(data stored in SCRATCH9089 zone)

EMBL: CP000377

ID   CP000377; SV 1; circular; genomic DNA; STD; PRO; 3200938 BP.
XX
AC   CP000377; AAFG02000000-AAFG02000027;
XX
PR   Project:PRJNA13040;
XX
DT   24-MAY-2006 (Rel. 87, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 12)
XX
DE   Ruegeria sp. TM1040 chromosome, complete genome.
XX
KW   .
XX
OS   Ruegeria sp. TM1040
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Ruegeria; unclassified Ruegeria.
XX
RN   [1]
RP   1-3200938
RX   DOI; 10.1128/AEM.02580-06.
RX   PUBMED; 17526795.
RA   Moran M.A., Belas R., Schell M.A., Gonzalez J.M., Sun F., Sun S.,
RA   Binder B.J., Edmonds J., Ye W., Orcutt B., Howard E.C., Meile C.,
RA   Palefsky W., Goesmann A., Ren Q., Paulsen I., Ulrich L.E., Thompson L.S.,
RA   Saunders E., Buchan A.;
RT   "Ecological genomics of marine Roseobacters";
RL   Appl. Environ. Microbiol. 73(14):4559-4569(2007).
XX
RN   [2]
RP   1-3200938
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Goodwin L., Thompson L.S.,
RA   Gilna P., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Belas R., Moran M.A., Buchan A., Gonzalez J.M., Schell M.A., Sun F.,
RA   Richardson P.;
RT   "Complete sequence of chromosome of Silicibacter sp. TM1040";
RL   Unpublished.
XX
RN   [3]
RP   1-3200938
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Brettin T., Bruce D., Han C., Tapia R., Goodwin L., Thompson L.S.,
RA   Gilna P., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Belas R., Moran M.A., Buchan A., Gonzalez J.M., Schell M.A., Sun F.,
RA   Richardson P.;
RT   ;
RL   Submitted (11-MAY-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ced23a6caf2a2bc7972e65ca50c8becc.
DR   BioSample; SAMN02598292.
DR   EnsemblGenomes-Gn; EBG00001251063.
DR   EnsemblGenomes-Gn; EBG00001251064.
DR   EnsemblGenomes-Gn; EBG00001251065.
DR   EnsemblGenomes-Gn; EBG00001251066.
DR   EnsemblGenomes-Gn; EBG00001251067.
DR   EnsemblGenomes-Gn; EBG00001251068.
DR   EnsemblGenomes-Gn; EBG00001251069.
DR   EnsemblGenomes-Gn; EBG00001251070.
DR   EnsemblGenomes-Gn; EBG00001251071.
DR   EnsemblGenomes-Gn; EBG00001251072.
DR   EnsemblGenomes-Gn; EBG00001251073.
DR   EnsemblGenomes-Gn; EBG00001251074.
DR   EnsemblGenomes-Gn; EBG00001251075.
DR   EnsemblGenomes-Gn; EBG00001251076.
DR   EnsemblGenomes-Gn; EBG00001251077.
DR   EnsemblGenomes-Gn; EBG00001251078.
DR   EnsemblGenomes-Gn; EBG00001251079.
DR   EnsemblGenomes-Gn; EBG00001251080.
DR   EnsemblGenomes-Gn; EBG00001251081.
DR   EnsemblGenomes-Gn; EBG00001251082.
DR   EnsemblGenomes-Gn; EBG00001251083.
DR   EnsemblGenomes-Gn; EBG00001251084.
DR   EnsemblGenomes-Gn; EBG00001251085.
DR   EnsemblGenomes-Gn; EBG00001251086.
DR   EnsemblGenomes-Gn; EBG00001251087.
DR   EnsemblGenomes-Gn; EBG00001251088.
DR   EnsemblGenomes-Gn; EBG00001251089.
DR   EnsemblGenomes-Gn; EBG00001251090.
DR   EnsemblGenomes-Gn; EBG00001251091.
DR   EnsemblGenomes-Gn; EBG00001251092.
DR   EnsemblGenomes-Gn; EBG00001251093.
DR   EnsemblGenomes-Gn; EBG00001251094.
DR   EnsemblGenomes-Gn; EBG00001251095.
DR   EnsemblGenomes-Gn; EBG00001251096.
DR   EnsemblGenomes-Gn; EBG00001251097.
DR   EnsemblGenomes-Gn; EBG00001251098.
DR   EnsemblGenomes-Gn; EBG00001251099.
DR   EnsemblGenomes-Gn; EBG00001251100.
DR   EnsemblGenomes-Gn; EBG00001251101.
DR   EnsemblGenomes-Gn; EBG00001251102.
DR   EnsemblGenomes-Gn; EBG00001251103.
DR   EnsemblGenomes-Gn; EBG00001251104.
DR   EnsemblGenomes-Gn; EBG00001251105.
DR   EnsemblGenomes-Gn; EBG00001251106.
DR   EnsemblGenomes-Gn; EBG00001251107.
DR   EnsemblGenomes-Gn; EBG00001251108.
DR   EnsemblGenomes-Gn; EBG00001251109.
DR   EnsemblGenomes-Gn; EBG00001251110.
DR   EnsemblGenomes-Gn; TM1040_R0001.
DR   EnsemblGenomes-Gn; TM1040_R0002.
DR   EnsemblGenomes-Gn; TM1040_R0003.
DR   EnsemblGenomes-Gn; TM1040_R0004.
DR   EnsemblGenomes-Gn; TM1040_R0005.
DR   EnsemblGenomes-Gn; TM1040_R0006.
DR   EnsemblGenomes-Gn; TM1040_R0007.
DR   EnsemblGenomes-Gn; TM1040_R0009.
DR   EnsemblGenomes-Gn; TM1040_R0010.
DR   EnsemblGenomes-Gn; TM1040_R0011.
DR   EnsemblGenomes-Gn; TM1040_R0012.
DR   EnsemblGenomes-Gn; TM1040_R0013.
DR   EnsemblGenomes-Gn; TM1040_R0014.
DR   EnsemblGenomes-Gn; TM1040_R0015.
DR   EnsemblGenomes-Gn; TM1040_R0016.
DR   EnsemblGenomes-Gn; TM1040_R0017.
DR   EnsemblGenomes-Gn; TM1040_R0018.
DR   EnsemblGenomes-Gn; TM1040_R0019.
DR   EnsemblGenomes-Gn; TM1040_R0020.
DR   EnsemblGenomes-Gn; TM1040_R0021.
DR   EnsemblGenomes-Gn; TM1040_R0022.
DR   EnsemblGenomes-Gn; TM1040_R0023.
DR   EnsemblGenomes-Gn; TM1040_R0024.
DR   EnsemblGenomes-Gn; TM1040_R0025.
