQSDGADLI
FT                   LRKGYNPAIDSYSAFFENDHKTPTGLEGYLRSRGIEKLTLVGLAFDFCVNYSALDAAKL
FT                   EFDVTVREDLCRAIDLDGSRDAARQAMQNAGVRLETVHG"
FT   gene            568444..569736
FT                   /gene="pncB"
FT                   /locus_tag="RD1_0586"
FT   CDS_pept        568444..569736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="RD1_0586"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30288"
FT                   /db_xref="GOA:Q16CK5"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK5"
FT                   /protein_id="ABG30288.1"
FT                   /translation="MVDIATRVWNHKWKIDPIVRSLIDTDFYKLLMCQSVFRNKPDTRV
FT                   TFSLINRSTHIPLAELIDEGELREQLDHIRSLSLSRGESTWLRGNTFYGKRQMFRSDFM
FT                   EWFEQLRLPAYHLERIGDQFELTFEGSWPEVMLWEIPALAVLMELRGRAVLDQMDRFEL
FT                   QVLYARAMTRVWEKVEALRDIPDLSIADFGTRRRHSFLWQDWCVQAMREGLGAAFTGTS
FT                   NCKIAMTREMEAIGTNAHELPMVYAALARDDAALAQAPYDVLSDWHDEHEGNLRIILPD
FT                   TFGTSRFLEKAPDWLAGWTGIRIDSGDPVQAGENAIDWWRSRGEDPSKKRVIFSDGLDV
FT                   DKIRSLHRTFSGRVQPSFGWGTLLTNDFRNLVPHDSLAPFSLVCKAVKANGRPTVKLSD
FT                   NPNKAMGPAAEIERYKRVFDVGVQRAQDVVV"
FT   gene            569800..569898
FT                   /locus_tag="RD1_0587"
FT   CDS_pept        569800..569898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30289"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK4"
FT                   /protein_id="ABG30289.1"
FT                   /translation="MVHLIWHAHNTVSIRHSGEMSNNDFDMCMNVT"
FT   gene            569981..570145
FT                   /locus_tag="RD1_0589"
FT   CDS_pept        569981..570145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30290"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK3"
FT                   /protein_id="ABG30290.1"
FT                   /translation="MILSDVGYPVSLSNALKQHPCTSASIGSAATVPAFGRSTYKACAA
FT                   CATRILQFE"
FT   gene            570328..570432
FT                   /locus_tag="RD1_0590"
FT   CDS_pept        570328..570432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK2"
FT                   /protein_id="ABG30291.1"
FT                   /translation="MHSSCCQTRWVETITIRFLSAFQIVMVAVDIVEG"
FT   gene            570864..571034
FT                   /locus_tag="RD1_0591"
FT   CDS_pept        570864..571034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30292"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK1"
FT                   /protein_id="ABG30292.1"
FT                   /translation="MASETDEQLPLVFINDVQRPERFFLVRPSLHEVLRPNMIMTFRWQ
FT                   MIAWTIIEPVR"
FT   gene            complement(571339..572700)
FT                   /locus_tag="RD1_0592"
FT   CDS_pept        complement(571339..572700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0592"
FT                   /product="putative HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30293"
FT                   /db_xref="GOA:Q16CK0"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CK0"
FT                   /protein_id="ABG30293.1"
FT                   /translation="MSNRFFRKKRKDKQGNAPQSGNVQSANITASPHLSEVHDGGYARS
FT                   VIWTVVLALAAFFYWSSVTPVYEVVTGEGTIKPEGLSTRIEHLEGGIVNEIAVQDGDIV
FT                   QPGQLILQLDTQIVQSELAKIETLLTQVQESIERYETISAISFGTLDDTELRQMTSVSI
FT                   ISDINYRLAQIQTIRSQKSVASTEQQAIHANIESLRQELAIQQAQLDRYQRAGFNGSVS
FT                   LNRREELQRENLRLESSIAQLSGEVRILDARIEQLGSSEREMIAQFRRDAALQLDEKRT
FT                   ELAGLLETRAALDFQIQRSRIVSPVAGMVNAISVQNLGEVVQPGEVIVEIIPSTGETFA
FT                   EIEIAADRIGGVTTGSTASVKVLTYDFTRYGSLDAVVEHISPSSFTKENGQTVFRVRLG
FT                   FRSLTIASVGQMPDGRRVTPGMTVVADIKSEGRTILSFLLKPLRVISDRALTEA"
FT   gene            complement(572702..574939)
FT                   /locus_tag="RD1_0593"
FT   CDS_pept        complement(572702..574939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0593"
FT                   /product="putative cyclosin secreting ABC transporter, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30294"
FT                   /db_xref="GOA:Q16CJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ9"
FT                   /protein_id="ABG30294.1"
FT                   /translation="MTSASPLNATQDRQGSAFDAVSDRAGIASATSDWENDSNYDALSA
FT                   GLRSGRFGGLPSHTNAGEAVVEVLRQCNWPVDFRAFAAAVPHFSPELNLNAARGILRNL
FT                   GFETAEDNLRGRNLQHLPSGSFVVSTSEDILFIGANDNGRLVLRDPVTGQEQPIRQRRL
FT                   YRCFRVSQAHSKSGTTPVSGSWISNTFHRFAPENRTILFIIFLSNTLIVIASLSVGFIF
FT                   DKVLPAKAFDTLVALLAGICILLYVDLRLRRIKSRIIAQVSGRIEFIVSSTLFERLMAF
FT                   PLEMVTGSSASDQMNRLKHFETVRDFYAGPFVAVIFELPFVAILLAAMFFLDPVIGTIL
FT                   LGFVVLYALIGAIFYPKISRGSKELSQLHNECMRLQEETLSQRQQIIARGLGAVWSARV
FT                   TPRFTALSQARHRLDAIWRVLNSLITVATPLATGCVIFTGALRVISADLTAGVLIACTI
FT                   ISARLLSPVQQALLLAVRAPDLLNLFKQIDVMMRIKGRNQLDRSQFSIGLDQGDTAPDI
FT                   HIDSLVLRYPQSVTAALKGISVRFDGGSLTCITGEAGSGKSSLLRAITGQYSAQNGTVM
FT                   IGQSNVNQFDTRTRASLISYLGHQSLQIHGTLAQNLRLTKPDATDAELRAVTEELSLLQ
FT                   SIESLSDGFDTKFSHADRHQFSPAFRTKFAVAQILLNAPRILLLDEPEAGLSDEDETAI
FT                   MNAIKRRAGHVTCLLVTHRPSIMRQADKVLLLNAGQIDFFGGPEKLQSRNG"
FT   gene            complement(574936..576594)
FT                   /locus_tag="RD1_0594"
FT   CDS_pept        complement(574936..576594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0594"
FT                   /product="ABC transporter, ATP-binding permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30295"
FT                   /db_xref="GOA:Q16CJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ8"
FT                   /protein_id="ABG30295.1"
FT                   /translation="MERGLDLRRLRRNPHVVVASLCANVLGLALPLAMIHVYDRIIPRE
FT                   GYATLAVLAAGLATAALADFMIRMARGRLMAAASNRFETEAYHRAFRNLLATGTRLRDA
FT                   SPGVLHDHVESIERVRKHHASEAASAMLDLPFIVLFIAVMALISPVLGISVCILALLSM
FT                   GIVWFQRRKILELNTFRQSRDQQRHSFLMEAIDGVEMIKSLGIEDLMQRRYERLMSVNA
FT                   AITHDLSRRVTLTQGITSAIGLMAPVLMAGVGSFLVIDGQMSVGGVAASVLLTGRVIQP
FT                   MLRIEALLAGEADVKRSEKQAHELLQADTAASGTRKIDRIDSIVFSNVTIARHPDKKPL
FT                   FENISLQLQRGDCVLLTGADGCGRSTLLSVMAGRARPTSGTVRINGLASDDIDQEILCD
FT                   RISTLSPDYTMLDGTLLENLTAFDVPRHQKQAFKLAEELGISSFISHHSDGLSLQVAAR
FT                   NANSLPKAIHDGIVLISGLVRCPDVILFDEANVGLDRNIDQNMLQALRRRIPEAIIVIV
FT                   THRPSYMALANRVLQIRDGRLIEGEVIPSERTMAG"
FT   gene            complement(576660..579725)
FT                   /locus_tag="RD1_0595"
FT   CDS_pept        complement(576660..579725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0595"
FT                   /product="type I secretion target domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30296"
FT                   /db_xref="GOA:Q16CJ7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ7"
FT                   /protein_id="ABG30296.1"
FT                   /translation="MGSIFSAFRSKFGRKNEAAENAGPSNSDQVQLDALQGSEASGNAT
FT                   AVGGASVTLAALSGFMRPQQADAQAPVAEVSAPPATGTTATAMPQQPDLDRSSGPNMPL
FT                   QGPAIDTGEGSTASARTGSMPAALELEQVRQSAPRSDITADKIADAPAPVRASGPNIWT
FT                   EANAGETAMPTTQAAASMQEAPTSSSDDNAGPEARIAQVDNSPLLSTAGGTVDENTSGA
FT                   VVGSAIGAAADPGDTLTYQVDDARFEVVGNHVKLKDGIDLDYETDGGVIDVAVTATDGA
FT                   GNATTQTIEVTVTDVAETIQLADGGTTFTDTGVAEEAILGGSGDDVITANAEGPEAKEG
FT                   PDAVLLMTFSDTGGTAEDSSGNSRDGFYRGDATPGTTGWDGTGTAVTLGGHGDYVEVPP
FT                   DNAYALDEGTVSIRFNADNLNGQQSIFSRDSNSYDGGGHLSAWVMSNGSLEVRLQSDSG
FT                   NTFLRSDPGTIEAGDWSHVAVSFGPEGAALFLDGVQVDTDSYTGGLAGNNEPWTLGASQ
FT                   NRSGDGVATNLRDYFEGSIDEFVLFDSQLDAAEIATLEAEGATGSERYRISGGAGDDHL
FT                   IGGAGDERLYGDAGNDTIEGGAGDDRLFGGDEVGADAVVLMHFEDVGNISADSSGNARD
FT                   GMYRGGATPGATGWDGNGTAVTLDGKNGYVEIPSDNTTGQSGRSSGSTTSWGTTSSGSL
FT                   SNRATRSDSTGTADPQDNAYALDAGTVSIRFNADNLDDKQTLFSRDSTHFDGGGHLTAW
FT                   LNTDGSIEVRLQSDSSNTFLRSDSGAVAADDWSHVAFSFGPEGAALFVDGSRVDTDSYT
FT                   GGITGNNEPWTLGASQWKSSDGAADNLQHFFDGAIDEFAVFDYQLDASEVATIEREGIT
FT                   MGGHDSLFGGDGNDLLQGGGGNDVLSGGAGNDTIYGDGGNDVLSGGLGDDVLYGGAGEN
FT                   TFLVAASEGSDTVVGGASGWTQTIELQDTTGGANVAGNTVTGNGWTMVLETGSSVEGQS
FT                   ADALALSEDAAGVITFDAGGIVEFTEIDKITW"
FT   gene            complement(579855..580376)
FT                   /gene="msrA"
FT                   /locus_tag="RD1_0596"
FT   CDS_pept        complement(579855..580376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="RD1_0596"
FT                   /product="peptide methionine sulfoxide reductase, putative"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30297"
FT                   /db_xref="GOA:Q16CJ6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ6"
FT                   /protein_id="ABG30297.1"
FT                   /translation="MTQERAVLAGGCFWGMEDLIRKREGVISTRVGYTGGDVAHATYRN
FT                   HGTHAEGIEVIFDPAVLSYRDLLELFFQIHDPTTLNRQGNDIGLSYRSAIYYVDETQHQ
FT                   VALDTIADVNASGLWPGKVVTEVAPVGDFWEAEPEHQNYLERYPNGYTCHFPRADWVLP
FT                   KRDSKTQAAE"
FT   gene            complement(580373..580822)
FT                   /gene="msrB"
FT                   /locus_tag="RD1_0597"
FT   CDS_pept        complement(580373..580822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="RD1_0597"
FT                   /product="peptide methionine sulfoxide reductase, putative"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30298"
FT                   /db_xref="GOA:Q16CJ5"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ5"
FT                   /protein_id="ABG30298.1"
FT                   /translation="MANYARTQEAIDRLSPEEYRVTQQDGTERPGTGALLENKEPGIYV
FT                   DIVSGEPLFASADKYESGCGWPSFTKPIEPANINELKDVSLGMVRTEVRSLHGDSHLGH
FT                   VFPDGPPDRGGLRYCINSASLRFVHRDDMEAEGYGDYINQVEDVT"
FT   gene            580959..581507
FT                   /gene="gpo"
FT                   /locus_tag="RD1_0599"
FT   CDS_pept        580959..581507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpo"
FT                   /locus_tag="RD1_0599"
FT                   /product="glutathione peroxidase, putative"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30299"
FT                   /db_xref="GOA:Q16CJ4"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ4"
FT                   /protein_id="ABG30299.1"
FT                   /translation="MKALKSTVAALVTAAFVAGPVCAGARDHQFASIDGGFVDMADWAG
FT                   QPVLVVNTASQCGFTGQYAGLQELYDTYRAAGLVVFAVPSDDFNQELGSAEEVKEFCEM
FT                   NFGLDLPMADITRIRGKNAHPFYQDVRAETGFVPRWNFNKVLIGPDGEIVDTWGSQTKP
FT                   MSREITDAVETLLDQASQG"
FT   gene            581511..582152
FT                   /locus_tag="RD1_0600"
FT   CDS_pept        581511..582152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30300"
FT                   /db_xref="GOA:Q16CJ3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ3"
FT                   /protein_id="ABG30300.1"
FT                   /translation="MTQEKEDKRLDLQAAYSVRTPAENEALYAAWAKTYDESFAAASDY
FT                   IFPQQVARVFHEQGGHGPVLDAGAGTGLVAEAIAARKTCLMDAFDISEPMLSIAKAKGV
FT                   YRRLVQGDLTQKLPFDDGSYASVVSAGTFTHGHVGPEAMDELLRVSASGALLVLTIKAE
FT                   LYEARGFAATFSDLGMQIYDFQLQEVPIYGAGAQSSDTLDAGLIACFRKT"
FT   gene            complement(582199..583068)
FT                   /locus_tag="RD1_0601"
FT   CDS_pept        complement(582199..583068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0601"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30301"
FT                   /db_xref="GOA:Q16CJ2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ2"
FT                   /protein_id="ABG30301.1"
FT                   /translation="MDIRAILMGLAFSLMWSSAFTSARIIVADASPLAALTLRYLISGL
FT                   LGVAIARALGQSWHLTPAQWRATVVFGVLQNGVYLGLNFVAMQTVQASVAAIIASTMPL
FT                   LVAMALWIVLGERLRPLGIAGLAAGILGVGLIMGARITTGVDPFGLALCCIGVIALTIA
FT                   TLSVRGATSGGNFLMIVGLQMLVGCLVLALATAIFETPHVTPSWRLLAAFSYTTLIPGL
FT                   AATFVWFWLVNRIGATRAATFHFLNPFLGVATAALLLSEPLGGQDILGVVIITLGILAV
FT                   QVSRQQKA"
FT   gene            583203..583832
FT                   /locus_tag="RD1_0602"
FT   CDS_pept        583203..583832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0602"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30302"
FT                   /db_xref="GOA:Q16CJ1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ1"
FT                   /protein_id="ABG30302.1"
FT                   /translation="MLIPPDIMLIFAAASVALALAPGPDNIFVLTQSALYGRMAGVMVT
FT                   LGLMTGVMVHTTLVALGVAVIFQTSVLAFTVLKLVGAGYLVYLAIMAFRAHATPVDRTQ
FT                   APKTPLARLYWRGVVMNLTNPKVAIFFLAFLPQFADPLRGAVTAQIFLFGAIFVLCALV
FT                   VFCTIAGAAGFLGTWLSTSPRAQVALNRVAGVVFLGLALRLVLAER"
FT   gene            complement(583987..584274)
FT                   /gene="hup"
FT                   /locus_tag="RD1_0603"
FT   CDS_pept        complement(583987..584274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="RD1_0603"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30303"
FT                   /db_xref="GOA:Q16CJ0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CJ0"
FT                   /protein_id="ABG30303.1"
FT                   /translation="MAKPMTKTQLVAALAEEMDTDKKSAGAALDAVCNLITKEVSGGGA
FT                   VTLPGVGKIYCRERPERMVRNPATGEQFKKDADKVVKMTIAKALKDSVNG"
FT   gene            complement(584412..585875)
FT                   /gene="amn"
FT                   /locus_tag="RD1_0604"
FT   CDS_pept        complement(584412..585875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="RD1_0604"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30304"