DR   EnsemblGenomes-Gn; TM1040_R0026.
DR   EnsemblGenomes-Gn; TM1040_R0027.
DR   EnsemblGenomes-Gn; TM1040_R0028.
DR   EnsemblGenomes-Gn; TM1040_R0029.
DR   EnsemblGenomes-Gn; TM1040_R0030.
DR   EnsemblGenomes-Gn; TM1040_R0031.
DR   EnsemblGenomes-Gn; TM1040_R0033.
DR   EnsemblGenomes-Gn; TM1040_R0034.
DR   EnsemblGenomes-Gn; TM1040_R0035.
DR   EnsemblGenomes-Gn; TM1040_R0036.
DR   EnsemblGenomes-Gn; TM1040_R0038.
DR   EnsemblGenomes-Gn; TM1040_R0039.
DR   EnsemblGenomes-Gn; TM1040_R0040.
DR   EnsemblGenomes-Gn; TM1040_R0043.
DR   EnsemblGenomes-Gn; TM1040_R0044.
DR   EnsemblGenomes-Gn; TM1040_R0046.
DR   EnsemblGenomes-Gn; TM1040_R0047.
DR   EnsemblGenomes-Gn; TM1040_R0049.
DR   EnsemblGenomes-Gn; TM1040_R0050.
DR   EnsemblGenomes-Gn; TM1040_R0051.
DR   EnsemblGenomes-Tr; EBT00001596724.
DR   EnsemblGenomes-Tr; EBT00001596725.
DR   EnsemblGenomes-Tr; EBT00001596726.
DR   EnsemblGenomes-Tr; EBT00001596727.
DR   EnsemblGenomes-Tr; EBT00001596728.
DR   EnsemblGenomes-Tr; EBT00001596729.
DR   EnsemblGenomes-Tr; EBT00001596730.
DR   EnsemblGenomes-Tr; EBT00001596731.
DR   EnsemblGenomes-Tr; EBT00001596732.
DR   EnsemblGenomes-Tr; EBT00001596733.
DR   EnsemblGenomes-Tr; EBT00001596734.
DR   EnsemblGenomes-Tr; EBT00001596735.
DR   EnsemblGenomes-Tr; EBT00001596736.
DR   EnsemblGenomes-Tr; EBT00001596737.
DR   EnsemblGenomes-Tr; EBT00001596738.
DR   EnsemblGenomes-Tr; EBT00001596739.
DR   EnsemblGenomes-Tr; EBT00001596740.
DR   EnsemblGenomes-Tr; EBT00001596741.
DR   EnsemblGenomes-Tr; EBT00001596742.
DR   EnsemblGenomes-Tr; EBT00001596743.
DR   EnsemblGenomes-Tr; EBT00001596744.
DR   EnsemblGenomes-Tr; EBT00001596745.
DR   EnsemblGenomes-Tr; EBT00001596746.
DR   EnsemblGenomes-Tr; EBT00001596747.
DR   EnsemblGenomes-Tr; EBT00001596748.
DR   EnsemblGenomes-Tr; EBT00001596749.
DR   EnsemblGenomes-Tr; EBT00001596750.
DR   EnsemblGenomes-Tr; EBT00001596751.
DR   EnsemblGenomes-Tr; EBT00001596752.
DR   EnsemblGenomes-Tr; EBT00001596753.
DR   EnsemblGenomes-Tr; EBT00001596754.
DR   EnsemblGenomes-Tr; EBT00001596755.
DR   EnsemblGenomes-Tr; EBT00001596756.
DR   EnsemblGenomes-Tr; EBT00001596757.
DR   EnsemblGenomes-Tr; EBT00001596758.
DR   EnsemblGenomes-Tr; EBT00001596759.
DR   EnsemblGenomes-Tr; EBT00001596760.
DR   EnsemblGenomes-Tr; EBT00001596761.
DR   EnsemblGenomes-Tr; EBT00001596762.
DR   EnsemblGenomes-Tr; EBT00001596763.
DR   EnsemblGenomes-Tr; EBT00001596764.
DR   EnsemblGenomes-Tr; EBT00001596765.
DR   EnsemblGenomes-Tr; EBT00001596766.
DR   EnsemblGenomes-Tr; EBT00001596767.
DR   EnsemblGenomes-Tr; EBT00001596768.
DR   EnsemblGenomes-Tr; EBT00001596769.
DR   EnsemblGenomes-Tr; EBT00001596770.
DR   EnsemblGenomes-Tr; EBT00001596771.
DR   EnsemblGenomes-Tr; TM1040_R0001-1.
DR   EnsemblGenomes-Tr; TM1040_R0002-1.
DR   EnsemblGenomes-Tr; TM1040_R0003-1.
DR   EnsemblGenomes-Tr; TM1040_R0004-1.
DR   EnsemblGenomes-Tr; TM1040_R0005-1.
DR   EnsemblGenomes-Tr; TM1040_R0006-1.
DR   EnsemblGenomes-Tr; TM1040_R0007-1.
DR   EnsemblGenomes-Tr; TM1040_R0009-1.
DR   EnsemblGenomes-Tr; TM1040_R0010-1.
DR   EnsemblGenomes-Tr; TM1040_R0011-1.
DR   EnsemblGenomes-Tr; TM1040_R0012-1.
DR   EnsemblGenomes-Tr; TM1040_R0013-1.
DR   EnsemblGenomes-Tr; TM1040_R0014-1.
DR   EnsemblGenomes-Tr; TM1040_R0015-1.
DR   EnsemblGenomes-Tr; TM1040_R0016-1.
DR   EnsemblGenomes-Tr; TM1040_R0017-1.
DR   EnsemblGenomes-Tr; TM1040_R0018-1.
DR   EnsemblGenomes-Tr; TM1040_R0019-1.
DR   EnsemblGenomes-Tr; TM1040_R0020-1.
DR   EnsemblGenomes-Tr; TM1040_R0021-1.
DR   EnsemblGenomes-Tr; TM1040_R0022-1.
DR   EnsemblGenomes-Tr; TM1040_R0023-1.
DR   EnsemblGenomes-Tr; TM1040_R0024-1.
DR   EnsemblGenomes-Tr; TM1040_R0025-1.
DR   EnsemblGenomes-Tr; TM1040_R0026-1.
DR   EnsemblGenomes-Tr; TM1040_R0027-1.
DR   EnsemblGenomes-Tr; TM1040_R0028-1.
DR   EnsemblGenomes-Tr; TM1040_R0029-1.
DR   EnsemblGenomes-Tr; TM1040_R0030-1.
DR   EnsemblGenomes-Tr; TM1040_R0031-1.
DR   EnsemblGenomes-Tr; TM1040_R0033-1.
DR   EnsemblGenomes-Tr; TM1040_R0034-1.