FT                   /db_xref="GOA:Q16CI9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI9"
FT                   /protein_id="ABG30304.1"
FT                   /translation="MSAIITPDSPAAEVFHDAVAAVARLEELYTQATAFLCTHFAQAMR
FT                   DGAPDCRVRAFYPQVEFETSSYAHVDTRLSFGHVSAPGRYRATITRPDLFRSYLTQQIG
FT                   LLIENHGQPVTIGPSETAMPVHFAVAGDAAITVPQEGAAEFTLRDVFDVPDLSTTNDDI
FT                   VNGTYSPADGIAPLAPFTAQRVDYSLARLAHYTATDPEHFQNHVLFTNYQFYVSEFEAY
FT                   ARAQLKDATSGYTAFVSTDNAEITDGDAPLPPSSKTPQMPTYHLKRADGSGITLVNIGV
FT                   GPSNAKTATDHIAVLRPHAWIMVGHCAGLRNSQALGDFVLAHAYLREDKVLDDDLPVWV
FT                   PVPALAEIQIALEQAVAKVTELEGYELKRLMRTGTVASLDNRNWELRDQSGPVQRLSQS
FT                   RAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMASDFYKTQVVRHLMIG
FT                   IHAMEQLRSMPLERIHSRKLRSFEETAFL"
FT   gene            complement(585872..587674)
FT                   /gene="ade"
FT                   /locus_tag="RD1_0605"
FT   CDS_pept        complement(585872..587674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ade"
FT                   /locus_tag="RD1_0605"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30305"
FT                   /db_xref="GOA:Q16CI8"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CI8"
FT                   /protein_id="ABG30305.1"
FT                   /translation="MTHSPFPSWPDTAADLIAVATGRMAADMLIRGGKWVNVHTREVLD
FT                   GYDVAIIRGRIACVVPDATNCTGPDTHMIRANGRYMIPGLCDGHMHIESGMLTPAEFAR
FT                   AVIPHGTTSMFTDPHEIANVLGLEGVRMMHDEALMQPVNIFTQMPSCAPSAPGLETTGF
FT                   EITAADVADAMAWPGIVGLGEMMNFPGVSNADPKMLAEIAATQRAGKTVGGHYASPDLG
FT                   PAFAGYIAGGPADDHEGTCEADAIARMRQGMRSMIRLGSAWYDVESQITAITEKGLDPR
FT                   NMILCTDDCHSGTLVNDGHMNRVVRHAIECGCDPLVALQMATINTATHFGLEREIGSIT
FT                   PGRRADIILTSDLRTLPIETVIARGQVVAEDGHCLVECPHFDWPAAARQTVHMGKTLGP
FT                   DDFTINAPKGANAVTANVIGVVENQAPTKALKFELPVTEGRVQATGDVAQIALVERHRA
FT                   TGSVTNAFVSGFGYQGRMAMASTVAHDSHHMIVVGTDADDMARAANRLGEVGGGIVLFK
FT                   DGVELALVELPIAGLMSDRPAAEVAAKADKMMQAMRDCGCTLNNAYMQHSLLALVVIPE
FT                   LRISDLGLVDVRTFEFIPVIESPT"
FT   gene            587725..588144
FT                   /locus_tag="RD1_0606"
FT   CDS_pept        587725..588144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30306"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI7"
FT                   /protein_id="ABG30306.1"
FT                   /translation="MDYETVSAEDFGKSLRGIGLNLLVRDVRATSAFLEDVFDAGIHRL
FT                   SDDFAIVTFGKDVFQLHSDATYSANPLLGLLPENPPRGAGLEIRLYDTDPDAAVARAVA
FT                   RGAMILQDPSDKPHGLREAYILCDDGYAWVPSRPL"
FT   gene            588521..590956
FT                   /locus_tag="RD1_0607"
FT   CDS_pept        588521..590956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0607"
FT                   /product="dimethylglycine dehydrogenase, putative"
FT                   /EC_number="1.5.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30307"
FT                   /db_xref="GOA:Q16CI6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI6"
FT                   /protein_id="ABG30307.1"
FT                   /translation="MKSRTKVAVIGGGIAGCSTLYHLTEEGWSDVVLIERDELTSGTTW
FT                   HSAAQVTNFGMNQTMVGLKTHSIRLYKKLRDDPDYPVGYHHGDGGIRLANTPEQMQAYR
FT                   HFASMARGMGTDFEVIDARECARRHPLISTDNLLGGLWDGEDGDIDPAQLCQALAFHAR
FT                   KAGAEVYRHTNVTALTQHADDTWTVETDKGRIDADIVVNACGYRVNEVGSMMGVHHPVA
FT                   SMEHQYFVTEDIPAIVEAGHRMPLLRCPISDYYARQEKNGLLVGFYEQDCKTWGMDGIS
FT                   PSFANDLCPDDLDRVMDVLEGAFERMPALSEVGIKRVVNGPITYTIDGAPLVGPIPGKR
FT                   NAYCIIGLRAGVGEGGGHGWLLAQQIVHGEAEYDTWVLDPRRFTGHANVELTALKAIED
FT                   YQNEFRFHFPHEHRPAGRNAKTTPLTPVMAAEGAAFTVVNGWERVDYIKPAPDFHPSLS
FT                   FNFDETFDVIGDEVRNVQQNVGLCEVNGFNRFEITGTDRHSFLDRMFCGAVRRKDGRVG
FT                   LGYMLNHHGKIKAEATIANIPASDRGPARLWYGSAAASEYHDMDWLTRHVQPDEDVQIR
FT                   SLTNDQTVLVLAGPKARDVLSACSRGDWSKAAFPWLSVREAFVGFSPVTVLGVSFSGEL
FT                   AYEIHVPNASLYAVYLALREAGQAHCLTLFGARAVDSMRMEKGFLHWKAELLTEFDPFE
FT                   TGLDRFVKPEKRPFIGQQALQKRMANGPIRKLVTLKIDCTTAPAHGGASLMQDGAVVGT
FT                   ITSGAWGYRVGLNLAYAFVIPEMAEIGRAMQLDLCGELVSAEVIAPSPYDPEHARMQA"
FT   gene            complement(590923..591102)
FT                   /locus_tag="RD1_0608"
FT   CDS_pept        complement(590923..591102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30308"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI5"
FT                   /protein_id="ABG30308.1"
FT                   /translation="MSLKADHILGIIDQQKNDVDALFVRWKTLRVSVSPLRQGHARLEG
FT                   RGVVHACIRACSGS"
FT   gene            591117..591872
FT                   /locus_tag="RD1_0609"
FT   CDS_pept        591117..591872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0609"
FT                   /product="aldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30309"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI4"
FT                   /protein_id="ABG30309.1"
FT                   /translation="MSVTEIRPNMENWQERVDLAAAFRWTARLNMHEAVANHFSLAIND
FT                   DGTQFLMNPNQMHFSRIKASDLIVVDANDPDTLSGPDAPDPTAWGLHGGLHRHCPHARC
FT                   AMHVHSPYATALASLADSRLPPVDQNACMFFDRVVIDENYGGLAFEEEGVRCAQLFDDP
FT                   RKKVMVMGNHGIMVIGDTVADTFNRMFYFERACQTYLLALQTGRPLRVLPDDVAEKTAR
FT                   EIEDYPEQDLRHLAELKAILDEEGATYAQ"
FT   gene            591862..592851
FT                   /locus_tag="RD1_0610"
FT   CDS_pept        591862..592851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0610"
FT                   /product="putative sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30310"
FT                   /db_xref="GOA:Q16CI3"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI3"
FT                   /protein_id="ABG30310.1"
FT                   /translation="MPNDAETREAGRWNYRPPVPLAQNPLFQWPPKPAAIFRWYAAFWL
FT                   EVSTTTLCLVFALIAYFLVLPDLAEMQVLAWGWVSQVWLANLIPQVICAGTLHYWLIMR
FT                   KGQGDKTKYDPRDQARDNGTFTFGNQVHDNMFWHIASGITLWTAAQVLVFWGMANGYAP
FT                   AMLFPGNPLWFVAFFVLIPIWSSFHFYWIHRALHWPPLYKLAHSLHHRNVNVGPWSGIS
FT                   MHPVEHLLFYTNFLIHFVVPSHPLHVLFHGYVQSTHPVFSHSGFEEIVVNDKRRAKAGV
FT                   FFHQLHHRYFECNYGTVEMPWDRWFGSYHDGSAQATDDTRARKKQMYT"
FT   gene            592957..594120
FT                   /gene="acdA"
FT                   /locus_tag="RD1_0611"
FT   CDS_pept        592957..594120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /locus_tag="RD1_0611"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30311"
FT                   /db_xref="GOA:Q16CI2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI2"
FT                   /protein_id="ABG30311.1"
FT                   /translation="MTTYGLTEEHTMIAESVRSFVEKEIYPHEELVERTGEVPAEIADE
FT                   IKRKTIDLGFYACNFPESVGCAGLNHLEFALVERELGRGSMALTHFFGRPQNILMACEG
FT                   DQIERYLMPAVRGERMDALAMTEPGAGSDVRGMKCAAVRKGGDWVVNGTKHFISGADHA
FT                   DFIIVFIATGEDQTPKGPKKRITAFLVDRGTPGFTIRDGYKSVSHRGYKNMILDFDDCR
FT                   LSDAQVLGEVDGGFEVMNTWLYATRITVATMSVGRARRVFDYALNYAAEREQFGQKIGK
FT                   FQGVSFQLADMVTEIDAADLLTLAAADRLDKDLPANREIASAKLYASEMLARVTDAAVQ
FT                   IHGGMGLMDDYPLERFWRDARVERIWDGTSEIQRHIISRDLLRALGA"
FT   gene            594183..596213
FT                   /locus_tag="RD1_0612"
FT   CDS_pept        594183..596213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0612"
FT                   /product="acyl-CoA synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30312"
FT                   /db_xref="GOA:Q16CI1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI1"
FT                   /protein_id="ABG30312.1"
FT                   /translation="MLRPRSIAVVGGGYWCQQVVRQSRAMGFAGDIARVHPKADVVEGI
FT                   RAVAHVRDLSHVPDAVFLGINRHSTTEVVAELAAMGAGGAVCFASGFAEADAEDPASAD
FT                   LQADLVAAAGDMPILGPNCYGFVNAVDGALLWPDQQGCSRVDRGVAILTQSSNIAINLT
FT                   MQRRALPIAYTVTCGNMAQTSQAEIAMALLDDPRVTALGLHVEGFGDTHQWHALAIKAF
FT                   EKSVPIIVLKIGVSDQAQQATVSHTASLAGSDAGACAFLRYLGIARVQDLPTFLETLKL
FT                   LHCHGVLPGSRLASISCSGGEASLVADMAAEHAVSFPALNDAQRITLSDVLGPMVSLSN
FT                   PLDYHTHIWGDAHKMAAAWLPMAAPHIDLVMIILDYPHTDATAWDCATQAAIAVHQRSG
FT                   RPVAVVATLPELLPTDVATCLMAAGVTPLHGLREALGAVEAAAGCSAAQDAPPLRAGSS
FT                   GKTEMLSEAEAKQSLARFGIPVPRGLVVKRADLEGAATALDAPLVLKAMGLAHKSEAGA
FT                   LRLNVQAETLATAARDMPGDRFLVEEMVTGTVAELLIGVTRDAAHGFVLTLAAGGVLTE
FT                   LWGDQRSLLIPASRVDVADALAGLRAYPLLCGYRGAAPACLPAVIDAVMGLQDYVMDNA
FT                   DHVHEVEINPLMCTPDAAIAADALITRLIPQFPAGERHGPD"
FT   gene            596200..596979
FT                   /gene="caiD"
FT                   /locus_tag="RD1_0613"
FT   CDS_pept        596200..596979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="RD1_0613"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30313"
FT                   /db_xref="GOA:Q16CI0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CI0"
FT                   /protein_id="ABG30313.1"
FT                   /translation="MDPIKTRQQGMILEVTLDRPKANAIDLATSRVMGEVFASFRDDPD
FT                   LRVAILTGAGEKFFCPGWDLKAAAEGDAVDGDYGVGGFGGLQELRAMNKPVIAAVNGIA
FT                   CGGGLELALSADMILAADHASFALPEIRSGTIADAASIKLPKRIPYHIAMELLLTGRWF
FT                   DPQEAKGWGLVNEILPAADLLPRAWELAELLASGPPLVYAAIKEVVREAEDAKFQDIMN
FT                   RITKRQLETIDVLYSSEDQLEGATAFAEKRDPVWKGR"
FT   gene            597019..597864
FT                   /locus_tag="RD1_0614"
FT   CDS_pept        597019..597864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30314"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH9"
FT                   /protein_id="ABG30314.1"
FT                   /translation="MTQNTLLSLGHGFSARALATRLIPAGWRVIGTTRSADKAAEIAQT
FT                   GVEPLIWPGADAETVLQDATALLISAGPDKDGDPVLRQLHAQIASHAKQFQWVGYLSTT
FT                   GVYGDHGGDWVDEDTPLTPSTARGQARVEAEAAWQAIPGLPLHIFRLAGIYGPGRGPFS
FT                   KVRAGTARRIIKKGQVFSRTHVDDIAQVLEASIRQPRPGAIYNVCDDNPAPPQDVIGHA
FT                   AELLGLPLPPAVDFETADMTPMARSFYAESKKVRNDLIKRELGVVLKYPDYRSGLKAML
FT                   "
FT   gene            complement(597982..598626)
FT                   /locus_tag="RD1_0615"
FT   CDS_pept        complement(597982..598626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30315"
FT                   /db_xref="GOA:Q16CH8"
FT                   /db_xref="InterPro:IPR022472"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH8"
FT                   /protein_id="ABG30315.1"
FT                   /translation="MNVKTLMATTAAILTLSISAANAASFSFTGTNQTQVIAKNDLGLG
FT                   LNGQTIDFISGDKKSTSNGLSITGGPAKVTFTYLGFEAGNTNFSANVGGTLFTNKGTGA
FT                   STVNATATVNQLIDGLVAFSFGTTIPTASAGEIFNNAGANPASANYAIGYKAISATSYY
FT                   VLFDDIASGDRDFDDMAMRIDIAPVPLPAAGFMLLAGIGGLAAMKRRKKSS"
FT   gene            complement(598888..600294)
FT                   /gene="leuC"
FT                   /locus_tag="RD1_0616"
FT   CDS_pept        complement(598888..600294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="RD1_0616"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30316"
FT                   /db_xref="GOA:Q16CH7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CH7"
FT                   /protein_id="ABG30316.1"
FT                   /translation="MSPKTLYDKIWDAHVAHEADDGTTLLYIDRHLVHEVTSPQAFEGL
FT                   RMTGRTVRAPDKTIAVPDHNVPTTLGREKADNMTEDSRIQVAALDTNAKEFGIHYYPVS
FT                   DIRQGIVHIVGPEQGWTLPGMTVVCGDSHTATHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKSKNMKVEITGKLRPGVTAKDITLSVIGHTGTAGGTGYVIEYCGEAIRDLSMEGRMTV
FT                   CNMAIEGGARAGLIAPDEKTFEYCMGRPHAPKGAQWEAAMSWWKTLYSDDDAHWDKVIT
FT                   IKGDDIAPVVTWGTSPEDVLPITASVPKPEDFTGGKVGAVQRSLEYMGLTSGTPLSEVE
FT                   IDTVFIGSCTNGRIEDLRAAAEILKGKKKKDGLRAMVVPGSGLVRAQAEEEGLADIFKE
FT                   AGFEWRLAGCSMCLAMNPDQLQPGERCAATSNRNFEGRQGRGGRTHLMSPAMAAAAAIT
FT                   GRLTDVRDLM"
FT   gene            complement(600339..600485)
FT                   /locus_tag="RD1_0617"
FT   CDS_pept        complement(600339..600485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30317"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH6"
FT                   /protein_id="ABG30317.1"
FT                   /translation="MQFPRLDEARISRYRFDAMKQLFDISDHARLPGRFVCLIRAAKAH
FT                   LHA"
FT   gene            600528..601844
FT                   /locus_tag="RD1_0618"
FT   CDS_pept        600528..601844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0618"
FT                   /product="mechanosensitive ion channel protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30318"
FT                   /db_xref="GOA:Q16CH5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH5"
FT                   /protein_id="ABG30318.1"
FT                   /translation="MENQSQDFDRVLMSVDEIWHLITSFGVSIMNPGWRQNQIIILLAL
FT                   VVVAWVLHRLLGREIDRRVRAREGWEKWKLRVIVQIKRRLGLICFALMAGLLYQIMQQI
FT                   TWPSRSYLIGLAATLAVVWAVISFLGRFIQNRLLRRFVVWGMWIYATLILIGLGDEASG
FT                   FLDDVGLNFGDYRISLLSVLSAAVVVGVLFTGARFISRTTASRIRSNEDISPSMQVLVV
FT                   KAVQVIFYGLAFFMGINALGLDLTGLAVLSGAIGVGLGFGLQKVVSNLVSGVIILLDKS
FT                   IKPGDVISLGETFGWINSLGARYVSVVTRDGREYLIPNEDLITGQVVNWSHSDEYVRLD
FT                   IFFGTSYGCDPHVVRKLAVEAASGVARVLGPPKTPVCHIVGFGDSSVDYILRFWIRDPT
FT                   GGLTNIRGGVYLALWDIFKANNISIPFPQREVRVLEEQD"
FT   gene            601916..602656
FT                   /locus_tag="RD1_0619"