DR   EnsemblGenomes-Tr; TM1040_R0035-1.
DR   EnsemblGenomes-Tr; TM1040_R0036-1.
DR   EnsemblGenomes-Tr; TM1040_R0038-1.
DR   EnsemblGenomes-Tr; TM1040_R0039-1.
DR   EnsemblGenomes-Tr; TM1040_R0040-1.
DR   EnsemblGenomes-Tr; TM1040_R0043-1.
DR   EnsemblGenomes-Tr; TM1040_R0044-1.
DR   EnsemblGenomes-Tr; TM1040_R0046-1.
DR   EnsemblGenomes-Tr; TM1040_R0047-1.
DR   EnsemblGenomes-Tr; TM1040_R0049-1.
DR   EnsemblGenomes-Tr; TM1040_R0050-1.
DR   EnsemblGenomes-Tr; TM1040_R0051-1.
DR   EuropePMC; PMC2258615; 18192410.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01727; SAM-SAH.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000377.
DR   SILVA-SSU; CP000377.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634501
CC   Source DNA and bacteria available from Mary Ann Moran
CC   (mmoran@uga.edu)
CC   Contacts: Mary Ann Moran (mmoran@uga.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Comments:
CC   Re: Chromosome Location:3038240, unresolved hard GC stop; Finkit
CC   used with two different primers failed to go through this hard
CC   stop, hairpin not identified, therefore potentially missing bases
CC   here.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3200938
FT                   /organism="Ruegeria sp. TM1040"
FT                   /strain="TM1040"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:292414"
FT   gene            45..1457
FT                   /locus_tag="TM1040_0001"
FT   CDS_pept        45..1457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62734"
FT                   /db_xref="GOA:Q1GKT2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKT2"
FT                   /protein_id="ABF62734.1"
FT                   /translation="MTDDTWGLLRKRLLKTVGQNNFTTWIEPLELDQVDGGVATFHVPT
FT                   NFMGNYVSQNFADLILHEFNKSGEAVQRLAFKVAANSPTRPVQPTMSEAIEEPAPLQTT
FT                   VVDQLGNQEGNTSVKSPPEDLQAAPLDPRFTFDSFVVGKPNELAHAAARRVAEGGPVTF
FT                   NPLVLYGGVGLGKTHLMHAIAWELKERNPELNVLYLSAEQFMYRFVQALRERKMMDFKH
FT                   LFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVK
FT                   SRLQCGLVVDLHPTDYELRLGILQTKVQQNRKNYPDLKIADGVLELLAHRISTNVRVLE
FT                   GALTRLFAFASLVGREIDMDLTQDCLADVLRASERKITVEEIQRKVSEYYNIRMSDIIG
FT                   PKRLRSYARPRQVAMYLCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIEELKTIDGQIA
FT                   EDVEMLRRSLEA"
FT   gene            1739..2860
FT                   /locus_tag="TM1040_0002"
FT   CDS_pept        1739..2860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62735"
FT                   /db_xref="GOA:Q1GKT1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKT1"
FT                   /protein_id="ABF62735.1"
FT                   /translation="MKISIERATLLKAVAQAQSVVERRNTIPILANVLIEAEGSDVMFR
FT                   ATDLDIEVVDKAPAQVERAGATTVAATTLHEIVRKLPDGALVTLDADAASGRLTVEAGR
FT                   SNFSLATLPREDFPVMATSEYHSNFTANAAMLRRLFDKSKFAISTEETRYYLNGVYMHV
FT                   ATGESGGKALRCVATDGHRLARIDADLPMGAEDMPGVIVPRKTVGELRKLLDEDDMDIA
FT                   VSVSETKVRFATPNITLTSKVIDGTFPDYTRVIPVGNTRRLEVDASEFAKAVDRVATVS
FT                   SERSRAVKLQLDEDRLVLSVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEIANQVDR
FT                   ENAVFMFNSSGDPTLMREGSDESAVYVVMPMRV"
FT   gene            2950..4023
FT                   /locus_tag="TM1040_0003"
FT   CDS_pept        2950..4023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62736"
FT                   /db_xref="GOA:Q1GKT0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKT0"
FT                   /protein_id="ABF62736.1"
FT                   /translation="MSHFRSHLRADLHLDTRPVAIHGNNGAGKTNILEAVSLFSPGRGL
FT                   RRASAADMARQPEALGWKLRGVLQSSGQAYEVETSSEVGNARQVKIDNKSASQVALGRI
FT                   ARVVWLVPAMDRLWIEGAEGRRRFLDRIALSFDPDHAEASLSYEKAMRERNRLLKDNVR
FT                   DAAWYRVLEGQMAETGFRIHQARMDAVARLTAAQAEAETAFPVAQLQLVQAEGDMPASA
FT                   EALREMLDAGRMRDLTVGRTLVGPHRSDLIGTFLAKGLPAKDCSTGEQKALLVSLILAN
FT                   ARALQAQEGAAPILLLDEVAAHLDAGRRAALYDEICALGTQAWMTGTGPELFQELGSRA
FT                   QHLTVSDRGGTSEVTLQ"
FT   gene            4020..4640
FT                   /locus_tag="TM1040_0004"
FT   CDS_pept        4020..4640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0004"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62737"
FT                   /db_xref="GOA:Q1GKS9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS9"
FT                   /protein_id="ABF62737.1"
FT                   /translation="MSLSLWDLVIYASAVFVLFLTPGPVWLALVARAMSGGFHAGWPLA
FT                   LGVAIGDVVWPLVAILGVAWITAASAQIALVLKGVAVLVFVLMGLSTIRSAGQPISTNS
FT                   RLTKPGRWAGFVAGVIVILGNPKAALFYMGILPGFFDLSQVTSADIALICAVSMAVPLI
FT                   GNVMLAGFVSQVRVLLSSPVALRRMNLGAGYLLIAVACIIPFT"
FT   gene            complement(4633..5220)
FT                   /locus_tag="TM1040_0005"
FT   CDS_pept        complement(4633..5220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0005"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62738"
FT                   /db_xref="GOA:Q1GKS8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS8"
FT                   /protein_id="ABF62738.1"
FT                   /translation="MGRAPQRRRLETRAKLLTVAAEIIDSHGVSALRVEDVVAQAGVAK
FT                   GTFFSHFGDKDGLLAVILGARVMRYIEDMEDAPAPSSPAEIAQRLAPLLDFISQDRIIF
FT                   DLLLRYSGTTGAEIEEVVTEGFLRQIALFIRWITNMQAKGQISQNGNPELLAEGIQGFL
FT                   NHVLATGFCMEHSNTPPPSKALVPYLEQWLLK"
FT   gene            5336..5929
FT                   /locus_tag="TM1040_0006"
FT   CDS_pept        5336..5929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0006"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62739"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS7"
FT                   /protein_id="ABF62739.1"
FT                   /translation="MSTRKILVLNGHPGQNSLNKSLADAYRRAAEAAGHELRYQDLSQM
FT                   QFDMDFGEGGYHDTKPLEPALQSFVADLEWAEHLVVTTPLWWGAFPAKLKGLFDRALLP
FT                   GQAFDTRNTNAFGVPAPMMTGKTARVMLTSDTPSWFLRLLYGNAIKKIMSRQILGFVGI
FT                   KPVRYTSFAAASHPKPGQADQWLKTVANLGRAAA"
FT   gene            6015..8432
FT                   /locus_tag="TM1040_0007"
FT   CDS_pept        6015..8432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0007"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62740"
FT                   /db_xref="GOA:Q1GKS6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS6"
FT                   /protein_id="ABF62740.1"
FT                   /translation="MSENEQAPAEYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VYEVVDNGIDEALAGHADRVTVTIHADSSVSVSDNGRGIPVDIHAEEGVSAAEVIMTQL
FT                   HAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIWRNGKEHVARFERGDTVKHLTVV
FT                   GDCGDRTGTEVRFLASTDTFSNLEYSFETLEKRLRELAFLNSGVRIVVADERPAERLES
FT                   ELFYEGGVNEFVKYLDRSKTPVMDAPIYIKGEKDDIGVEIAMWWNDSYHETVLPFTNNI
FT                   PQRDGGTHVAGFRGALTRTINSYAQSSGIAKKEKVSFTGDDAREGLTCVLSVKVPDPKF
FT                   SSQTKDKLVSSEVRPVVESLMGEKLAEWFEENPNVAKQVVGKIIEAALAREAARKAREL
FT                   TRRKTAMDVNFLAGKLKDCSEKDPAKTEVFLVEGDSAGGSAQTGRDRQTQAILPLKGKI
FT                   LNVERARFDRMLSSQEIGNLVMALGTGIGRDEFNIEKLRYHKIVIMTDADVDGAHIRTL
FT                   LLTFFYRQMPELIEGGYLYIAQPPLYKVSRGKSEVYLKDQAAMDDYLINQGVDGALLRL
FT                   GDGSEIAGQDLTRVVDEARRLKRLLDAFPTHYPRHILEQAAIAGAFVPGAVDADLQGVA
FT                   DKVAARLDLIALEYERGWQGRITQDHGIRLARILRGVEEVRTLDGPMLRSGEARKTGSF
FT                   TKSLQEIYGAPATLHRKDRQQAIYGPLDLLKAILEEGEKGLTLQRYKGLGEMNPDQLWE
FT                   TTLDPDARTLLQVRVDDMIEADDLFTKLMGDVVEPRREFIQKNALSVENLDF"
FT   gene            complement(8429..9205)
FT                   /locus_tag="TM1040_0008"
FT   CDS_pept        complement(8429..9205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0008"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62741"
FT                   /db_xref="GOA:Q1GKS5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS5"
FT                   /protein_id="ABF62741.1"
FT                   /translation="MGKSERFEEDMLPLFEGANGDSDEAPLLPIMQGRIPSYIRDHRAR
FT                   LRERFMSAGAIGLPDYELLELILFRSIPRKDVKPLAHQLLASFGDLNRVVTASPERLAE
FT                   VQGIGQAVICDLKIFEAAAQRMARSRVLQRQVIASWDALLDYCHTAMAHRETEQFRVLY
FT                   LDRKNILIADEEQARGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQADIG
FT                   MTRKVGAALGALDITLHDHLIIGASDELSFRSEGLL"
FT   gene            complement(9343..10500)
FT                   /locus_tag="TM1040_0009"
FT   CDS_pept        complement(9343..10500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0009"
FT                   /product="Chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62742"
FT                   /db_xref="GOA:Q1GKS4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKS4"
FT                   /protein_id="ABF62742.1"
FT                   /translation="MSKRDYYEVLGVSKGASADEIKKGFRKKAKELHPDRNADNPDAEA
FT                   QFKEANEAYDVLKDPERKAAYDRYGHAAFENGMGGGGGGRAGGHPGGDFSSAFSDVFDD
FT                   LFGDFMGGGGGRAGARQRATRGADLRYNLRLSLEEAFAGLHKTINVPTSVSCTSCEGTG
FT                   AEGGAEPTTCPTCSGMGKVRAQQGFFTVERTCPTCSGLGQMIKNPCKTCNGHGRVEKDR
FT                   SLSVNIPAGVETGTRIRLAGEGEAGLRGGPPGDLYIFIEVARHELFEREGNNLHCRVPV
FT                   SMAKAALGGAIEVPTIDGGRGRVQIPEGSQSGRQMRLRGKGMPALRGGGTGDMFIELAV
FT                   ETPVNLTPRQKEILKEFDEISEENTNPETRSFFSSVKSFWDGMKG"
FT   gene            complement(10577..12505)
FT                   /locus_tag="TM1040_0010"
FT   CDS_pept        complement(10577..12505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0010"
FT                   /product="Chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62743"
FT                   /db_xref="GOA:Q1GKS3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKS3"
FT                   /protein_id="ABF62743.1"
FT                   /translation="MSKVIGIDLGTTNSCVAIMDGSQPRVIENAEGARTTPSIVAFTDE
FT                   ERLVGQPAKRQAVTNPDNTIFGVKRLIGRRFDDSDLAKDKKNLPFAVINGGNGDAWVEA
FT                   KSEKYSPSQISAFILGKMKETAESYLGEEVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGLDKAETQTIAVYDLGGGTFDVTILEIDDGLFEVKSTNGDTFLG
FT                   GEDFDMRIVNYLADEFKKEHGVDLTKDKMALQRLKEAAEKAKIELSSSSQTEINQPFIS
FT                   MDPSSGQPLHLVIKLTRAKLESLVGDLIKNSMKPCAAALKDAGLSASDIDEVVLVGGMT
FT                   RMPKVIEEVTKFFGKEPHKGVNPDEVVAMGAAIQAGVLQGDVKDVVLLDVTPLSLGIET
FT                   LGGVFTRLIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFNLEDI
FT                   PPAPRGMPQIEVTFDIDANGIVSVSAKDKGTGKEQKITIQASGGLSDEDIEKMVKDAED
FT                   NAEADKERRELIEARNQAESLIHSTEKSIEDHGDKVDPSTIEAIELAIAALKDDLEGDK
FT                   ANAEKIKSGIQNVTEAAMRLGEAIYKAQAEEGGADEPSAADEDASAGPGDDDIVDAEFE
FT                   DLDDNKR"
FT   gene            12713..13315