FT   CDS_pept        601916..602656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30319"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH4"
FT                   /protein_id="ABG30319.1"
FT                   /translation="MARQTDIVLILGSGPNAPQAEAWPRGWFDRIVAINNAWRIREDWD
FT                   DLVFPEDFPEDRRPQSILPSQRFVQADQFVPAQNAYGGFVYAGGTMAFTTAYWALQALR
FT                   PKVMAFLGCDMVYPKAGPTHFYGTGAADPLRPDITLQDLGAKSARLGMFAAAQGCRCVN
FT                   LSSDPSKLMYQRANPDALRDTVLGLPDVTGMGALLKREDDLGYFVATGRYWERDFGFDA
FT                   QGLAALDASWRALWSEGSGITCAA"
FT   gene            602813..603181
FT                   /locus_tag="RD1_0620"
FT   CDS_pept        602813..603181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0620"
FT                   /product="iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30320"
FT                   /db_xref="GOA:Q16CH3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH3"
FT                   /protein_id="ABG30320.1"
FT                   /translation="MSAATDNATSEKLLATILTSLNDDKAEDIVQIDLRGKTEIGDYMV
FT                   ICSGRSTRQVASISEKLVQTIKDDFGRVSKIEGKETGDWVLIDTGDVIVHVFRPEVREF
FT                   YQLEKMWQPMGGPETAAN"
FT   gene            603197..603667
FT                   /locus_tag="RD1_0621"
FT   CDS_pept        603197..603667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30321"
FT                   /db_xref="GOA:Q16CH2"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CH2"
FT                   /protein_id="ABG30321.1"
FT                   /translation="MRIHIIAVGRLRAGPEKDLIGDYLTRFARSGRALGLGPARVVEVE
FT                   DRKNGGMGNEAALLRRAIPDGALIAVLDERGRVESSPDFAQRLAGWRDQGRGDLALVIG
FT                   GADGIDPALRAEADFALSLGKMVWPHMLVRVMLAEQLYRAASILAGAPYHRN"
FT   gene            complement(603688..604272)
FT                   /locus_tag="RD1_0622"
FT   CDS_pept        complement(603688..604272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0622"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30322"
FT                   /db_xref="GOA:Q16CH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH1"
FT                   /protein_id="ABG30322.1"
FT                   /translation="MKTTILGGILFLAPLAVLAILLGKVYQIGLLVAAPVDRLIPVTQI
FT                   GGLALVNILAIVMILLVCYLAGLVARSQFMQARVRRIDDLLIDVLPTYAVFKGMLGSMS
FT                   GSKDVATLMKPVVAKFDDYDQIAFEMERDETQAVLFIPGAPSAWSGTTVVVTLDRVQPL
FT                   DLPTHQAVKLMRVMGRGTLATQRKLAGNQAL"
FT   gene            complement(604372..604746)
FT                   /locus_tag="RD1_0623"
FT   CDS_pept        complement(604372..604746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30323"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CH0"
FT                   /protein_id="ABG30323.1"
FT                   /translation="MSRVLNMIRYVIISLLLSTLPALAEPPRIDHVAARQASDGTWRFS
FT                   VTISHPDTGWDHYADAWRVLDMEGRELGVRVLAHPHVEEQPFTRSLSNVRIPEGVKRVQ
FT                   VQARDKPGGWNPDTQIVTLR"
FT   gene            complement(604759..605457)
FT                   /locus_tag="RD1_0624"
FT   CDS_pept        complement(604759..605457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30324"
FT                   /db_xref="GOA:Q16CG9"
FT                   /db_xref="InterPro:IPR006747"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG9"
FT                   /protein_id="ABG30324.1"
FT                   /translation="MDIMDRFALFTVFDMAAVGLLFGLWFIIGLWVEHAPKSKPSTSQL
FT                   MASYRKEWMKQMVTREPRVFDAQILSALRQGTAFFASTCMIALGGTLALIGNADQLAGV
FT                   AEDITAANYPAIVWEIKLVMLALFLTNAFLKFVWSNRLFGYCAVLMAAVPNDPDDDKAY
FT                   HRASQAAEINITAAKGFNRGLRSIYFALASAAWLLGPLALALAACVTFIVVWRREFASN
FT                   SRKILLDGYV"
FT   gene            605531..606985
FT                   /gene="glcD"
FT                   /locus_tag="RD1_0625"
FT   CDS_pept        605531..606985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="RD1_0625"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30325"
FT                   /db_xref="GOA:Q16CG8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG8"
FT                   /protein_id="ABG30325.1"
FT                   /translation="MSMEMPVPDAAILARKARLVERLQSVVPADAVIHDPHQTRAYECD
FT                   ALTAYKCPPMAVVLPASTKEVSDVLRICHEDGVPVVPRGSGTSLAGGALPTADCVILGV
FT                   ARMNDVLETNYDDRYIRVESGRTNLSVTGAVEEDGFFYAPDPSSQLACAIAGNIAMNSG
FT                   GAHCLKYGVTTNNLMGVTLVMMDGEIVEVGGAHMDSAGLDLLGLICGSEGQLGVVTEAT
FT                   LRILPKPEGARPVLMGFDDSEVAGACVSDIIKAGVLPVAIEFMDRLCIETSENFAQAGY
FT                   PMCEALLIVEVEGSEAEIDHQLDLIMEIARRHDPVELRQSTSAEESALIWLGRKSAFGA
FT                   IGQINDYMCLDGTIPVSSLPFVLRRIGEMSKEFGLQVGNVFHAGDGNMHPLILFDANKP
FT                   GDLERCEALGAEILKLCVEAGGCLTGEHGVGIEKRDLMEYQFAPDDLEAQMAIKDVFDA
FT                   QWLLNPAKVFPLSVSQNRRMLAIAAQ"
FT   gene            607037..608182
FT                   /gene="glcE"
FT                   /locus_tag="RD1_0626"
FT   CDS_pept        607037..608182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="RD1_0626"
FT                   /product="glycolate oxidase, subunit GlcE"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30326"
FT                   /db_xref="GOA:Q16CG7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG7"
FT                   /protein_id="ABG30326.1"
FT                   /translation="MITPDTEAALADVIKSAAAPMHIQGGATRGFVVPGTPLSTRYITG
FT                   ISLYEPGALTLVAAAGTTVRDIDQALAAENQRLAFEPTDYRKLLGTTGEPTIGGVLATN
FT                   ASGPRRIQGGAARDYALGVRFVDGNGAIVKNGGRVMKNVTGYDLVKLFSGSFGTLGVLT
FT                   EVSLKVMPVPETQSTLMLHGLSDVAAVRAMADAMRSPFEVTGAAHGAYVEGEAAVTLLR
FT                   LEGFEGSVAYRINALKDLLTGTGAQITVIDAAASAQVWRDIRDVTVMAKATGDVWRVSC
FT                   KPSQAAELAQRADALSCAFDWSGGLIWVNTPPDTDLRARLGVFDGHATLVRASEETRRR
FT                   LPVFHPQSAGIERLCAGLRARFDPRGILNKGLMDAPETEVA"
FT   gene            608182..609507
FT                   /gene="glcF"
FT                   /locus_tag="RD1_0627"
FT   CDS_pept        608182..609507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="RD1_0627"
FT                   /product="glycolate oxidase, iron-sulfur subunit"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30327"
FT                   /db_xref="GOA:Q16CG6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG6"
FT                   /protein_id="ABG30327.1"
FT                   /translation="MQTTFTPEQMKNPEIQRSNEILRSCVHCGFCTATCPTYQVLGDEL
FT                   DSPRGRIYLIKDMLENDRDPDAKTVKHIDRCLSCLACMTTCPSGVHYMHLVDHARAYIE
FT                   ERYKRPFSDRALRWVLARILPYPMRFRLALLGAKIGRPFARFMPDARLQAMLEMAPKTI
FT                   PPVSRNDDPQSFAPEIERKKRVALMTGCAQKALNTDINDATIRVLRRLGCEVVVAKGAG
FT                   CCGALTHHMGKSDESHSTAARNIRAWAREMDAGGLDAIVINTSGCGTTVKDYGHMFRND
FT                   PALAEDAARVSAIAKDVSEVLVDLDMPAGEDKAMVVGYHAACSLQHGQQIKTFPKDLLK
FT                   RAGFTVVEPRDSHLCCGSAGTYNLMQPEISKQLKARKVQTLEAKNPDVIAAGNIGCMMQ
FT                   IGSGTEIPVVHSVELLDWATGGPRPPSLDGDAMPKSDVPILR"
FT   gene            609598..610419
FT                   /locus_tag="RD1_0628"
FT   CDS_pept        609598..610419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0628"
FT                   /product="trypsin domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30328"
FT                   /db_xref="GOA:Q16CG5"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG5"
FT                   /protein_id="ABG30328.1"
FT                   /translation="MRRWVRAAALLGCLATSAAADPQGLRALETGVDAGAWEAVGRLNI
FT                   GGRGFCTGALIAPDIVLTAAHCLFDKRSGAQVDPTGIEFLAGWRKGRAAAHRQVKHAAL
FT                   HKDYTYGDVVAPERVRYDLALLRLVRPIRNTTITPFETAPHPAKGAQVGVVSYGRDRAE
FT                   APSLQEVCEVLGRQEGVLITTCAVDFGSSGAPIFSFASGAAVIVSVVSAKAEVEGQNIA
FT                   LGTDLSGALAALHETLARQNRPFVRAVPALRQTTIEESRSSMGARFIRPAQ"
FT   gene            610631..611098
FT                   /gene="ibpA"
FT                   /locus_tag="RD1_0629"
FT   CDS_pept        610631..611098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="RD1_0629"
FT                   /product="heat shock protein, Hsp20 family"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30329"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG4"
FT                   /protein_id="ABG30329.1"
FT                   /translation="MRTFDFAPLYRATVGFDQIADLMDRVLTNEGAQPSYPPYNIEKLD
FT                   DDAYRISVAVAGFSDQDLSVEVRENALIVSARKAEENTERTYLHRGIATRAFERRFHLA
FT                   DHVHVTGASHVDGMLHIDLMREVPEALKPRQISITSAKQIEKDVVDAKAVN"
FT   gene            complement(611188..611400)
FT                   /locus_tag="RD1_0630"
FT   CDS_pept        complement(611188..611400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30330"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG3"
FT                   /protein_id="ABG30330.1"
FT                   /translation="MKHPRWCINGWGCVQAALAVAESDARTRIIAITLACFDFAHSDPK
FT                   RGEMRIERGAQAALNKISKAHAHGA"
FT   gene            complement(611397..612698)
FT                   /locus_tag="RD1_0631"
FT   CDS_pept        complement(611397..612698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0631"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30331"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG2"
FT                   /protein_id="ABG30331.1"
FT                   /translation="MFSSSFAHRIALSSLFPNDGVGMEEPINIGFLAPLTGPVSSWGLP
FT                   GLHGCQLWAEWLNRAGGLLVGGRRYPLRILPYDCGYDPQSALEGARHLVLSEKVKLLMM
FT                   LGGDTFTPLRSFLMQNRVLTSTLLPSDLSPDTPYLIAPSEVHPVYNVTGVDWLAANEPQ
FT                   RRRVAMCSQRDALGLPSTATYRAAFDAADLAIVKDIQYRPEDTDIAAIVQPMLDARPDI
FT                   LCWCTSYTPAVHAMTEYAFERGFTGRILSCTLDNYPRLIERTSAGFMEGTVFQFPDFDD
FT                   PELARKAFFFNRPSAFFEEYNARYPGAWSAVSWEYVAILEIWHAAVERVASVSPVSVLT
FT                   TMKQMQPVTHAFGPARWWGESLFGIDNALIGDWPVVQIREGKARIAAFRSIPEWLEKHE
FT                   DKLREQMRAEGQLWQQRIELGSAPTHLIAREAMD"
FT   gene            612813..614213
FT                   /locus_tag="RD1_0632"
FT   CDS_pept        612813..614213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0632"
FT                   /product="flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30332"
FT                   /db_xref="GOA:Q16CG1"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG1"
FT                   /protein_id="ABG30332.1"
FT                   /translation="MVQPISTTFKPSSRETDMSTKRVAIIGAGPSGLAQLRAFQSAAEK
FT                   GEEIPEIVCFEKQSNWGGLWNYTWRTGLDENGEPVHCSMYRYLWSNGPKEGLEFADYSF
FT                   EEHFGKQIASYPPRAVLFDYIEGRVKKAGVRDWIRFSTAVRWVSYDNDTGLFTVTVHDH
FT                   KKDYVYEETFDHVICASGHFSTPNVPYYEGFESFKGRVVHAHDFRDAREFTGKDILVVG
FT                   SSYSAEDIGSQCWKYGAKTVTSCYRSAPMGFKWPENWEEKPAMQKVDGNTVFFADGTTK
FT                   EVDAIILCTGYKHFFNFLPDDLRLKTANRLASADLYKGVAFVHNPKMFYLGMQDQWFTF
FT                   NMFDAQAWWVRDAILGKIDLSKVSKAEMVADVKEREAREEEDDDTKYAIRYQADYIKEL
FT                   VAETDYPDFDIDGACEAFFQWKKHKAEDIMGFRNNSYKSVMTGTMAPVHHTPWKDALDD
FT                   SMEAYLKN"
FT   gene            complement(614461..615888)
FT                   /gene="ald"
FT                   /locus_tag="RD1_0633"
FT   CDS_pept        complement(614461..615888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="RD1_0633"
FT                   /product="aldehyde dehydrogenase family protein, putative"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30333"
FT                   /db_xref="GOA:Q16CG0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CG0"
FT                   /protein_id="ABG30333.1"
FT                   /translation="MLEKRNFYINGQWVAPVKQNDFAVIDPSTEEQCAVISLGGQADTD
FT                   AAVAAARAAFDDWSQTSKSERQGLLKRLLEVYNDRSEEMAQAMSMEMGAPMALSRAQQV
FT                   GAGSWHLEGFLKAFEDFSFERDFTSSEKTLLEPIGVCALITPWNWPMNQIVLKAVPAMA
FT                   TGCTMILKPSEIAPLSGLLFSEFVHEAGFPAGVFNMVNGDGAGVGSKLSAHPEVDMVSF
FT                   TGSTRAGIAISKAAADTLKRVSLELGGKGANIIFEDARPDAAKSGAVRCFRNSGQSCNA
FT                   PTRMLVHKSRYDEAVEMAADVARNTHVGPASEEGKHIGPVVSEAQFDKIQKLIEVGMGE
FT                   ARLVAGGLGRPDGLNRGYFVKPTVFADVTNEMTIAREEIFGPVLSIIPFESEEEAIAIA
FT                   NDTPYGLTNYIQTEDTDKRRRVARRLRSGMVETNGQGFAQGSPFGGYKQSGNGREGGIY
FT                   GLEEFLEVKAVSGWAAE"
FT   gene            616042..616695
FT                   /locus_tag="RD1_0634"
FT   CDS_pept        616042..616695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0634"
FT                   /product="antioxidant, AhpC/Tsa family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30334"
FT                   /db_xref="GOA:Q16CF9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF9"
FT                   /protein_id="ABG30334.1"
FT                   /translation="MGLRINDTVPDFTAETDHGTIQFHDWIGDSWAILFSHPKDFTPVC
FT                   TTEFGAVAQLADEWEKRGTKVIGVSVDGVEDHKKWKGDIEHVAGTTAGFPIIADEGLAV
FT                   SKAFDMLPAEAYLPDGRTPADSATVRSVFIIGPDKQLKLSMTYPMTVGRNFAEVLRALD
FT                   GLQMSTGKGVATPANWVPGEDVIIPPSVSDEDAKAKFGDFETVLPYLRKTKAPS"
FT   gene            complement(616843..617820)
FT                   /locus_tag="RD1_0635"
FT   CDS_pept        complement(616843..617820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0635"
FT                   /product="glycosyl transferase, putative"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30335"
FT                   /db_xref="GOA:Q16CF8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF8"
FT                   /protein_id="ABG30335.1"
FT                   /translation="MSTLRPLRITVSTLTRQRPAMLAALIESWGKMAVPIACEITCLVV
FT                   ENDAEPKSVGVVDVARPLANGVGLAYVLETEPGIPFGRNRAAKEAIAAGSDLLAFVDDD
FT                   EIVAEDWLVKLIAAYRHSEALLIGGPLRVKETPRKLSFVAALMDKCIARRYLRKETRAA
FT                   RRADLTGTPGVTIVTNNWLAETSVFEKHGIWFDEKMRFTGGTDSKLCAEVKAAGLPTAW