FT                   /locus_tag="TM1040_0011"
FT   CDS_pept        12713..13315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0011"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /EC_number="1.14.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62744"
FT                   /db_xref="GOA:Q1GKS2"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS2"
FT                   /protein_id="ABF62744.1"
FT                   /translation="MTRLKVRGFEIHKGFLSVQAQKELISALRPVLRAAPLFSPEVPGG
FT                   GQMSVRMTSAGEYGWFSDPSGYRYEGKHPSGRKWPEIPSEVLNVWTTLVDRERLPDCCL
FT                   FNYYGEGARMGLHQDKDEADFSFPVVSISLGDDGLLRLGGTSRKEKTQTVWLNSGDVVV
FT                   MGGEARLAYHGIDRIRFRSSRLLPKGGRVNLTLRVVT"
FT   gene            complement(13332..14210)
FT                   /locus_tag="TM1040_0012"
FT   CDS_pept        complement(13332..14210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0012"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62745"
FT                   /db_xref="GOA:Q1GKS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS1"
FT                   /protein_id="ABF62745.1"
FT                   /translation="MDQQEIHVRISHLLLNSEAMFRYRTDKSPLSRAITLSEVVFHSVV
FT                   RSVRSKHNNAFMALGINIIQSVLFVMFFYFMFTVMGIKGAAIRGDFLLYMMSGVFLFMT
FT                   HTKTVGAVVGAEGASSPMMQHAPMNTTIAILSAALGALYLQVLSMLIILFAYHVAFTPI
FT                   HIEEPVPAFGMLLLAWASGAAIGLVLYVLKPWMPSAIGIISTIYQRSNMLFSGKMVLAN
FT                   TLPGYMLPMFIWNPLFHTIDQARGYIFINYNPHVTWWEYTMWLALIFLVLGLMGEFYTR
FT                   RAVSLSWGARR"
FT   gene            14274..15071
FT                   /locus_tag="TM1040_0013"
FT   CDS_pept        14274..15071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0013"
FT                   /product="3'(2')5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62746"
FT                   /db_xref="GOA:Q1GKS0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKS0"
FT                   /protein_id="ABF62746.1"
FT                   /translation="MNYDDLVVVMRRLALEAGDKIMEIYNSDDFDVKQKSDDSPVTVAD
FT                   EAADALISAGLRSAFPDVMLVTEEQAESHSATGDTFLIVDPLDGTKEFINRRGDFTVNI
FT                   AYVEAGVPTRGVVYAPARDRMFYTLADGSAVEEKGPFSKNEVGETTALKVAESDNSALL
FT                   VVASKSHRDQATDDYINKYSVKDTRSAGSSLKFCLVATGEADLYPRVGRTMEWDTAAGH
FT                   AVLSGAGGRVVRFDDHNPLRYGKDGFANPFFIAHAPAVELKDA"
FT   gene            15072..15872
FT                   /locus_tag="TM1040_0014"
FT   CDS_pept        15072..15872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0014"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62747"
FT                   /db_xref="GOA:Q1GKR9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR9"
FT                   /protein_id="ABF62747.1"
FT                   /translation="MSVLIVIPARYASTRFPGKPLAELTGATGKTRSLIERSWRAACAV
FT                   NGVDRVVVATDDDRIKAASETFGAEVVMTSETCANGTERCAEAHAALGGGYEVVVNLQG
FT                   DAPLTPPWFIEDLINGLQAAEGMGLATPVLRCDGATLNSLLEDRRAGRVGGTTAVFGAD
FT                   HSALYFSKEVIPFQSGRYSDAECTPVFHHVGVYAYRPDALLAYPTWPVGPLETLEGLEQ
FT                   LRFLENGRKILCVEVDARGREFWELNNPEDRPKIEEMMRKMGVE"
FT   gene            16023..16916
FT                   /locus_tag="TM1040_0015"
FT   CDS_pept        16023..16916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0015"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62748"
FT                   /db_xref="GOA:Q1GKR8"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR8"
FT                   /protein_id="ABF62748.1"
FT                   /translation="MPRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDE
FT                   ARAAGIKEFIFVTSRGKGALEDYFDHAPVLEQELRKKGKDQLLEVLKATNMGSGDIAYI
FT                   RQHKALGLGHAVWCARRLIGDEPFAVMLPDDVIAADKPCLQQMVEAYAETGGNMVAAME
FT                   VAPEKTSSYGILDVKDSKDAVMPINAMIEKPSPEEAPSNLAVIGRYILSPSVLQNLNKR
FT                   KQGAGGEIQLTDAIAEDIARDVPVCGYRFKGRRFDCGSKSGFLQATVAFALEREELRDD
FT                   LMEYLSTLSAHRQAAE"
FT   gene            17017..18000
FT                   /locus_tag="TM1040_0016"
FT   CDS_pept        17017..18000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0016"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62749"
FT                   /db_xref="GOA:Q1GKR7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR7"
FT                   /protein_id="ABF62749.1"
FT                   /translation="MANVLVTGGAGYIGSHACKALKQAGYTPVTYDNLVTGWQDAVKFG
FT                   PFEQGDLTDRGRLDEVFAQYKPVAVMHFAALSQVGEAMSEPGRYWANNVGGSLCLIEAA
FT                   VAAGCLDFVFSSTCATYGEHDNVVLDENTPQQPLNAYGASKRAVEDILKDFEAAHGLRS
FT                   VIFRYFNVAGADPEAEVGEFHQPETHLVPLMIQAIKGERAALTVFGTDYDTPDGTCIRD
FT                   YVHVCDLVDAHILGLKWLEDGKGSRVFNLGTGTGFSVKEVLSHSHAVTNTEVPHVIGPR
FT                   RAGDCTKLVSGSVRAGEELGWEPKRSTMDQMISDAWRWHQSGHYER"
FT   gene            18017..19078
FT                   /locus_tag="TM1040_0017"
FT   CDS_pept        18017..19078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62750"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR6"
FT                   /protein_id="ABF62750.1"
FT                   /translation="MPKISLMAAYRLRLKRRRCLWRAYRARRQLRCIVDNTINIGRDDI
FT                   LVVVVLRNEAQRLPYFLEYYRRLGAAHFLVVDNTSEDGSLALLQREARRGDLSLWQTHD
FT                   SYRASRFGIDWSGWLLMQHGSGHWCLTVDADELLVYPGMDQMDLPMLTQRLDQIGLEGF
FT                   GALMLDLYPKGPLGTQEYRVGQDPTEVLRWFDASPYHAVRQAPQGNLWLQGGARARMFF