FT                   AADAAVYEEIPLERLAIRYQFKRGRDQSSTNYTRKLEGQPSAKYNVLVSVPIKIVIICG
FT                   LVIALPFTGGRTLLDVVRTSGWVAGRFDALRGRRSDLYKTVTGD"
FT   gene            617819..618772
FT                   /locus_tag="RD1_0636"
FT   CDS_pept        617819..618772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0636"
FT                   /product="glycosyl transferase, putative"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30336"
FT                   /db_xref="GOA:Q16CF7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF7"
FT                   /protein_id="ABG30336.1"
FT                   /translation="MNRDYCVYGASATSAESDMRSIQLDKKASVIIPTYHSWPDLQRCL
FT                   DLLEAQTTPASDFEIVVVNNAATDEVPDDFHLPPNARVIREPKPGSYAARNAGIGAAGT
FT                   DLLFFTDADCRPRPDYIAQGLKAFAAHPDVLRFAGAVELEAAGEVWTIAERVDRMTSLK
FT                   QEHYASQGRAATANIFVRRAAFEAVGLFDDTALSGGDMEWARRCNAQGVKQLYVPEVMV
FT                   GHPARASMEAHAIKRRRILGAQIRNADPRKKWKYHIPPFKRFLLPSFGAMRSAFREPDV
FT                   TLWQRFQIWSFLNRLRRVIAKEQIRLTWFKGRHERR"
FT   gene            complement(618906..621041)
FT                   /gene="pnp"
FT                   /locus_tag="RD1_0637"
FT   CDS_pept        complement(618906..621041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="RD1_0637"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30337"
FT                   /db_xref="GOA:Q16CF6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CF6"
FT                   /protein_id="ABG30337.1"
FT                   /translation="MFNETKKSIEWGEETLTLETGKVARQADGSVIATLGETSVMANVT
FT                   FAKKQKPGQDFFPLTVHYQEKYYAAGKVPGGFFKREARPTEKETLTARLIDRPLRPLFV
FT                   PGFKNEVLVMCTVLSHDLVNDPDMVAMIAASAALTISGAPFMGPIAGARVGFEDGEYIL
FT                   NPTVDDMQDLRLNPEQRLDLVVAGTKDAVMMVESEAYELSEAEMLGAVKFAHDAIQPVL
FT                   DLIIDLAEDCAKEPFDFSPPDYSELSAAVKAAGETEMRAAFAISDKQERTTAVAAARET
FT                   IMAALSDEQKEDPNLGSAMKGLEASILRGDVVKTGKRIDGRKTDEIRDIVCETGLLPRT
FT                   HGSALFTRGETQGLVVTTLGTGDDEQFIDALHGNFKSNFLLHYNFPPYSVGEAGRVGPP
FT                   GRREIGHGKLAWRALQAVLPAATDFPYTVRVVSEITESNGSSSMASVCGGSLSMMDAGV
FT                   PLKAPVAGVAMGLILEEDGSYAILSDILGDEDHLGDMDFKVAGTEAGITSLQMDIKIAG
FT                   ITPEIMEKALEQAKAGRIHILGEMAKSITGAQDFSIHAPRIETMQIPTDKIREVIGSGG
FT                   KVIREIVEVSGAKVDINDEGIIKIASPNGEAIKKAYDMIHSIVAEPEEGMVYTGTVVKI
FT                   VDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFDDRGKVRLSMKV
FT                   VDQETGEEIKKEEAPAD"
FT   gene            complement(621496..623049)
FT                   /locus_tag="RD1_0638"
FT   CDS_pept        complement(621496..623049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0638"
FT                   /product="Na(+)-linked D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30338"
FT                   /db_xref="GOA:Q16CF5"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF5"
FT                   /protein_id="ABG30338.1"
FT                   /translation="MLKKLNYLAASAALATMANPVMAQEASSLDARVNEIFATFTGPFV
FT                   GLIFAPFPGTSFPWIVMWLVIAATIFTIYFGFVQLRFFGHAISLVKGDYSDPDDAGEVS
FT                   HFQALATALSGTVGLGNIAGVAVAVGIGGPGATFWMILAGLLGMASKFTECTLGVKYRN
FT                   EYPDGTVSGGPMYYMSKGFDELGLPGGKILAVLFSVFCILGALGGGNMFQANQAHAQIT
FT                   QITGDYPGWITGIIFAGVVFAVIVGGIKSIAKVTEKVVPFMGIMYVGAALIILIVNFDM
FT                   IGWAFGQIFVGAFTGLGVAGGFVGALIQGFKRAAFSNEAGVGSAAIAHSAVKTKEPITE
FT                   GFVSLLEPLIDTVVICTMTALVIIISQQLIIDEATGNYMLNEAGSAIATVDGNSGVALT
FT                   SAAFASGISWFPFILAIAVVLFAFSTMISWSYYGLKAWTYLFGEGKTSELVFKVIFCIF
FT                   IVIGAAASLGPVIDFSDAAIFAMAVVNIFALYFLMKLVRAELASYSARLKSGEIKKFSH
FT                   "
FT   gene            complement(623060..623497)
FT                   /locus_tag="RD1_0639"
FT   CDS_pept        complement(623060..623497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0639"
FT                   /product="universal stress family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30339"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF4"
FT                   /protein_id="ABG30339.1"
FT                   /translation="MTTTLLVGLDGHSSGERALAYGEELAKLIGNCTLLVVYVIEWSPY
FT                   SFQTAEENAQRHKRREEEISTAMARVVQPALDSLKEKGVTAQGKVRHGNVSDTLESIAS
FT                   SSSADQIIVGRSTETGLSQRIFGSSTANLVMQATVPVTVVP"
FT   gene            complement(623772..624362)
FT                   /locus_tag="RD1_0641"
FT   CDS_pept        complement(623772..624362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0641"
FT                   /product="LysE family transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30340"
FT                   /db_xref="GOA:Q16CF3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF3"
FT                   /protein_id="ABG30340.1"
FT                   /translation="MYTFAAAVFFLIITPGPGVLSAAGVGASFGAQAGVRYLAGLFIGT
FT                   NLVCLAVVSGLTAFLLADPRLRIILFFASVAYLTYLALRIAFAGSKIAFIERQKPPGVI
FT                   GGIALQAINPKAYAVNTALFSGFGFLPGNLVLEITLKFLIVNAIWIPIHIAWLYLGISL
FT                   RRMNLPDRTQRAINIAMAASMMVVVALAATAQF"
FT   gene            complement(624537..624806)
FT                   /gene="rpsO"
FT                   /locus_tag="RD1_0642"
FT   CDS_pept        complement(624537..624806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="RD1_0642"
FT                   /product="ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30341"
FT                   /db_xref="GOA:Q16CF2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CF2"
FT                   /protein_id="ABG30341.1"
FT                   /translation="MSITAEEKARVMKEFATKEGDTGSPEVQVAILSSRIATLTEHFKT
FT                   HKKDNHGRRGLLKMVATRRKLLDYTKAKDEARYQDLIKRLGLRR"
FT   gene            complement(624977..625240)
FT                   /locus_tag="RD1_0643"
FT   CDS_pept        complement(624977..625240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0643"
FT                   /product="type I secretion target repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30342"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF1"
FT                   /protein_id="ABG30342.1"
FT                   /translation="MEKNGQTGEVLDHETGQDTLMLVWNDTIVDASAPDIGVGKVPFDA
FT                   QVALVLMNGRCVAQIHGDPGLDASGITVIPSSSARRIGLEPV"
FT   gene            complement(625962..626543)
FT                   /locus_tag="RD1_0645"
FT   CDS_pept        complement(625962..626543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30343"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CF0"
FT                   /protein_id="ABG30343.1"
FT                   /translation="MRKDTPATLHDPGGKVHLRLGDGVTGGAIFSPCGRYRHVLTRDWT
FT                   RQGDPPRTIMFVGQNPSVASAEVSDPTCNKEVRFARRWGFTRYVKTNILDWRATNPKDV
FT                   PHDPALACSADNLPNMMEEAAQVDEVLMAYGKLHKRYVDVVMRTVSALRGTGKPLNCLK
FT                   LNKDGSAQHPLYIRDDTQRFVFPSFSHTDV"
FT   gene            complement(626688..627233)
FT                   /locus_tag="RD1_0646"
FT   CDS_pept        complement(626688..627233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30344"
FT                   /db_xref="GOA:Q16CE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CE9"
FT                   /protein_id="ABG30344.1"
FT                   /translation="MSPISRSSETEMTPKGLHDMKRTALTLLTAGAFATIAFDVFGQAL
FT                   SPLFGHAKLAPVGLAGATIKSVFGTNPSGAAYLLHSLTGLLFYVVGYFAIARPVQIAIL
FT                   PKLHWSITAIVYGVALWAFALYGMAHLVAGMKPFLGFTGITWVALWGHIVYALVAAAIL
FT                   ESRGVVMELPKRTQLALG"
FT   gene            complement(627364..628275)
FT                   /gene="truB"
FT                   /locus_tag="RD1_0647"
FT   CDS_pept        complement(627364..628275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="RD1_0647"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30345"
FT                   /db_xref="GOA:Q16CE8"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CE8"
FT                   /protein_id="ABG30345.1"
FT                   /translation="MGRRRKGRDISGWLIVDKPAGLTSTAVVNKVRWALDAKKAGHAGT
FT                   LDPDATGVLAVALGEATKTVPYVTGALKAYEFEIRLGQATNTDDAEGEVIAQSDLRPTE
FT                   DEIKEALSAFIGDIEQVPPQFSAVKVDGERAYKRARDGEEMTLAARPLYVDSLLLIDRP
FT                   DADHVLLEMVCGKGGYVRSIARDLGAALGCLAHVRSLRRIWSGPFDAKNAADLETIEAL
FT                   ARTPELDAHVQPLETALDDMPEVKATAEGAVRLRNGNPGMVLASGIEYGETCWASFESR
FT                   AIAIGRYKSGELHPVRVINAPD"
FT   gene            complement(628381..629121)
FT                   /locus_tag="RD1_0648"
FT   CDS_pept        complement(628381..629121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30346"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CE7"
FT                   /protein_id="ABG30346.1"
FT                   /translation="MTRLGYMALFLGLGASALSAATCEAVTYNGAQYTICEIDAGEDQL
FT                   DLFLRDDAGDIYGQFTSVDRALSEHGEKLVFAMNAGMYHDDRSPVGHYVENGEEIMRVI
FT                   PNAGPGNFGLLPNGVLCVREGRTDVFETLAYIEAAPACKHATQSGPMLVIDGALHPRFL
FT                   ADGTSLHIRNGVGTSADGQRVVFAISDQPVNFHSFGTLFRDYIGVPNALYFDGKVSRLY
FT                   APDLGRRDFGFALGPIIGVVAPAD"
FT   gene            complement(629118..629549)
FT                   /gene="rbfA"
FT                   /locus_tag="RD1_0649"
FT   CDS_pept        complement(629118..629549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="RD1_0649"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30347"
FT                   /db_xref="GOA:Q16CE6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CE6"
FT                   /protein_id="ABG30347.1"
FT                   /translation="MRFMGKNKFHTGPGPSQRQLRVGETIRRALSDVLARGDVHDTDLN
FT                   RLSVTVGEVRASPDLKIATAYVLPLGGQGKDEVIALLARNKGELRRLVAKKLTLKFAPD
FT                   LRFQLDETFDRMDETREMLNRAEVKRDTGPVPAGESDTE"
FT   gene            629629..630447
FT                   /gene="dapB"
FT                   /locus_tag="RD1_0650"
FT   CDS_pept        629629..630447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="RD1_0650"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30348"
FT                   /db_xref="GOA:Q16CE5"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CE5"
FT                   /protein_id="ABG30348.1"
FT                   /translation="MTTPMKIAITGVSGRMGRMLVDTIDTSDAVTLSAALERPGHDWIG
FT                   RDLGLALGGTERGVLVSDDIDSALADSEAVIDFTSPAATIRFAQAAARVGAIHVIGTTG
FT                   MTEQEIAQIDAQAAGAVIVRAGNMSLGVNLLVQLTKRVAAALDEDFDIEVIESHHNQKV
FT                   DAPSGTALMLGEAAAEGRGVSLDAVSDRGRDGLTGARQKGDIGFVSVRGGDIVGEHDVL
FT                   FAAQGERITLRHVASDRSVFARGALKAALWARHRAPGAYDMLDVLGLKDG"
FT   gene            630538..630894
FT                   /locus_tag="RD1_0651"
FT   CDS_pept        630538..630894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30349"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CE4"
FT                   /protein_id="ABG30349.1"
FT                   /translation="MRIALSSLTIAATLIAAPAFAEFSKVDDQSEFVALISGKELRRPF
FT                   VNLEVTPDGAINGYGAAWPVTGNWTWRDGYFCRDIYWGGDPLGYNCQEVQATEDRIRFT
FT                   SDRGAGDSAEFRLR"
FT   gene            complement(630960..631154)
FT                   /locus_tag="RD1_0652"
FT   CDS_pept        complement(630960..631154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30350"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CE3"
FT                   /protein_id="ABG30350.1"
FT                   /translation="MTQDSDDTQDISDLPPAAQRALAEAEARRKKAKDMNMPPELGGRE
FT                   GPEPVRYGDWERKGIAVDF"
FT   gene            631240..632511
FT                   /locus_tag="RD1_0653"
FT   CDS_pept        631240..632511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0653"
FT                   /product="rRNA methyltransferase RsmB"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30351"
FT                   /db_xref="GOA:Q16CE2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CE2"
FT                   /protein_id="ABG30351.1"
FT                   /translation="MADTGLPARRSAVYLLDQILGEGRLMSELLTAGTLDKLEPEDRAR
FT                   AARLAQDTLRGLERADRILQKHLSKYPPLTVRNALRVGAVELCTGTAAHGVVNAMVELV
FT                   SRHKHYSHLKGLTNAVLRKVAADGPAAWDALRAPRLPKWLRGPLVEAWGADAMARMEIA
FT                   HFAGAPLDLTAKSDASAIAALTGGTVLPTGSVRVENAGQVSAMPGFSDGTWWVQDAAAA
FT                   LPVRILAPQPGETVLDLCAAPGGKTMQLAAAGARVTAVDDSSVRMGRVAENLARTGLKA
FT                   EVLVQDARATSGTFDAVLLDAPCSATGTIRRHPDLPHAKDGSEFGDLIAMQSELIDHAW
FT                   DRVKPGGRLVFCTCSLLPDEGEVQVDEALERHEDMRTDADALGVPGVDPAWRTSEGGLR
FT                   LRPDYWSDLGGLDGFYIAVLRKAG"
FT   gene            632577..634364
FT                   /locus_tag="RD1_0654"
FT   CDS_pept        632577..634364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30352"
FT                   /db_xref="GOA:Q16CE1"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CE1"
FT                   /protein_id="ABG30352.1"
FT                   /translation="MPQSVVRTRQAEIAMSQSKSFAARKVHFLNRWHATRAGRMRSRPV
FT                   GFVSSPEPRTIGSYARGRQLLAGNFLFAGHLLERKDADIWDLPPPNEDFSLELSGFQWL
FT                   DDLAAVGDAAARGKAQAWLWGWIERYGRGRGPGWTPDLTGRRLIRWINHAIFLLRGSDG
FT                   PDSDTFYRSLNQQTHFLSRRWQGAASGLPRFEALTGLIYAALSLEGMQAMAMPALKGLA
FT                   RECRTQIDAQGGLPSRNPEDLLEVFTLLTWTAATLKEAGYAPPREHLEAIARIAPTLRT
FT                   LRHADGGLARFHGGGRGAEGWLDHALAQARIKTQQPDGLSMGFARLSAGRTSVIIDASV
FT                   PPAGRASFNAHASTLAFEVTSGRRPLIVNCGSGRTFGPEWRRAGRATPSHSTLALGGYS
FT                   SARLGSADPATGGEPLIEAPTHVPIEITDASDGIRFQGGHDGFVPTHGLTHARTLEMTF
FT                   DGRGIAGEDMLLAMGDREKRRFDLALDATKLAGIGFEIRFHLHPDVDATLDMGGAAISI
FT                   ALKSGEIWVFRHDGSQKLKLEPSVYLEVGRLKPRSANQIVLAGRAMSYATRVRWSLSKA
FT                   QETAIGVRDLSRDTLNYTD"