FT                   ADTPERAPTLNKIPLMRWHWRYAYTNATHALLPPRLNAIYGGTEGQAPSGVLLHTKFLP
FT                   EIVSKSKQERSRAEHFHNPTLFEGYYAQIETKPDFWHPDSQEYHSPEQLAELGLCRGFD
FT                   ARTTVAGGQRNQF"
FT   gene            19217..20203
FT                   /locus_tag="TM1040_0018"
FT   CDS_pept        19217..20203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62751"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR5"
FT                   /protein_id="ABF62751.1"
FT                   /translation="MRIRRKRRILRALRKSRNLHCVQNNTSRIRPGDILLVCTFRNEQV
FT                   RLPYFLQYYRSLGVNHFLFIDNGSTDGAQGYLAGLQDVSVWNAQGSYKRATFGVDWANA
FT                   LLRKYGHGHWCLVVDADELFVYPFCDTRPIRALTDWLDSSQIRSFSAMLLDMYPKGRVD
FT                   EVPYKPGQDPLEITQWFDSGNYSITRNKRYGNLWIQGGPRARVFFADRPKLAPALNKIP
FT                   LVKWDRRYAYVSSTHMLLPRGLNQVYEINGGEKASGILMHTKFLDTFPAKAEEELKRRE
FT                   HYAGSVEYQAYVKEAESSPELWCKWSEKYINWRQLEILGLMSKGNWA"
FT   gene            20200..21900
FT                   /locus_tag="TM1040_0019"
FT   CDS_pept        20200..21900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0019"
FT                   /product="glycosyl transferase family 14"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62752"
FT                   /db_xref="GOA:Q1GKR4"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR4"
FT                   /protein_id="ABF62752.1"
FT                   /translation="MSNVGVIMLVHTALERAEQVVRHWTAAGCPVVLHVDRQVSKQVFQ
FT                   EFCARLKDDPLVRFSRRHRCEWGTWGIVAASQSASELMLSEFPDVSHIYLTSGSCLPLR
FT                   PVKELQTYLAARPDIDFIESATTSDVPWIVGGLSTERFTMRFPFSWKRHRKLFDRYVRL
FT                   QRKLKLRRRIPAGLVPHMGSQWWCLTRRTLTAILTDADRARYDAYFRHVWIPDESYYQT
FT                   LARLHSDNIESRSLTLSKFDYQGKPHVFYDDHLQLLRRSDCFVARKIWPHAERLYQAFL
FT                   CPSATDINRTEPNPGKIDRIFAKAVERRIRGRKGLYMQSRFPAKGVESQQTCGPYSVFQ
FT                   GFSELFEDFESWLARATGARVHGHLFAPERAEFAGEQRLFNGCLSDSALLRDRNPQSFL
FT                   SNLIWNTRGERQCFQFGPHDTQSINWFIAQDSNAQISVISGAWSVSLFKTNRSFSDLRR
FT                   EAAKLQRIEAEHLKILRGRWTHARIRVWSMAEFIEAPMENLQTIVDEIGPMSRSHILEA
FT                   PQMVDLTGFGQFLQNLKNQGMHPYLMGDFPARSAPKQPMRQARKTYIVK"
FT   gene            21907..23346
FT                   /locus_tag="TM1040_0020"
FT   CDS_pept        21907..23346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62753"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR3"
FT                   /protein_id="ABF62753.1"
FT                   /translation="MSADFTSFVVLAEMRTGSNFLEANLNALRGVSCLGEAFNPHFIGY
FT                   PNQESIFEVSREARDDDPHALVDAIHAAEGLCGFRYFHDHDPRILERILNDPQVAKIIL
FT                   TRNPLDSYVSWKIARTTGQWKLTNVKRRKEAKAVFDAEEFGAHVDGLQEFQIAVLNQLQ
FT                   RTGQTAFYVAYEDLQSLEVMNGLATWLGVDARLDALDDSLKRQNPAPVIAKVENPEEMT
FT                   EALAGMDRFNLTRTPNFEPRRGPAVPGYVAGVVTPILYMPVRNGLEAHVSEWIGGLDKV
FT                   PAEGLITGMNQKQLRQWRHANPGHRSFTVVRHPLARAHHVFCTKILPNGPGSMKHIRNT
FT                   LRRQFHLDIPQDGIDVGYSRERHRQAFEQFLTFLKSNLAGQTAIRVDARWASQAQSISG
FT                   FAELGAPDLILREEDLATDLPWLARKLGRMSPAEVPPVPADQPIALAEIYDDALEVLCR
FT                   SIYTRDYLTFGFDSWSPRIER"
FT   gene            complement(23420..23884)
FT                   /locus_tag="TM1040_0021"
FT   CDS_pept        complement(23420..23884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0021"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62754"
FT                   /db_xref="GOA:Q1GKR2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR2"
FT                   /protein_id="ABF62754.1"
FT                   /translation="MQISNILTQEAVRVIGAASSKKRLFQEVAEVAQTAYGLKASLTVE
FT                   ALLDRESLGPTGVGHGVALPHARLSGIDRVVGVYVSLEKPLDFGAVDRQPVDIVFALLA
FT                   PVDAGVEHLKALALVSRTLREQSFCTKLRANPDTATLYTILTESQSVQAA"
FT   gene            complement(23940..24503)
FT                   /locus_tag="TM1040_0022"
FT   CDS_pept        complement(23940..24503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0022"
FT                   /product="SSU ribosomal protein S30P / sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62755"
FT                   /db_xref="GOA:Q1GKR1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR1"
FT                   /protein_id="ABF62755.1"
FT                   /translation="MRYKVSGKQIDIGESLQTHVETELSAVLEKYAGRPTDAQVVFSRN
FT                   AHEFVCEAIVHLSTGLTCQAKAHATEIYASFESCLEKMDKQLRRYKRRLKDHHRDRAEP
FT                   VELMGASSYILASEEAESDQEPDSLQPIIVAEMETKIPSLSVGEAVMQMELAGSPVLVF
FT                   RNEGKDGLNVVYRREDGNIGWIDP"
FT   gene            24596..24820
FT                   /locus_tag="TM1040_0023"
FT   CDS_pept        24596..24820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKR0"
FT                   /protein_id="ABF62756.1"
FT                   /translation="MQCAETGIPKAGSKRRLLRFAHVPYFNSMPNPGRSQWNSDCIFKC
FT                   GTTYRRAPANHSARKGYAHAYAPALQDWL"
FT   gene            complement(24823..25581)
FT                   /locus_tag="TM1040_0024"
FT   CDS_pept        complement(24823..25581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0024"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62757"
FT                   /db_xref="GOA:Q1GKQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ9"
FT                   /protein_id="ABF62757.1"
FT                   /translation="MAKPKLEVTSGSSGLRIEKMRKSYRKRVVIRDVSMELNRGEVVAL