FT   gene            634384..635970
FT                   /gene="purH"
FT                   /locus_tag="RD1_0655"
FT   CDS_pept        634384..635970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="RD1_0655"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30353"
FT                   /db_xref="GOA:Q16CE0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16CE0"
FT                   /protein_id="ABG30353.1"
FT                   /translation="MTDLAPLRRALLSVSDKTGLVALGKALAARGVELLSTGGTARALR
FT                   DAGLEVKDVAEVTGFPEMMDGRVKTLHPAVHGGLLALRDNDDHLAAMQEHGIAGIDLVV
FT                   VNLYPFEQTVAKGAQYDEVIENIDIGGPAMIRSAAKNHGFVSVVVDVEDYDVLIAQLEA
FT                   YDGHTTYALRQRLAQTAYARTAAYDTAVSTWMAAQVGEPPRRRSFGGTLAQTLRYGENP
FT                   HQDAAFYLDGSNSPGVATARQLQGKELSYNNINDTDAAFELVSEFDQGDGPACAIIKHA
FT                   NPCGVARAETLTEAYRRAFDCDRTSAFGGIIALNQPLDGATAEEISSIFTEVVIAPGAD
FT                   AEAQEVFAKKKNLRLLTTDGLADPTAPGLAIRQVSGGYLVQDRDTGRLSADALQIVTKR
FT                   APSDQEMADLMFAWTVAKHVKSNAIIYVKDGATVGVGAGQMSRVDSTRIAARKAQDMAE
FT                   AMGLPAPLTQGSVVASDAFFPFADGLITAAEAGATALIQPGGSMRDDEVIAAADEAGLA
FT                   MVFTGMRHFRH"
FT   gene            635985..636470
FT                   /gene="lspA"
FT                   /locus_tag="RD1_0656"
FT   CDS_pept        635985..636470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="RD1_0656"
FT                   /product="signal peptidase II, putative"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30354"
FT                   /db_xref="GOA:Q16CD9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD9"
FT                   /protein_id="ABG30354.1"
FT                   /translation="MRLLYGAAVIAFLVDQVSKYIVIHMMELWRIRAVDVFPPFVNFRY
FT                   GENRGINFGLFDGGSDAARWALIGVALAICTFVYIWSRKSQLAGWAAAAAGLLIGGALA
FT                   NVLDRLIYGYVLDFLNMSCCGIDNPFVFNLADVFIFMGAIGLVFLAPDPKADANKGG"
FT   gene            636537..637040
FT                   /locus_tag="RD1_0657"
FT   CDS_pept        636537..637040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30355"
FT                   /db_xref="InterPro:IPR021395"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD8"
FT                   /protein_id="ABG30355.1"
FT                   /translation="MRMKVPFLLLAMTLAACSNQGLKTLSSTSRGPDEFIVEPKAELTL
FT                   PPDFSNLPQPTPGQANRTDTDPLAEMVVALGGRPGDASAPVPSSDGALVTAASRFGVSP
FT                   DIRQSLATEDAEFRRTQSRFTQFKIFPEDVYNQVYRDQALDPRETAEAWRRAGARTPSF
FT                   PPPG"
FT   gene            637158..638489
FT                   /gene="pqqE"
FT                   /locus_tag="RD1_0658"
FT   CDS_pept        637158..638489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="RD1_0658"
FT                   /product="peptidase, M16 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30356"
FT                   /db_xref="GOA:Q16CD7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD7"
FT                   /protein_id="ABG30356.1"
FT                   /translation="MRCTAFAALLSLIPVTLSAGEEAVTTFELENGMQVVVVEDHRAPV
FT                   VQHMLWYRAGSADEPKGSSGVAHFLEHLLFKATDTLAEGELSATVARNGGRDNAFTSYD
FT                   YTAYFQRVASDRLGLMMKMEADRMKNIRLTEENIATERNVIIEERNQRTENNPGALFGE
FT                   QINAAQFLNHRYGVPIIGWMHEMETLDMEDALGFYEIYYSPNNAVLVVSGDVTPEEVRA
FT                   LAEEHYGAIPSNPDLPTRMRTQEPPQTAERRLIYRDARVAQPYVRRSYLAPERDPGAQE
FT                   TAAALVFLSEILGGGTTSFLAEELQFNNQLATYAASFYRPVSLDDTTFNLIVVPRPDVS
FT                   LQEAEDAMDAALAKFMETGVDPEQLERIKFQIRADQIYARDDVDRIANRYGQALTSGLT
FT                   VEDVQVWPDVLQAVTEEDIMAAAREVFDRRASVTGWIMREEVTQ"
FT   gene            638489..639805
FT                   /locus_tag="RD1_0659"
FT   CDS_pept        638489..639805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0659"
FT                   /product="peptidase, M16 family, putative"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30357"
FT                   /db_xref="GOA:Q16CD6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD6"
FT                   /protein_id="ABG30357.1"
FT                   /translation="MRLMMTIAAVLCLALPASATVDIKEVNTPGGLTAWLVKDQSIPFM
FT                   ALEIRFRGGASLDVAGKRGATNLMTGLLDEGAGDMDARAFARSVEGLAASISFGVDDDA
FT                   LSVSARFLTENRDEAVALLRAAMLEPRFDADAIERVREQVISGIESDAKDPDALASRAM
FT                   DQMMFGDHPYATNLSGTVSSVEALTRDDLVEAHRNLLARDRIYIGAVGDITEEDLAALL
FT                   DGLLGALPEEGAPMPPRANVEISGGITVVPFETPQSVARFAQKGIKLDHPDYFTAVVLN
FT                   HVLGGGSFESRLMDEVRAKRGLTYGVYSYLAGKDLAEVYIGSVSSANDRIAEAIEVIRD
FT                   EWEKAATEGVTAQEVENAKTFLTGAYPLRFDGNGPIANIMVGMQMLGLPIDYIATRNER
FT                   VEAVTVEGVKRVAGELLEPENLHFVVVGQPVGLETTPGN"
FT   gene            complement(639848..642190)
FT                   /gene="ald"
FT                   /locus_tag="RD1_0660"
FT   CDS_pept        complement(639848..642190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="RD1_0660"
FT                   /product="aldehyde dehydrogenase family protein, putative"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30358"
FT                   /db_xref="GOA:Q16CD5"
FT                   /db_xref="InterPro:IPR011408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD5"
FT                   /protein_id="ABG30358.1"
FT                   /translation="MTVSEIFASMEYGTAPESAADALAWIAEQGGQFGHFIDGAFTSPG
FT                   EGFETRNPATGETLARLSQATQDDVDRAVAAARRAQPRWEKLGGHGRARFLYSLARLLQ
FT                   KHSRLFAVLETLDNGKPIREARDIDIPLAQRHFYFHAGMAQLMPTELADRAPIGVCGQI
FT                   IPWNFPLLMLAWKIAPALAMGNTVVLKPAEYTSLTALLFAEICTQAGLPKGVVNIVIGD
FT                   GAVGERVVAAPVDKIAFTGSTEVGRRIREQTAGSGKALTLELGGKSPYIVFDDADIDSA
FT                   VEGLVDAIWFNQGQVCCAGSRLLVHEPVADVFYRKLRARMDKLRVGDPMDKNTDVGAIV
FT                   DPVQVSHISGLVSANRSGDTHVAPVTIPQTGSFYPPTLITGLNPADTLMQEEIFGPVLV
FT                   STTFRTPAEAVQLANNTRYGLAATVWSENINLALDIAPKLAAGIVWINGTNMMDAAAGF
FT                   GGVRESGFGREGGWEGLAAYTKPKSKPKPLRKIARVTGKASPADAIDRTSKLYIGGKQA
FT                   RPDGGYSRPVFNKSGGLAGHVSLANRKDVRNAVEAARSAGAWSKTTGHLRAQILYYIAE
FT                   NLSARAGEFAARLNALQGGTRGAAEVEATVQRLFTYAAWADKFDGQIHGVPLRGVALGM
FT                   KEPVGVIGAICPDEAPLLGLVSCMAPAIAMGNRVILAASEPFPLAATDFVQVLETSDVP
FT                   AGVVNILTGDHADSAAPLAGHMDVDAVWCFGAAGLSETVEKAAASNLKRTWVNHGRARD
FT                   WNGPDGEGRAFLEAATEVKNVWIPYGE"
FT   gene            complement(642218..643174)
FT                   /gene="deoC"
FT                   /locus_tag="RD1_0661"
FT   CDS_pept        complement(642218..643174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="RD1_0661"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30359"
FT                   /db_xref="GOA:Q16CD4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD4"
FT                   /protein_id="ABG30359.1"
FT                   /translation="MPQVVEPRNPGMDLDMDWVMRLQANTSAIERRAATLPARRSVKKA
FT                   HQAAWLLRAITCIDLTTLSGDDTERRVERLCAKAMHPVSDSLLSALGVDDIKTGAVCVY
FT                   HEMIPAALRALEGSGIPVAAVSTGFPAGLSPLHLRIAEIEESVAAGAAEIDIVISRRHV
FT                   LTGNWQALYDEMRAFRAACGNAHVKAILATGELGSLRNVARASMVCMMAGADFIKTSTG
FT                   KESVNATLPVTLVMIRAIRDYYERSGYRVGYKPAGGISKAKDALTYLALIKEELGTAWL
FT                   APNLFRFGASSLLNDIERQLEHHVTGQYSAGYRHATS"
FT   gene            643354..645186
FT                   /gene="mutL"
FT                   /locus_tag="RD1_0662"
FT   CDS_pept        643354..645186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="RD1_0662"
FT                   /product="DNA mismatch repair protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30360"
FT                   /db_xref="GOA:Q16CD3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD3"
FT                   /protein_id="ABG30360.1"
FT                   /translation="MNVANPNIGASRPVIRQLDEGAVNRIAAGEVVERPASAIKELVEN
FT                   ALDASARKIAIDYGDGGKTLIRVQDDGCGMTATDLPLALSRHATSKIDGSDLLNIQTFG
FT                   FRGEALPSLAAVGRLTIVTRAGGDDGVEASVSGGDEKPLKPAACNPGTTVTIRDLFYAT
FT                   PARLKFLRSDRAEAQAIIDVVKRLAMAEPFVQFVLRDVSGDGPGREVFRADAQQGDLFG
FT                   ALHGRLARVLGREFAENALAIDAEREGLHLTGFAALPTYSRGSAVAQYFFVNGRPVKDK
FT                   LLVGALRGAYSDFLSRDRHPAAALFLDCDPKLVDVNVHPAKSEVRFRDPGIARGLIVSA
FT                   LRHALAEAGHRASTTVSTATLGAMQPEPIGARVYQMDQASRPVSAPPPQTPAFQEVAAP
FT                   WGRVAETDPDEQTAGDPGDYPLGAARGQVHENYIIAQTATGMVIVDQHAAHERLVYEKL
FT                   KRQMAENGVASQALLIPEIVELSAADCASLMQISDDLARLGFVVEPFGGDAIAVRETPA
FT                   ILGVVDARALILDILDELADQNASENIRMRIDAILSRVACHGSIRSGRWMKTEEMNALL
FT                   REMEATPHSGQCNHGRPTYVELKLSDIERLFGRT"
FT   gene            645183..646418
FT                   /locus_tag="RD1_0663"
FT   CDS_pept        645183..646418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0663"
FT                   /product="RmuC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30361"
FT                   /db_xref="GOA:Q16CD2"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD2"
FT                   /protein_id="ABG30361.1"
FT                   /translation="MIEFAGHTIDLTDPVVLAAMGGGAVVLLILVLLVMAVRAAARSAK
FT                   STEPLMQQLGVLGQHVQHLSAGQEQLRGGLQTVSDTQANAQTQVIQTVEARLAAVQQQM
FT                   QDRLADNAMRSQRALTDMQERMKETLHGSSKQTTTSLTQLQERLASIDKAQDNITKLSG
FT                   DVLSLQDILSNKQTRGAFGEIQLHDIVSKALPNDSYALQHTLSNGKRADCLIHLPNPPG
FT                   PIVIDSKFPLEAYEQLRAAKTEWDLKDAVAKMKTAVTKHINDISEKYIIEGETADGALM
FT                   FLPSEAVYAELHSNFPELVRKGFDARVWIVSPTTCMATLNTMRAILKDARMREQAGAIR
FT                   KTLKMLHRDVELVVERVGKLDTHFRQAQRDVHEISTAAERAGKRAVKLDNFDFEELSQE
FT                   DDKILPLTRTEA"
FT   gene            646415..646513
FT                   /locus_tag="RD1_0664"
FT   CDS_pept        646415..646513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30362"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD1"
FT                   /protein_id="ABG30362.1"
FT                   /translation="MKCGAKYLKHALLPDIKGFNALRDLRVLRQTL"
FT   gene            complement(646510..647697)
FT                   /gene="uxuA"
FT                   /locus_tag="RD1_0665"
FT   CDS_pept        complement(646510..647697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="RD1_0665"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30363"
FT                   /db_xref="GOA:Q16CD0"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CD0"
FT                   /protein_id="ABG30363.1"
FT                   /translation="MKQCWRWFGPADKIALPDLHQVGVQGIVSALHDILPGALWTPEAI
FT                   RQRQDMLHQQGFDWTVVESLPVSESIKTQSPQMADHLLAYKKSLRNLAAAGISTICYNF
FT                   MPILDWTRTELRAKQPHGGTAMLFCFLDFAVFDLHILQRDGATADYSQELQEMAAQRFA
FT                   DLTDAQRVALQNNIVAGLPGSNDKWTTDDVRAHLATYQDISPTQLRQNLIDFLSEVCPV
FT                   AEELGLRLCCHPDDPPFSLLGLPRIMSSTDDYAHILDAVPSPANGATLCTGSLGVAEGF
FT                   DPVEFVSRLGDKIHFVHLRNTKRLPGSDRARPDFFEAAHLEGDTDMVATIKALLAEEQR
FT                   RKAAGRADWEIPMRPDHGQELLSDLGGDSMPGYPLIGRMRGLAELRGIMAAFDAA"
FT   gene            complement(647694..648746)
FT                   /locus_tag="RD1_0666"
FT   CDS_pept        complement(647694..648746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0666"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30364"
FT                   /db_xref="GOA:Q16CC9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC9"
FT                   /protein_id="ABG30364.1"
FT                   /translation="MLNVAILGAGIGAQHLAAYQALPHLFRVVALVDKDQTRAEALRGT
FT                   HDFLITPDWNGVFARPDIDLIDICLPPHLHLPVTLEALAAGKNAICEKPLATSLAGVEQ
FT                   IAQTAKRHNRKVYPVFQYRWGRSCAQLRHLQRADLLGQPLVAALETHWSRDSTYYDVPW
FT                   RGTWAGEQGGAVLGHAIHAHDLLTHFMGPVRAVSAVTTTRVNPIETEDCAALTFEMANG
FT                   ALATSNITLGAATDETRLRFVFEKLTVTSGSNPYAPGTSDWSFMARDPNDQPDIDHALT
FT                   KTPDEASGFTGFLAAIADDLAGRPSGAVSLADGAASIELVSAVYHSARSGARVSLPLSS
FT                   AHPLFNGWIP"
FT   gene            complement(648748..649749)
FT                   /locus_tag="RD1_0667"
FT   CDS_pept        complement(648748..649749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0667"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30365"
FT                   /db_xref="GOA:Q16CC8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC8"
FT                   /protein_id="ABG30365.1"
FT                   /translation="MSVKFVAIGLDHRHIFGMTQNMLDAGAQCLGFWTEGTLHSLEGFR
FT                   KRFPHLTRFETLDAALASGADLALIAAIPADRAALAIQCMQRGMDVMTDKPGCTTMAQL
FT                   DDLRSTVRDTGRIWSINFSERFEVPAVTRASTLVAEGAIGRVVHTAGLGPHRLNKETRP
FT                   DWFFDRGRYGGILTDIASHQIDQFLHFTGSTEAEVTHAFVANHANPAHPGLQDFGEITL
FT                   KSDQGTGSIRVDWYTPHALPTWGDGRLTILGTEGYIELRKYVDVGGSAGTDHLILVTGD
FT                   RCEKIDASDAGLPYFGQLLNDIENRTETAMTQAHCFKVMELALQAQALAEGA"
FT   gene            complement(649746..650783)
FT                   /locus_tag="RD1_0668"
FT   CDS_pept        complement(649746..650783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0668"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30366"
FT                   /db_xref="GOA:Q16CC7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC7"
FT                   /protein_id="ABG30366.1"
FT                   /translation="MKNAVLIGLGMVADTHLTAFRDAETVYLSGIMGRDPEKARAYGRH
FT                   AAEVLGRAVKTYQNADEVAADPGVDFVVIATPPDARRDLIAPLVRAGKPILMEKPVERT
FT                   LEAAQDIVTLCADHAVPLGIVFQHRARAASQALKQALDQGKLGDITNAEIRVPWWRDQD
FT                   YYDAPGRGTYARDGGGVMMSQAIHTLDLALWLLGPFSKVCAHMHQTALHRLEAENWAGA
FT                   LFETAGGCVGTLTATTSAFPGTAETISLHGTKASAHLESGVLTIAHLDGETETHGASAT
FT                   TGGGADPMAFTHAWHQSVIEDFALAITDQRAPMATGKQALMAHAVIDAMERSGKLRSWE
FT                   KVAQV"
FT   gene            complement(650780..651661)
FT                   /gene="kdgK"
FT                   /locus_tag="RD1_0669"
FT   CDS_pept        complement(650780..651661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="RD1_0669"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30367"
FT                   /db_xref="GOA:Q16CC6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC6"
FT                   /protein_id="ABG30367.1"
FT                   /translation="MTRIACVGEAMIELSILGQTSQVGVAGDTLNTAIYLKRNAPQFSV
FT                   DYVTCLGDDPFSDQIEDFIAAQAIGTGAVTRLTGKSPGLYAITTTEDGERSFTYWRSAA
FT                   AARDLFQTGAGYDFAILEAYDLVYLSGISVAILPDAARSALVEWLGRTPIKLAYDSNYR
FT                   PRLWEDKPTAQRVTSALWERADICLPSIDDEMLLFDEDAAAVEARFTRYHGTGALKRGA
FT                   DGPISLGDAVSQAYGAAPHVLDTTAAGDSFNGAYLAALLAGGSQAQALRAGHDCAAQVV
FT                   QYRGAIIPKAAP"
FT   gene            complement(651658..652542)
FT                   /locus_tag="RD1_0671"
FT   CDS_pept        complement(651658..652542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0671"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30368"
FT                   /db_xref="GOA:Q16CC5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC5"
FT                   /protein_id="ABG30368.1"
FT                   /translation="MAVAARAIEDRPQLGILMMLVAWYFFAMVDVSAKWLALAGYPAFQ
FT                   LVFMRYAGHLVISVGMIAKDGMALDRFRTDHIWLVLSRALLLISATLGNFYALSYLPLT
FT                   IISAIMFSSPIIVCFLSMTILKEQIGPWRWGAILLGFAGVLIVIRPFGETFHPAMILPL
FT                   YNATALALYSLMTRRLAGIVATETQQLYLGALGTMLTLPFALWFWIPPQSLLDTALLVG
FT                   LGVMGWGGHQLLTNAHRFAPANTLMPYTYSFMIYIAAFSWLIFGDVPDFWVVVGALVIV
FT                   ASGLVIWKREQRK"
FT   gene            complement(652543..653430)
FT                   /gene="garR"
FT                   /locus_tag="RD1_0672"
FT   CDS_pept        complement(652543..653430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garR"
FT                   /locus_tag="RD1_0672"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30369"
FT                   /db_xref="GOA:Q16CC4"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC4"
FT                   /protein_id="ABG30369.1"
FT                   /translation="MTKPTIGFIGLGLMGGAMVGRLQDQGYTLTVLGNRDRTHLDAAIA
FT                   RGATEAASAKEVAAASDIIMLCMGTSDHVESRMRGEDGVIAGLKPGAVVIDFGTSLPAS
FT                   TRALGTEVAEADGTYLDAPLGRTPSHAKDGLLNIMCSGDKTAFDKVEGVLKDLGENVFH
FT                   LGALGSGHTIKLINNFFGMTVANAMAEAFAMADIAGVNRKELYDVMAAGPLHSGMMDFV
FT                   KGYGVDGDPNLLAFAIKNAAKDVGYYSKMADDAGVKSMMSQCALSALTEARDTGRGDDM
FT                   VSQMVDFFAVKYSG"
FT   gene            complement(653443..654321)
FT                   /locus_tag="RD1_0673"
FT   CDS_pept        complement(653443..654321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0673"
FT                   /product="phytanoyl-CoA dioxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30370"
FT                   /db_xref="GOA:Q16CC3"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC3"
FT                   /protein_id="ABG30370.1"
FT                   /translation="MLSPEQVTRYNDRGYLVVENQIPPEWITQLRDEITRFETEAAGMT
FT                   QSNDRLDLEDTHTPAEPRLRRVKLPHMISDVVRDLMVSDHILGPARDLIGPDLRLHTTK
FT                   LNMKSAGYGAAVEWHQDYAFYPHTNDDILAIGVLIDDMAAENGPLMVYPESHKGPVYDH
FT                   HVDGVFAGAMLPEDNGLNPDDAVQLTGPAGSISIHHGRIVHGSALNTSDRPRRILFFEM
FT                   MAADAFPIMGSMTRWDGIEDYDTRMLCGQPTKNPRLKNIPVRIPQPQPDVPISIYEIQK
FT                   GMKKRAFDTAK"
FT   gene            complement(654308..655330)
FT                   /locus_tag="RD1_0674"
FT   CDS_pept        complement(654308..655330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0674"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30371"
FT                   /db_xref="GOA:Q16CC2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC2"
FT                   /protein_id="ABG30371.1"
FT                   /translation="MKKVLIVGGGLIGARHVQTVKDHPRCTLVGLVDPNPDIKTGEGIP
FT                   RFEDMAQVTTPVDGVILATPTDLHSAQGQYAAEHGWHMLIEKPVAGDMGAARALGDAVQ
FT                   QAGVGSLVGHHRRYHASVQQLKHLLTEGAIGTPVTLSMIWAMRKPDAYFDGNWRTAGGS
FT                   PVLINLVHDIDTLRFVVGEIVATAALRGRGLRGETRIESGAIALAFEDGATGTISFADT
FT                   TPSPWGFEAATGENPNIGTTGQDMLRISGTDGAVSFPSMTLWQGTDWGKSARQKPLVRA
FT                   DNTKPPLDAQLDHFLDVMDGAAPLIDVADATRTLEIALAIEDQLAAQTTGDGHARSALA
FT                   "
FT   gene            complement(655327..656835)
FT                   /gene="garD"
FT                   /locus_tag="RD1_0675"
FT   CDS_pept        complement(655327..656835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="RD1_0675"
FT                   /product="D-galactarate dehydratase, putative"
FT                   /EC_number="4.2.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30372"
FT                   /db_xref="GOA:Q16CC1"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC1"
FT                   /protein_id="ABG30372.1"
FT                   /translation="MEIVRLDPSDNVVTATRALEVGVEIGGATTNALIPSGHKIATQAI
FT                   PKGDAIRKYAQIIGYAIEDIAAGDHVHTQNVEFRNTDADYEFSTDQRPVTPVPEAERDT
FT                   FMGFRRENGAVGTRNYIAIVTSVNCSATAARMIANHFTPEVMAAYPNVDGVAAFVHGTG
FT                   CGMAGDGDGFEALQRVMWGYARHPNHAGVLMVGLGCEMNQIDWLLEAYGLKQSKTFQVM
FT                   NIQSVAGLRKTIEMGIQKIEAMLPIANQATRTQCPASELMVALQCGGSDAWSGITANPA
FT                   LGHACDLLAAQGGTGVLAETPEIYGAEHLLTRRAIDRATGEQLVGLIKWWEDYTARNKG
FT                   TMDNNPSPGNKAGGLTTILEKSLGAAAKGGTSPLMGVYKYAEPVRARGFTFMDSPGYDP
FT                   ASVTGQIAGGCNLVCFTTGRGSAFGSKPSPTIKVATNSAMAKRMSEDMDVDAGTILTEG
FT                   ISVEEKGREIYEMFLRVASGEATKSEAQGLGDYEFVPWQIGAVM"
FT   gene            complement(656847..657797)
FT                   /locus_tag="RD1_0676"
FT   CDS_pept        complement(656847..657797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0676"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30373"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CC0"
FT                   /protein_id="ABG30373.1"
FT                   /translation="MLTPEQIETFETRGYLVVPDVIPTDVLNRVKTEYAARLDDLYTGW
FT                   FEQGRVSTPPGRLDFWGKLIEAYRAKCDWFQPLDISLPGDKIKADTPFHFGPAVFDLLR
FT                   EPRLLDVVESLLGPELTSNPIQHVRLKPPATDLQSDEIRAHITATDWHQDRAVALEEAD
FT                   ETRMVTVWIAVTDATIENGCLQVQAKSPDQGILPHCARTQTGIADGFVDEAAAIPLPIK
FT                   AGGVVLFHPLTPHASLTNQTDAFRWSFDIRYNVTGEPTGRSHFPDFVARSRANPDSELR
FT                   DWRVWKAMWEDARARLSDAPHIPIHRWTSDAPFCA"
FT   gene            complement(657813..659435)
FT                   /locus_tag="RD1_0677"
FT   CDS_pept        complement(657813..659435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0677"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30374"
FT                   /db_xref="GOA:Q16CB9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB9"
FT                   /protein_id="ABG30374.1"
FT                   /translation="MDIGTISLVLMLALILLLAIGMPLGLASASLAVLVLVMKFEPTLL
FT                   SNPMSFGEGILTSRPGTGPLYILTQKIYGLLTDYVLISIPLFIFMAALLERSGVAKDMY
FT                   SSLNVWLSGTRGGIAIVTSIMAVIMAAMSGIIGGEVVLLGLIALPQMLRLGYNQNLAIG
FT                   VICASGSLGTMIPPSIVLIIYGLITETSIKALFTASFLPGFMLATFIIIYIIIRTQMHP
FT                   EDAPLPDPVPGDPQGREKGMLFAAFLAVVTAGFTVALFLRAAFFEFTGANAANEGDPFA
FT                   LGTADWLPWFAGVFLLMLALMQFVFGWANTRTGWNMGKGLVAPIVVIGVVMGSIYGGIT
FT                   GITEAAGMGAFAVLVIAILRGEASWDLIWDSLMRTLKSTGTIIWVTIGAAALAGAYTIA
FT                   GGPTYVADFIVGTDLPTMGIILAMMLILLFMGAFMDWVGIVLLIIPVFLPIIRRLPIEE
FT                   IGFIGQLEPQHIAIWFGVVFCMNMQVSFLSPPFGPAAFYLKSVAPPHISLTDIFRGFLP
FT                   FIGIQLCALSVLLIWPNIVTLLL"
FT   gene            complement(659435..660058)
FT                   /locus_tag="RD1_0678"
FT   CDS_pept        complement(659435..660058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0678"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30375"
FT                   /db_xref="GOA:Q16CB8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB8"
FT                   /protein_id="ABG30375.1"
FT                   /translation="MTLLLVPVLFIAGAMTVRRANMEFEHWRSVDRAAMFIGRVTMMLV
FT                   VLLTSVMLYEVFLRYVLERPTLWANELSLWLAGFVFLMAGLYAMQQRSHIRIFLLYDVC
FT                   PRWVQRLFDCITTVLIVMFAFFLVYGSYKQVFENKLYKWETFGTAFDPPIPATLQPLVL
FT                   IMISLVAVQAVLNLISDWNAEPEIHDDTPDEDEIQALKRAVGQD"
FT   gene            complement(660302..661471)
FT                   /locus_tag="RD1_0679"
FT   CDS_pept        complement(660302..661471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0679"
FT                   /product="racemase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30376"
FT                   /db_xref="GOA:Q16CB7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB7"
FT                   /protein_id="ABG30376.1"
FT                   /translation="MKITRIISHVLQYEMPEQLGYSQQYYDRRTAHLVEVETDEGITGW
FT                   GECFGPGNIALANKGIVEKVIQPMVLGMDPMDRDVIWHKVYNLMRDHGQKGMPMQSLSG
FT                   VDIALWDIAGKVAGLPLHKMIGGAHRTSVPCYGYGMMLRDEPVDALAARFTDEAAAIRD
FT                   MGFVATKMKTGFGPKPDVALCTAVRKGVGDGYPFMVDANHAYTTSDAFYVGRALDELDA
FT                   YWFEEPIAPEDHAGYAELRRGLSVNISGGEAEFGRWGWRAILENRGLDIAQPEVCALGG
FT                   ISEYLRVLALCHAHFTPVVNHVWGSAIAVAANLQLLAAMPPLPGGLHPWEPMLEFDTTD
FT                   NKFRDDLLTQPLNIQAQVKANAGRVTIPDGPGIGVEPDRDFIAHYALAA"
FT   gene            complement(661543..662565)
FT                   /locus_tag="RD1_0680"
FT   CDS_pept        complement(661543..662565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0680"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30377"
FT                   /db_xref="GOA:Q16CB6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB6"
FT                   /protein_id="ABG30377.1"
FT                   /translation="MNLLKKAASVAAVAALAATTAMTASAQTTTLRIQTHFSPEQLSGQ
FT                   LAAKFIDDVTTMSNGEIQIEMFYSSSVVKSVETFDAAATGILDCDMTGGAYQTGKNPAF
FT                   QFAGDLMGGYQNPYQQMAWLLHGDGKAALNELYNPYGMEFIGWWIPGPESLSSTKPIRN
FT                   VADFKDWKFRSPPGLATKVFANLGASPIVMDFTEIFTALETGIIDGADAANLTNNVGLG
FT                   LYDIAEHTNYPGFHSMPADHLACNKDVWDAMPDHHKRIMEVAMDSLALHNATINEVQNA
FT                   QTAKDLRAKGVNLYEWSAEDLQVYRDAVQKGWTEFATTPEAQALLASHISFLQDMGAMK
FT                   "
FT   gene            662590..662688
FT                   /locus_tag="RD1_0681"
FT   CDS_pept        662590..662688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30378"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB5"
FT                   /protein_id="ABG30378.1"
FT                   /translation="MLLLSRRWPLILNTLAERYAGLTIPAIEFSYF"
FT   gene            662762..663439
FT                   /locus_tag="RD1_0682"
FT   CDS_pept        662762..663439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0682"
FT                   /product="transcriptional regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30379"
FT                   /db_xref="GOA:Q16CB4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB4"
FT                   /protein_id="ABG30379.1"
FT                   /translation="MFDRDIYSDLQHRLITNDFDHGEKLRAEQLKRDYGCSASTVREAL
FT                   FRLSTEGLVDFQEQRGFRVPEKSAAVLAELTHIRILLEGEGTVLSIRQGGVAWEARLTA
FT                   AHHQLSHIEKRIHASEDPTDLVPLWFQAELEFHQTLISACDSATLKAMHVQVYRRFRQQ
FT                   LMIADRSFDFISKNIQHHHAIMVAALDGNEDLTRQKIHDHLARHLGGAFSAQAAQRFKS
FT                   SAM"
FT   gene            complement(663412..664383)
FT                   /locus_tag="RD1_0683"
FT   CDS_pept        complement(663412..664383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30380"
FT                   /db_xref="GOA:Q16CB3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB3"
FT                   /protein_id="ABG30380.1"
FT                   /translation="MTRVLIIGGGGMVGQKLAHRLATSGLAGAQDLDVTLFDMGFPPTS
FT                   APGVQITGNLTDAAAIQTLATQRFEVIFHLAAIVSGEAETDFDKGWAVNMMSMWHLLKA
FT                   LRSEHNATGGAYVPRVVFTSSIAVFGGPFPDRIDDEFLSAPQTSYGAQKASCELMLSDF
FT                   SRKGFVDGMSLRFPTICVRPGKANLAASSFFSGIIREPLNGQEAILPVPDTVRHWHASP
FT                   RSAAGFLVHAAGLDTNRLGGRRALNLPGISCTVAEQIEALRRVAGQKVVDLIVPRPNAD
FT                   IAKIVEGWPRDFNPARAEALGFKAEASFDEIIEIYIAEDLNR"
FT   gene            complement(664380..665267)
FT                   /gene="glxR"
FT                   /locus_tag="RD1_0684"
FT   CDS_pept        complement(664380..665267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR"
FT                   /locus_tag="RD1_0684"
FT                   /product="2-hydroxy-3-oxopropionate reductase, putative"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30381"
FT                   /db_xref="GOA:Q16CB2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB2"
FT                   /protein_id="ABG30381.1"
FT                   /translation="MAQSRKITLIGTGLMGVPMARNLLKAGHDVTVWNRTAARAQPLVA
FT                   DGAKLAADAVQAVQGAEFVITMLSDGYATGALVDDPAIQAALSPGAIWIDMSSTKPEHA
FT                   RAQHATLTALGFGHLDAPVSGGTKGAQDATLAIMVGGKAETFEAARAVFEAMGRPVHVG
FT                   PSGTGQLSKLANQTIVAVTISAVAEAMLLVEQGGADPAAVRAALKGGFADSTILQQHGE
FT                   RMTKGDFEPGGLTKFQIKDLNNTLDEAASLGLTLPATETVRDRFQHFSDAMGGAEKDHS
FT                   GLYLELKQRNGLAT"
FT   gene            665467..666228
FT                   /locus_tag="RD1_0685"
FT   CDS_pept        665467..666228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0685"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30382"
FT                   /db_xref="GOA:Q16CB1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB1"
FT                   /protein_id="ABG30382.1"
FT                   /translation="MPGQRLKGKRALVTAAGQGIGRASALAMAEEGAQVFATDIDMDAL