FT                   LGPNGSGKTTSFYTIAGLVFPEAGRVTLDGQNVTSLPMYRRARLGIGYLPQEMSIFRGL
FT                   SVEDNISAVLDIAVSDDHKRRERLEELLSDFSIEHLRRAPALALSGGERRRVEIARCLA
FT                   ADPKYLLLDEPFAGVDPISVGDIRNLVADLKNRGIGVLITDHNVRETLEIVDRAYILHD
FT                   GQVLMSGSPSEVVENENVRRVYLGDNFRIS"
FT   gene            complement(25581..26015)
FT                   /locus_tag="TM1040_0025"
FT   CDS_pept        complement(25581..26015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0025"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62758"
FT                   /db_xref="GOA:Q1GKQ8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ8"
FT                   /protein_id="ABF62758.1"
FT                   /translation="MAQGTGVSFGVLQTDTSQPVDIASDNMSVNQEDGSALLTGNVLII
FT                   QGEMRLSADNVLVVRRTEGNGIERLEARGNVLLVSGEDAAEAREADYTIQSGTVVMRGN
FT                   VLLTQQGSTLGAEQMTVNMTTGNATLSGRVRTTLPGSGGN"
FT   gene            complement(26085..26684)
FT                   /locus_tag="TM1040_0026"
FT   CDS_pept        complement(26085..26684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62759"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ7"
FT                   /protein_id="ABF62759.1"
FT                   /translation="MDRYSRVVSYLKVALPLTALALLSTLFLISHNINTDPSIPFAEIE
FT                   LENRLRGQQVTAPFFTGTTATGQEITIAATKALPGGDGEGASASDLEAEILTTEGRRIL
FT                   LLSDRGSIRPDQDLAVLVGNVRIITADGTRVESERLNAELSGLQVVSPGPVTAQGPMGD
FT                   FSAGTMRIFTDSKNAPVHIEFTEGVKLVYDPAKIER"
FT   gene            complement(26757..27371)
FT                   /locus_tag="TM1040_0027"
FT   CDS_pept        complement(26757..27371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0027"
FT                   /product="3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62760"
FT                   /db_xref="GOA:Q1GKQ6"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ6"
FT                   /protein_id="ABF62760.1"
FT                   /translation="MATHLYQHDLPNSLDLGPVVAIDCETMGLNPHRDRLCVVQMSSGD
FT                   GDAHLVQIAKGQTDAPNLTAMLTNPDVLKLFHYGRFDIAALYHRFGALAAPVYCTKIAS
FT                   RLVRTYTDRHGLKNLTQDLLGQDISKQQQMSDWGAETLTRAQMDYAASDVLHLHRLRDA
FT                   LDQRLVREGRSDLAQACFDFLPTRARLDLAGWPDTDIFAHS"
FT   gene            27635..29086
FT                   /locus_tag="TM1040_0028"
FT   CDS_pept        27635..29086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0028"
FT                   /product="xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62761"
FT                   /db_xref="GOA:Q1GKQ5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ5"
FT                   /protein_id="ABF62761.1"
FT                   /translation="MFLGLDVGTSGLRALLADEGGNVIGVADAAYGVSHPKTGWSEQDP
FT                   QDWITACQSAVAELRGEHPEAISALRGIGLSGHMHGATLLDVDGKVLRPCILWNDTRSA
FT                   TEAAELDGTEGVRDLSGNIVFPGFTAPKLAWVKTHEPDIYAQIAKVLLPKDYLRFWLTG
FT                   SYISDMSDSAGTSWLDVGARDWSPTLLEASGMRRDQMPDLVEGSAAGGELRADLRADWG
FT                   IKGSVVVAGGGGDNAVAACGAGCFREGEGFVSLGTSGVLLAAKSAYKPDPASAVHTFCH
FT                   AVPQTWYQMGVILAATDCLNWLSRTLGQTPATLAGRLPNEVKGPSSITFLPYLSGERTP
FT                   HNDAQIRATLAGLDIGDGPAELTQAVMEGVAFALRDCLEALKGTDTSFTRLLAVGGGTR
FT                   SPYWVETLATVLGVSLDIPDKGEFGAALGAARLAMTATGADLATVMRAPPISHTIDPRS
FT                   DLIEAYDTSYARYRALYPNMKALMT"
FT   gene            29083..30393
FT                   /locus_tag="TM1040_0029"
FT   CDS_pept        29083..30393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0029"
FT                   /product="D-xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62762"
FT                   /db_xref="GOA:Q1GKQ4"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKQ4"
FT                   /protein_id="ABF62762.1"
FT                   /translation="MTTGFFGDVSKITFEGADSTNPLAFRHYNPDEVILGKRMEEHLRF
FT                   ATCYWHNFVWPGGDPFGGQTFDRPWFKDTMHAAKLKADVAFEMFTLLQSPYYCFHDADV
FT                   RPEGANFAENTRNLNEIVDYFAQKQEETGVKLLWGTANLFSNARYMSGASTNPDPDVFA
FT                   FSAATIKTCMDATHRLGGENYVLWGGREGYETLLNTDLAQEDQQMGRMLNMVVEYKHKI
FT                   GFKGAILVEPKPQEPSKHQYDYDAATVYGFLKRHGLENEVKLNLEQGHAILAGHSFEHE
FT                   IATAQALGIFGSIDMNRNDYQSGWDTDQFPNNTPEVALAYYHILKHGGFTTGGTNFDAK
FT                   LRRQSIDAEDLLMAHIGGMDICARGFKAAAAMIEDGTLDQFVTDRYAGWQTDPAQDMLA
FT                   GKLSLDEIAKRVEAEDINPKPRSGRQEYLENLINRFV"
FT   gene            30394..31401
FT                   /locus_tag="TM1040_0030"
FT   CDS_pept        30394..31401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0030"
FT                   /product="Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62763"
FT                   /db_xref="GOA:Q1GKQ3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ3"
FT                   /protein_id="ABF62763.1"
FT                   /translation="MKDAQIVEHGLHRGHTLKEARLQSAGLSISLLNFGAVTRDLRLLE
FT                   ENRPLILGFQDPADYLLNPGYLGVIAGRVAGRIKNARFTLGRQRFQLNPNEGDTLLHGG
FT                   ANGLCHVFWNLEVLSENTARLRYHSPEGEGGFPGAAEITLTVMLEAQAVVYDLTAEVTA
FT                   PTPFSLAQHNYYNLMGGAQSIREHRLQVDATSYLGLDDANVPDGRLLALDGCHHDFRLG
FT                   RSFAELDPQTKGSDVAVVFDECRDPEQPVASLIAPDGLQMRVISDQPCAQIYTASALPE
FT                   QPGALPGQRIGSDMGVCIEPQGYANAVNLPQFPSMIATPERPYRQRLRLEFGRI"
FT   gene            31401..32708
FT                   /locus_tag="TM1040_0031"