FT                   STIREANHENIEIFELDARSDDSVAAGVERARPDVLFNCAGFVHHGTILDATDGDWDFA
FT                   FDLNVRSMLRTIKAALPGMLNRGVGSIVNMSSACSSVMGAPNRFIYGTTKAAVIGLTKS
FT                   VALDFIDKGIRCNAICPGTVESPSWLERVDALGKQLGSREEALAQFVARQPMGRVASAD
FT                   EIASLVVYLASDESAFTTGHPHIIDGGWSGQ"
FT   gene            666225..668024
FT                   /locus_tag="RD1_0686"
FT   CDS_pept        666225..668024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0686"
FT                   /product="dihydroxy-acid dehydratase, putative"
FT                   /EC_number="4.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30383"
FT                   /db_xref="GOA:Q16CB0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CB0"
FT                   /protein_id="ABG30383.1"
FT                   /translation="MTKKIGIEDLRSRKWFMNPDNPEMTALYLERYLNYGLTRGELQSG
FT                   KPIIGIAQTGSDLSPCNRHHLELTKRVRDGIIAAGGTCIEVPVHPIQETGKRPTAMLDR
FT                   NLAYLSLVETLFGYPLDGVVLNIGCDKTTPALLMAAATVNIPAIALSVGPMLNGWFKGE
FT                   RTGSGTIVWKAREMLAAGEIDDDGFMELVASSAPSVGYCNTMGTATTMNSLAEALGMQL
FT                   PGSAAIPAPYRERGQISYETGRRIVDMVWEDLRPSQIMTREAFENAIVINSAIGGSTNA
FT                   PIHLNGIARHLGVPLDNNDWQKLGHDVPLLVNLQPAGEYLGEDYSHAGGVPAVVGELMA
FT                   EGMLPHPDVITVNGKTMGENCADMRSADTKVIKTVADPLKAQAGFINLTGNLFDSAIMK
FT                   TSVISESFRAKYLSNPEDPNAFEGRAVVFDGPEDFHNRIDDPAEAIDENCILFMRGAGP
FT                   KGYPGGAEVVNMRPPSYLIKQGVEALPCVGDGRQSGTSGSPSILNASPEAAAGGGLALL
FT                   QNGDPVRIDLQKCTANSLVPLDELAERARLFEANGGYDAPESQSPWQQYFREKVGRFDE
FT                   GMILEDADKYQDISRRFMPRDNH"
FT   gene            668058..668906
FT                   /locus_tag="RD1_0688"
FT   CDS_pept        668058..668906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0688"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase,
FT                   putative"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30384"
FT                   /db_xref="GOA:Q16CA9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA9"
FT                   /protein_id="ABG30384.1"
FT                   /translation="MKLVRYGDAGAEKPGMLDAEGALRDLSGHVDDIAGDVLSDAGLDK
FT                   LRAIDPTSLPVVDGSPRIGPCVGNIGKFMCIGLNYSDHAAETGAAIPEHPILFFKANSA
FT                   VVGPNDDVSMPRGSTHTDWEVELGVVIGTTAKYVSKENALDHVAGYCVINDVSERHFQT
FT                   QLTGQWTKGKSCDTFGPTGPWLVTRDEVADPQALDMWLDVNGKRMQTGTTSTMIFTVAE
FT                   IIEHLSGLMTLHPGDVITTGTPPGVGMGIKPEPVYLKKGDVMELWIEGLGTQRQTVTED
FT                   A"
FT   gene            668907..669836
FT                   /locus_tag="RD1_0689"
FT   CDS_pept        668907..669836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0689"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30385"
FT                   /db_xref="GOA:Q16CA8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA8"
FT                   /protein_id="ABG30385.1"
FT                   /translation="MPDLLQIGGVTDVMRERLEAAFTIHKLADGAYPAEAITHIATNGH
FT                   DGVPADVMSALPNLKMISCYGVGYDAVDVTVAKARGIVVTHTPNVLNGEVATTAVMLMM
FT                   ACYRELLRDDAWVRSGDWEAKGNAPLTRSVDNQTVGILGLGRIGQAIADKLAPFGTTIV
FT                   YHSRTQKDVAYQYYADLTEMAANVDCLICITPGGPATNKIVNKDVLDALGPKGTLINVS
FT                   RGSVVDEAAMIAALQEKRLGWAGLDVFEAEPKVPQALRDLPNVVLLPHVGSATVETRAA
FT                   MGALTVDNLLQHLSDGSTVSPVPECADM"
FT   gene            669838..670938
FT                   /locus_tag="RD1_0690"
FT   CDS_pept        669838..670938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0690"
FT                   /product="racemase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30386"
FT                   /db_xref="GOA:Q16CA7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034382"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA7"
FT                   /protein_id="ABG30386.1"
FT                   /translation="MSRIATVQARLFNVPLDEVLVDAKHGSHSHFHLITATITLEDGRQ
FT                   GTGYTYNGGRGGHATAAMITHDLAPFLIGKYAQDVEALNDAMQWHMHYVGRGGIVSFAI
FT                   SAVDIALWDLRCKAHGAPLWQLAGGVDNSCKAYGGGIDLAFPLPKLLTHVQGYLDAGLN
FT                   AVKIKVGQPDMADDIARIRAVRRHIGPDADFMIDANYALTVEQAITLANAVKDQNILWF
FT                   EEPIIPDNYPGYAQITKATGMAVAQGENLHTIHEFEMAVAQSDLGFIQPDASNCGGITG
FT                   WLQVAALTEQSGIALCSHGMQELHVSLVSAQAHAGWIEVHSFPIDRYTMRPLVIEDARA
FT                   VAPDESGIGVTFDWQRLQAFEVVQPA"
FT   gene            complement(670935..671588)
FT                   /gene="chrR"
FT                   /locus_tag="RD1_0691"
FT   CDS_pept        complement(670935..671588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrR"
FT                   /locus_tag="RD1_0691"
FT                   /product="anti-sigma factor ChrR"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30387"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA6"
FT                   /protein_id="ABG30387.1"
FT                   /translation="MTDTIKHHLNDAILMAYSAGTLPEAFNLMVAAHLSLCDSCRAQAE
FT                   SFDALGGALLEQSADTEMDNNSFANTMDLIAGGDIDVTMPAAKTTPGVLPKPIQDYVGG
FT                   DLDSIKWKPIGMGVKQAILPTSKDATARLLLIPAGTAMPDHGHKGTEMTMVLKGAFQDD
FT                   DGYFARGDVEIADSDLHHTPVADIHEDCICLAVADAPLEFDRLLPKIAQRFLRI"
FT   gene            complement(671596..672252)
FT                   /gene="rpoE"
FT                   /locus_tag="RD1_0692"
FT   CDS_pept        complement(671596..672252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="RD1_0692"
FT                   /product="RpoE"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30388"
FT                   /db_xref="GOA:Q16CA5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA5"
FT                   /protein_id="ABG30388.1"
FT                   /translation="MCANLTIQPDTASPFQLVGPGTSGHLKVVKTGREQVTSSEPSKRM
FT                   LWVSHMTRIRDDQDRAAFAELFDHFAPRVKGFLIKSGADSTLAEECTQDVMATLWHKSH
FT                   QFDPSRASVATWIFTIARNRKIDLLRRNRRPEPEDLTWGPEAEPDQAEVLGLQQESEIL
FT                   VSALAALPPAQRELIEKAYFGDLTHSEIAAQTGLPLGTIKSRIRLALDRLRHAMK"
FT   gene            672406..673704
FT                   /locus_tag="RD1_0693"
FT   CDS_pept        672406..673704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0693"
FT                   /product="dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30389"
FT                   /db_xref="GOA:Q16CA4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA4"
FT                   /protein_id="ABG30389.1"
FT                   /translation="MPAYTPPQNQTKVAIIGAGISGLGAAHMLSKTHKVTLFEAEDRLG
FT                   GHARTKMAGKRGDQPVDTGFIVFNYANYPYMAALFEQLDVPVVKSNMSFGASIDGGALE
FT                   YALTSLDALFAQRRNAVHPAFLRMVRDIFKFNKHAITVAQDESLTLGEFLDKMGTGPWF
FT                   RDYYLLPLSGAIWSTPVEKIMDFPAYALIRFFENHALLNTTGQHQWYTVQGGSTQYVRR
FT                   LENALLAQGVEMRLGAAVQSVRRVGGKVFIRPWGGEEEAFDHVIMATHSDDSLKMLADP
FT                   SAQETAALDAVAYQPNDIVLHADASIMPKRKKTWASWVYTEDKDALSDRIDLTYWMNSL
FT                   QPIPHDDPHFVTLNTKRTIREELIYDQATLRHPVYDLAALTAQKEVADFNGAQNTWFCG
FT                   AWMKNGFHEDGLSSAVDVVRKLRSNEQMKVAAE"
FT   gene            673701..674459
FT                   /locus_tag="RD1_0694"
FT   CDS_pept        673701..674459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30390"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA3"
FT                   /protein_id="ABG30390.1"
FT                   /translation="MTLGIDHISGLTYHGRKGAISNAFRYSVDYVLLDAEAEVKTPWLF
FT                   SRNGRGFTGLKDLDHGGAPGQGRGASWVREVLGQHQIRDVETIELLAQPRVLGHVFNPV
FT                   SFWLCRRSDGALITVIAEVSNTFGDRHSYLCAHSDQRPIEPSDTLQATKIFHVSPFQPV
FT                   EGGYKFRFDVTDARIGIWIDYARPDGGLIATLTGHRKPLTNGAILRAAFRRPLGARRVL
FT                   ALIHWQALKLWIKGAIYRGRPKPPSKEVSR"
FT   gene            674459..675688
FT                   /locus_tag="RD1_0695"
FT   CDS_pept        674459..675688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0695"
FT                   /product="sodium:galactoside symporter family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30391"
FT                   /db_xref="GOA:Q16CA2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA2"
FT                   /protein_id="ABG30391.1"
FT                   /translation="MQKTQRLPAYSLFAALLAAAGLPIYIHAPKFYLDEYGVSLAALGA
FT                   VLFGLRLLDVVQDPLLGKLAEKTRTQRRTYVSIAALIMAVAMVALFAVPPLLPPLVWFG
FT                   LCLTFVFSAFSFLTINFYAQGVIKADAMPGQGHLRLARWRESGALTGVCVASVAPVALG
FT                   AAMNAPFAGFAIGFCVLGLAAVWAMREEWSTAGVAASTGFATVLKDPLARRLLLIAMVN
FT                   AAPVAVSSTLFLFFVESKLAAPGFEGPLLLLFFLSAALAAPVWSALAERFGPRNVLLLA
FT                   MGLAIAAFGLTLTLGPGDWVLFALICLASGATLGADLTLLPAIFASRMAQISPSASEGF
FT                   GLWSFVSKLTLAFAAVTLLPLLERAGFQSGSLQNPPEALALLTLLYAAVPCALKLIAIA
FT                   LLVMTDLKEA"
FT   gene            675698..676252
FT                   /locus_tag="RD1_0696"
FT   CDS_pept        675698..676252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0696"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30392"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA1"
FT                   /protein_id="ABG30392.1"
FT                   /translation="MWFYILIGALLAFTLVWMRRTFWSFTAQTPEDYEDENPAFDVREH
FT                   LNGPILCEGVIYGPLGRVSSRFVADFDASWEGNTGVMKERFVYDDGTVQDREWHLTLGN
FT                   DGKIRALASDVVGEGQGRQSGSTVLLKYDIRLPEASGGHVLNTVDWMYLTPNGTIMNRS
FT                   QFRKFGIKVAELVATMRPKEA"
FT   gene            676252..676983
FT                   /locus_tag="RD1_0697"
FT   CDS_pept        676252..676983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0697"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30393"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16CA0"
FT                   /protein_id="ABG30393.1"
FT                   /translation="MRDWKGKRYWLVGASDGLGAALALKMSRAGAHVILSARSADKLAA
FT                   VAENLPNEASVQVVDVSDDASVDQAANAIGQIDGVVYLAGVYWPFAAQEWDAEKATAMA
FT                   DINFTGLVRVMGRIVPQFVSRGAGHVVITGSLSGFRGLPGSIGYTASKAGTMSLAECMY
FT                   ADLRGSGVDVQVSNPGFIKTQLTDKNDFSMPFIMTPDEAADHMFRHMNTKRFKNSFPTL
FT                   FSWVFRGSQFLPDWLYFRIFS"
FT   gene            complement(676987..678039)
FT                   /locus_tag="RD1_0698"
FT   CDS_pept        complement(676987..678039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0698"
FT                   /product="saccharopine dehydrogenase, putative"
FT                   /EC_number="1.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30394"
FT                   /db_xref="GOA:Q16C99"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR027281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C99"
FT                   /protein_id="ABG30394.1"
FT                   /translation="MTHLWVRAEQRDNETRVGLTPDGARQLIASGITLTVEQSPTRVIP
FT                   DAAYAATGCTMAPAHSWPDAPKDAIIFGLKELPEDGTPLPHRHIMFGHAFKGQPAGRVL
FT                   LQRFKAGGGTLLDLEYLVDDQNRRVAAFGYWAGYAGAAVALKCWAAQQRGSIAGPVTPH
FT                   DSSTHLLADLQSDLLATGTHRPTALIIGALGRVGTGVFDLCTAMGVACTKWDMAETTGG
FT                   GPFPEVLAHDLFFNCVLARPGTPVFVPAQTADAARRLSVIADIACDPDSDFSPIKVYDR
FT                   TTTWAEPARRVHDQPMLDVTAIDNLPSLLPLESSQDYAAQLLPTLMSLKDNSAIWQRAA
FT                   TTYRTHRDRL"
FT   gene            complement(678036..678656)
FT                   /gene="gst"
FT                   /locus_tag="RD1_0699"
FT   CDS_pept        complement(678036..678656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="RD1_0699"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30395"
FT                   /db_xref="GOA:Q16C98"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C98"
FT                   /protein_id="ABG30395.1"
FT                   /translation="MRLYYSPGSIAVAVAITLYEAQLPFEPVKVSFADAEQTKAPYLGL
FT                   NPKGRVPTLDTGGNLLTETGAILEYIAALAPQAALVPQDPLKAAHMRAVMYYLASTMHV
FT                   NHAHRLRGNRWADHPESLADMAARATLNMTQNARYVEDHCLKGDFVTGDRLSLADPYLF
FT                   VVCSWLEGDGVRLDDFPKITAFDKRMRARDGVRQAVKAGMLPA"
FT   gene            complement(678667..679320)
FT                   /locus_tag="RD1_0700"
FT   CDS_pept        complement(678667..679320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0700"
FT                   /product="phosphoglycerate mutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30396"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C97"
FT                   /protein_id="ABG30396.1"
FT                   /translation="MSHITLIRHGQANSGATDEQSYDKLSTLGHQQSAWLGAHLKAQNQ
FT                   HHARLFTGTLRRHVETEAAMQMGLTPIRDARLNELEYLTLARAMEKEHGVPFPTDQAGF
FT                   TTHLPMLFAAWQRDEIAGAPERFCEFEARISDVLREIAEGDGPALVVTSGGLIACAMRQ
FT                   VLRLDIGAMAQLALAIYNTSQHRLFPIGGQLSPTMFNAIPHLEDPSRHFAQTHV"
FT   gene            679438..679563
FT                   /locus_tag="RD1_0701"
FT   CDS_pept        679438..679563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30397"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C96"
FT                   /protein_id="ABG30397.1"
FT                   /translation="MLENCRAIDVEDSVFDPDGLARVFEILAPSQSGGGQMKLKS"
FT   gene            679654..681624
FT                   /locus_tag="RD1_0702"
FT   CDS_pept        679654..681624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0702"
FT                   /product="putative AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30398"
FT                   /db_xref="GOA:Q16C95"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C95"
FT                   /protein_id="ABG30398.1"
FT                   /translation="MNTVPTQVDGPQSVPALLHRNAKEFADAPAYREKEYGIWQSWTWA
FT                   ETLEEVEALALGLVDLGVQEGDFIAVIGRNRPRLYWAMIAAEMVGAVPVPLYQDAVAEE
FT                   MAYVLSHCGARFVIVGDQEQVDKVIEIGDQLPSFEQMIYLDPRGLRKYDHSKLHQYTHV
FT                   QDAGRAKRDELLPEITARQAKLNYDSTCVMLYTSGTTGKPKGVVLSNRNVIETSKSSSE
FT                   FDDLRQTDSILAYLPMAWVGDFIFSVGQALWTGFCTNCPESAETMHTDLREIGPTYYFA
FT                   PPRVFETQLTNVMIRMEDAGRFKKWLFDYFMAHARRVGPDILDGQPVNQWDRFKYNIGE
FT                   LAIYGPLKNTLGFSRIRVGYTAGEAIGPEIFDFFRSLGINLKQLYGQTEATVFITAQPD
FT                   GEVRSDTVGVTCPGVELKIAENGEVFYRSPGVFVEYFKNPESTADTKDAEGWVATGDAG
FT                   FIEEDTGHLRIIDRAKDVGKMADGSLFAPKYAENKLKFFPNILEAVVFGNGRDECTAFI
FT                   NIDLTAVGNWAERNNIGYASYQELARHPQVMGMIQEHVEEVNASVAEDVMLSGCQVHRF
FT                   VVLHKELDADDGELTRTRKVRRRIIEEKYADIIAALYDGSPEVSTVTEVTYEDGRKGSI
FT                   SATLEVRVAAVHPVGARMAAQ"
FT   gene            681662..682480
FT                   /locus_tag="RD1_0703"
FT   CDS_pept        681662..682480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0703"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30399"
FT                   /db_xref="GOA:Q16C94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C94"
FT                   /protein_id="ABG30399.1"
FT                   /translation="MKDTIDGYVTEDGRRIGPVVMEMKNITLRFGGVEAIKDISFDIRE
FT                   GEIRAIIGPNGAGKSSMLNVISGFYVPQEGQVFYKGAQRPAMKPYQVARQGIARTFQNI
FT                   ALFEGMSVLDNVMTGRLTHMKTNIWRQAIWRGKAEAEETENREVAEKIIDFLEIQAIRK
FT                   TPVSRLPYGLKKRVELARALAAEPSLLLLDEPMAGMNVEEKEDMSRFILDVNDEFGTTI
FT                   ALIEHDMGVVMDLSDRVVVMDYGKKIGDGTPDEVRNNQAVIDAYLGVAHD"
FT   gene            682582..683571
FT                   /locus_tag="RD1_0704"
FT   CDS_pept        682582..683571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0704"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30400"
FT                   /db_xref="GOA:Q16C93"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C93"
FT                   /protein_id="ABG30400.1"
FT                   /translation="MPEQLLWTAEVFLNGLMAGVLYALVALGFVLIYKASGIFNFAQGV
FT                   MALFAAMTLYGIMNGQVPFAHLINAIFGTEIHYFGWNVPALAAIFLTMCVMVLFSWLVQ
FT                   RYIFRFLVGQEPIILFMATIGLAYFLEGVGDLMWGSDIKTLEVGLPQGINETIDAVTFE
FT                   AFGYGFFIDNLDIVASVVAAILVLGLVLFAQYTKQGRAMRAVADDHQAALSVGVSLNFI
FT                   WILVWSLAGFVALVAGIMWGAKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIG
FT                   VGEKLFEFLIGQPYLGGATENWFAYMLALVFLLFRPQGLFGEKIIERV"
FT   gene            complement(683602..683940)
FT                   /locus_tag="RD1_0705"
FT   CDS_pept        complement(683602..683940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30401"
FT                   /db_xref="GOA:Q16C92"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C92"
FT                   /protein_id="ABG30401.1"
FT                   /translation="MTAVLNEIRNLDARLDRGEITPAEYEAARGQLLQDIEDAESDFID
FT                   ITPAPTARKARRQGSSALGLGLVVCLLVMSLCISLTLLFLPDLNLALTLGVTILAALSV
FT                   ALLQVKDD"
FT   gene            684146..685222
FT                   /locus_tag="RD1_0706"
FT   CDS_pept        684146..685222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0706"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30402"
FT                   /db_xref="GOA:Q16C91"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C91"
FT                   /protein_id="ABG30402.1"
FT                   /translation="MLYREAGDFSTTYPEDSQTFPIRFDRYRYYAVLFIAIVIIPFVIN
FT                   DYWVNSIFMPFLIYSIAAIGLNILVGYCGQVSLGTGGFMAVGAYACYKLMTAFPEVSMF
FT                   IHVLLSGVITAGVGVLFGLPSLRIKGFYLAVATLAAQFFLVWMFNRVSWFYNYSASGQI
FT                   NAPERDTFGIIITGPNTDAWAAYVFCLIFTIASAIIARNLTRGSMGRQWMAIRDMDIAA
FT                   EIIGVNPLKAKLTAFAVSSFFVGISGALFFAIYLGAVEVGEVFGITKSFLVLFMIIIGG
FT                   LGSIFGSFAGAAFLVLLPVLLKVIGVDWFGWPTDIVAHLNLVIVGALIIVFLIVEPHGL
FT                   AQLWRLAKEKLRLWPFPH"
FT   gene            685313..686596
FT                   /locus_tag="RD1_0708"
FT   CDS_pept        685313..686596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30403"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C90"
FT                   /protein_id="ABG30403.1"
FT                   /translation="MKHKIGTWAVAAVMAASPVMADLVFPSLSYRTGPYAANGIPFADG
FT                   YADYFTLLNERDGGIGGVMTRVPECETGYNTEKGVECYESTKGEGALVYQPLSTGITYQ
FT                   LIPKATADGIPVHSMGYGRTSAKDGTVFRNIFNYPANYWDGASFAIKHLLDVNDGSLEG
FT                   KKIALVYHNSAYGKEPIRTLEELSEKHGFELMLLAVDHPGQEQKSQWLQIRRERPDNVI
FT                   MYGWGVMNQVAIQEAANIRFPMENFIGIWWSGSENDVRPAGAAADGYKALAFHNVGSDF
FT                   PVFDDIQKYVVDAGKAAGAGDQIGTVLYNRGLYAAMLAAEAARTAQEIHGVAEITAPMM
FT                   RDGMEALKITEEKMAALGLPGFGPAFEVSCENHGGGGFVAMAQWSGTNDQWTLISDYEQ
FT                   SDQDVIGPLIAEDAAAFAAENNITPGCD"
FT   gene            686729..687556
FT                   /locus_tag="RD1_0709"
FT   CDS_pept        686729..687556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0709"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30404"
FT                   /db_xref="GOA:Q16C89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C89"
FT                   /protein_id="ABG30404.1"
FT                   /translation="MFDAAEGQTENVLEVNNIEVIYNHVILVLKGVSLNVPQGGITALL
FT                   GGNGAGKTTTLKAISGLLASERGEVTKGSIKYRGTVIQHQDPADIVKSGVVQVMEGRHC
FT                   FEHLTVEENLLTGAYTRREGKAAIQRDLEMVYDYFPRLKERRKSQAGYTSGGEQQMTAI
FT                   GRALMSKPETILLDEPSMGLAPQLVEQIFEIVKSVNENEGVTFLLAEQNTNVALRFAHY
FT                   GYILESGRVVMDGPAADLRENPDVKEFYLGMSEQGRKSFRDVRSYRRRKRWLS"
FT   gene            687719..688954
FT                   /gene="paaK"
FT                   /locus_tag="RD1_0710"
FT   CDS_pept        687719..688954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="RD1_0710"
FT                   /product="phenylacetate-CoA ligase, putative"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30405"
FT                   /db_xref="GOA:Q16C88"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C88"
FT                   /protein_id="ABG30405.1"
FT                   /translation="MKKHSDLFFDGLEVRSADERAAHLSRILPQQIARAQALQGYAGRL
FT                   NGYTAGDITDVAALAKLPVLRKSDLGDAQSMHMPFGNFTTKPATGFSHIFQSPGPIYEP
FT                   FDVNHDWFRMGRFLHAVGIGKGDIVQNCFGYHLTPAGAIFESGAHAVGATVLPAGTGQT
FT                   ELQITAARDVGTTAYAGTPDFLKVILDKADAMGVALNITKAAVGGGALFPSLRKEYADR
FT                   GVLCLQCYATADLGNVAYESPAMEGLILDEQVVVEIVTPGTGTPVPEGEVGEVIVTTLN
FT                   PDYPLIRFSTGDLSAFMDGESPCGRTNRRIKGWMGRADQTAKVKGMFVRPEQVASFVDH
FT                   HEEVAKARVVITRANEQDAMTVKVEADDSADATRYASTVVETLKLKATVEIVPMGSLPK
FT                   DGVVIEDQRSYD"
FT   gene            689085..689789
FT                   /locus_tag="RD1_0711"
FT   CDS_pept        689085..689789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30406"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C87"
FT                   /protein_id="ABG30406.1"
FT                   /translation="MATYRFPGLDGRALSPALRIEQAAGDIAGLAAAYPDTPFRLLGFS
FT                   TGAPIAISAAARMRNEVKVAGLSPAVECGGGAETAIRTTRLILNAAWRVRSVRLRRVWL
FT                   AYYRLLLFGTPVLSDQALSTRAAQIIAARADRIVFPEGGLPRAHMADLRRWRLPRDIAF
FT                   EEGRIRFFHGLEDPVFSPEQIRRFAAQLGGVPVTGYEGQGHLMFASHLPVFDDVFAFFE
FT                   GREPGEGGGAGL"
FT   gene            complement(689846..690754)
FT                   /pseudo
FT                   /locus_tag="RD1_0714"
FT   CDS_pept        complement(689846..690754)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0714"
FT                   /note="conserved hypothetical protein"
FT   gene            690832..691650
FT                   /locus_tag="RD1_0715"
FT   CDS_pept        690832..691650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0715"
FT                   /product="putative voltage-gated K+ channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30407"
FT                   /db_xref="GOA:Q16C86"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C86"
FT                   /protein_id="ABG30407.1"
FT                   /translation="MSLPSQPGFELMCAMMRDLKQTMTELYTGSQQRSRRFRFGLILFD
FT                   VFTIILFIAIAPLQATVGLEALGFVLGLLILADFTARLWIASDRREMLLKIYTIADVIV
FT                   ILSLLIAPFIHANLAFLRILRGLRIIHSYHLLRDLRRVSPFFVKHEGAVIAAINLFVFV
FT                   FFTTSVVFALFVERGTGLEGYINALYFTVSTLTTTGYGDITPTTTGGKLLAVVIMVVGV
FT                   ALFVQLARAIIQPPKVQYTCQSCGLTKHDHDAVHCKHCGAVVRIKTEGMV"
FT   gene            691586..692329
FT                   /locus_tag="RD1_0716"
FT   CDS_pept        691586..692329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RD1_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30408"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C85"
FT                   /protein_id="ABG30408.1"
FT                   /translation="MTRYTASTVVPWFASKPKVWYRNLVHKAVLKFTLLSALWLGLLAT
FT                   SGGAEEPRAGLMWNKTGLPAVFPLQVKTAPGQDFMMTLVDAQTHAPALAAFIEGGEFFK
FT                   VLVPPGEYDVRFATGAQWRGEAELFGKDETTLFVLDGPLRFAVMDFATKLGHVIDFTAS
FT                   DDAIMVKAQFICQRFSVAEFARPQPPFDDLEGYATRLTQEGELVQFPNRFAPDRLSAGT
FT                   DDPVIPTDFAPYFSDPAYEVRAFPC"
FT   gene            complement(692586..692660)
FT                   /locus_tag="RD1_0717"
FT   tRNA            complement(692586..692660)
FT                   /locus_tag="RD1_0717"
FT                   /product="tRNA-Val"
FT   gene            692810..693670
FT                   /gene="hutG"
FT                   /locus_tag="RD1_0718"
FT   CDS_pept        692810..693670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="RD1_0718"
FT                   /product="N-formylglutamate amidohydrolase, putative"
FT                   /EC_number="3.5.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30409"
FT                   /db_xref="GOA:Q16C84"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C84"
FT                   /protein_id="ABG30409.1"
FT                   /translation="MLHTAYHICLPARDTSCVVFASPHSGSAYPKDMMRKTVLNDQLIR
FT                   SSEDAFVDRLFDCAPAFGARFIKAAAPRAYVDLNRSPDELDPALIEGVRRQGHNPRVAS
FT                   GLGVIPRVVANGRAIYRGKIAMVDAQERLDRYWHPYHQKLQVLLDDAHRFHGQAVLIDC
FT                   HSMPHEAVESVARSGGTRPDIVLGDRFGAAAAGSVVERVEAAFVAQGFRVARNAPFAGA
FT                   YIAQAYGRPQRGQHAVQVELDRALYMDEKRIRPNSNFEAVRAALRAAVSEIAQIGREPV
FT                   PLAAE"
FT   gene            complement(693673..694926)
FT                   /gene="dinB"
FT                   /locus_tag="RD1_0719"
FT   CDS_pept        complement(693673..694926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="RD1_0719"
FT                   /product="DNA polymerase IV, putative"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30410"
FT                   /db_xref="GOA:Q16C83"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C83"
FT                   /protein_id="ABG30410.1"
FT                   /translation="MPTLCRDCFSLFDHGQRCPACNSPRRIAHAELNELSIAHMDCDAF
FT                   YASVEKRDNPELEGKPVIIGGGRRGVVSTACYVARIRGVRSAMPMFQALKLCPDAVIIK
FT                   PRMQAYVEASRAIRAMMEELTPAIEPLSLDEAFMDLSGTARLHGAPPAVMLARLVKRMH
FT                   QELGLTGSIGLSHNKFLAKVASDLDKPHGFSIIGKAETAAFLRNKPVRMIWGVGAAGQA
FT                   SLEKAGIRTFSDLLRWDRRDLGARFGSMGDRLWHLARGEDHRRVSAHAPMKSISNETTF
FT                   HDDTSDPELLDGHLWRMAEKVSDRAKAKQLAGRVVTLKLKRADHSLLSRRISLRDGTQM
FT                   ADTIYRTARSLFDQVGDEGPYRLLGCGLSDLIPEDSADLSGDLLDPQAQQRSAAERATD
FT                   KIRDRFGADAILKGRSLR"
FT   gene            complement(695269..696000)
FT                   /gene="pyrF"
FT                   /locus_tag="RD1_0720"
FT   CDS_pept        complement(695269..696000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="RD1_0720"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30411"
FT                   /db_xref="GOA:Q16C82"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C82"
FT                   /protein_id="ABG30411.1"
FT                   /translation="MTDTTTPDDRLIVALDVPNALAGQELAAQIGDAVGFYKIGLGMLT
FT                   GGGLALANELKQEHGKRIFLDMKLFDIGATVEAAVRGLAQFELDFLTVHGDPHVVRAAR
FT                   EGAADSDMKILAVTILTSLDRGDLDHCLIRDGELSDLVQMRADRAFEAGADGVIASPHE
FT                   AALIRALPSATGRLIVTPGVRPAGADLGDQKRVATPANAIADGADHIVVGRPVWKSPNP
FT                   RAAAQAILSELQSPQAHSPNR"
FT   gene            696573..699191
FT                   /gene="clpB"
FT                   /locus_tag="RD1_0721"
FT   CDS_pept        696573..699191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="RD1_0721"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:RD1_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABG30412"
FT                   /db_xref="GOA:Q16C81"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q16C81"
FT                   /protein_id="ABG30412.1"
FT                   /translation="MDLSKFTERSRGFIQAAQTIAARESHQRLAAEHLLKALMDDDQGL
FT                   ASNLISAAGGQPARVLESVDLALGKMPKVTGDAAQVYVDGTTTKVLAEAEQLAKKAGDS
FT                   FVPVERILMALCMVKSGAKTALDAGNVTAQALNGAINDVRKGRTADTATAEEGYDALKK
FT                   YAMDLTERAEAGKIDPIIGRDEEIRRAMQVLSRRTKNNPVLIGEPGVGKTAIAEGLALR
FT                   IVNGDVPESLRNKKLLALDMGALIAGAKFRGEFEERLKAVLTEVTEAAGEIILFIDEMH
FT                   TLVGAGKADGAMDAANLIKPALARGELHCVGATTLDEYRKYVEKDAALARRFQPVMVQE
FT                   PTVEDTVSILRGIKEKYELHHGVRISDSSLVAAATLSHRYITDRFLPDKAIDLMDEAAS
FT                   RLRMEVDSKPEELDAIDRQILQMQIEAEALRLEDDAASKDRLETLEKELAELQERSDAM
FT                   TAKWQAERDKMAGARDLKEQLDHARAELEIAKREGNLGRAGELSYGVIPQLEKQLEAAE
FT                   GRDDGDVMVEEAVRPEQIASVVERWTGIPAGKMLEGERDKLLRMEDQLHGRVIGQNSAV
FT                   RAISNAVRRARAGLNDENRPLGSFLFLGPTGVGKTELTKAVAEFLFDDDNAMVRIDMSE
FT                   FMEKHAVARLIGAPPGYVGYDEGGVLTEAVRRRPYQVVLFDEVEKAHPDVFNVLLQVLD
FT                   DGVLTDGQGRTVDFKQTLIVLTSNLGAQALSQLPDGADASAAKRDVMDAVRAHFRPEFL
FT                   NRLDETIIFDRLGRADMDGIVEIQMARLLKRLAGRKIALE