FT   CDS_pept        31401..32708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0031"
FT                   /product="methylamine utilization protein MauG putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62764"
FT                   /db_xref="GOA:Q1GKQ2"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ2"
FT                   /protein_id="ABF62764.1"
FT                   /translation="MRWFILLTLMGASATQAQSRPDLGPRPAFPAPDMAAVELGQLLFY
FT                   DPILSGNRNIACSTCHHPRLGTGDGLSLGLGEGGIGLGPDRKPDPANLPEQRIPRNAPG
FT                   LWNLGAPEFTVMFHDGRLEDHPDHPGGIRTPLGEDMVAGFDDALAAQAMFPVLSADEMA
FT                   GHYSENEVAQAVRLGQLSTPGGAWDRIAARVEAIPAYRVAFDEVLGEGTPITFADIGNV
FT                   LADFIRFEWRADMSPFDAYMLGQGDLPKAAKRGMELFYGAADCSQCHTGWFQTDHGFHA
FT                   LAVPQIGPGKAARFETHSRDEGRIRVTGRAEDAFAFRTPSLRNVGQTAPYGHSGAFATL
FT                   EDIVWHHLSPEQSLSSYSKSQAVLPQLEGAQDWTIQDNAAERAALIAAVDLDPVSLTAA
FT                   EVADIVAFLHALTDEEAAKGRLGVPAEVPSGLPVDQ"
FT   gene            complement(32737..34287)
FT                   /locus_tag="TM1040_0032"
FT   CDS_pept        complement(32737..34287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0032"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62765"
FT                   /db_xref="GOA:Q1GKQ1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ1"
FT                   /protein_id="ABF62765.1"
FT                   /translation="MMRFLKTLALIGLTLAAFVMLARLLFPLPDISNREISSALPASDQ
FT                   TSIGATVADLNAAHVGQSGIIPLRSGTDALASRVELIRRAEASIDAQYYIWHDDTSGVL
FT                   LLEELRNAALRGVRVRLLLDDNGVPGLDATMATLNAQPNFEIRLFNPSTIRRPKLLGYS
FT                   FDFFRMNRRMHNKSLIVDGAVAIIGGRNIGDEYFDVQRDAFYIDMDALAAGKVVPETAT
FT                   VFDDYWNSASVFALETIVSSDGNLITFDQRVSEVMATPEAQRLMGDLQSSADKFARGEM
FT                   PMEWTNVRVVADDPVKGQGSATSDQLMISRLGEILGQVETRLDLVSAYFVPGQRGTEYL
FT                   TDLAAAGVDVRVLTNAMNTTDVLMVHSGYTRYRRALLEADVSLYELKLRAQMSADANRQ
FT                   LKPFGLSGASLHAKTFAVDGDRVFIGSFNFDPRSATLNCEMGFLIESPTLAGQVSAGFD
FT                   GPLLTVSYQPALTPKGKMIWREPIEDGETLIYQEEPGATWFQQIAIAVIGVLPVEWLL"
FT   gene            34629..35831
FT                   /locus_tag="TM1040_0033"
FT   CDS_pept        34629..35831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0033"
FT                   /product="sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62766"
FT                   /db_xref="GOA:Q1GKQ0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKQ0"
FT                   /protein_id="ABF62766.1"
FT                   /translation="MTFLILLVLLAFALYSLFSKRIDRSVLTLPILFTGLGFLLSKPLS
FT                   EVIPAGLIHEGKAGLAEVTLILVLFSDASHVRLRSLARGWQYPTRMLVIGLPLTIASGT
FT                   AVAFWLNPSSGLAVALLTAAVLTPTDAALGQAVVNSPDVPDRLAQTINVESGLNDGLVL
FT                   PFVLTGAILASGFAGEAHTAGLALEALIEVILGPLAGIAVGWVAARAMDWAQNRDLMQE
FT                   AAGAVVFLVTAFAAYLFAVLIHGNGFIAAFVAGMVFGNSYRHNIHFISEFMEGAGQLLT
FT                   MAAFLVFGAFLLPDGLAHAGVSTLVLALLFLTVVRMGPILLSLIGSGLPTREKLFLGWF
FT                   GPRGLASILFTLLMMDQFDIPNEEELLACVSLTVGLSILLHGITSTPLASWISQEGKRN
FT                   T"
FT   gene            complement(35895..36665)
FT                   /locus_tag="TM1040_0034"
FT   CDS_pept        complement(35895..36665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0034"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62767"
FT                   /db_xref="GOA:Q1GKP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP9"
FT                   /protein_id="ABF62767.1"
FT                   /translation="MRTAIDIKGLNVYFGDSHNLFHAVKNASFSVDSGASFGLVGESGS
FT                   GKSTILKAITGLAPYWEGEMTVAGHPLAGKRDRTFYKTVQMVFQDPYASLHPRQSVDQV
FT                   LSETLRLHGFKDINDRVDQLLKDVGLGPAFRFRYPHQLSGGQRQRVAIARALAPNPKIL
FT                   LLDEPTSALDVSVQAEILNLLKDLQAEHDLTYVMVSHDLAVVAHMCSTAAVMRNGEIME
FT                   ILSIDDMRAGKTAHDYTQHLLNASANRVASVETA"
FT   gene            complement(36662..37519)
FT                   /locus_tag="TM1040_0035"
FT   CDS_pept        complement(36662..37519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0035"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62768"
FT                   /db_xref="GOA:Q1GKP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP8"
FT                   /protein_id="ABF62768.1"
FT                   /translation="MSTLLDIENLWVKFPTRNGIFDAVRGVSFSLGKERLGIVGESGSG
FT                   KSMTGRAILRLIRKPGIVEAGHIKLHDTNLLDLSERDMRKVRGEKISMVMQDPKFSLNP
FT                   VVTVGDQIIEAYRLHAKSSRAEARSKALEMLEAVSIRDPERVMKAYPHEMSGGMGQRIM
FT                   IAMMLIPNPEILIADEPTSALDVSVQGQVLSIMDKLVRERGMGLIFISHDLNLVSQFCD
FT                   RVLIMYAGRIIEVCDADKLHEAKHPYTQGLLGSLPRFDHPKPRLQVLDRDPQWRDTASV
FT                   EGRP"
FT   gene            complement(37516..38433)
FT                   /locus_tag="TM1040_0036"
FT   CDS_pept        complement(37516..38433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0036"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62769"
FT                   /db_xref="GOA:Q1GKP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP7"
FT                   /protein_id="ABF62769.1"
FT                   /translation="MSSQTMTLREWLLTDTPTSRRQARLAAYYKGWLTLRSNHMAMGGL
FT                   AIIVLLVAVAIFAPLLAPHDPYYQDLGNRLQPLGTEGHILGTDSLGRDILSRLIWGARI
FT                   TLYIVALVAMIAPIVGLLVGTVSGYVGGWVDIMLMRVTDIFLAFPRLVLALAFVAALGA
FT                   GIENAVLAISLTAWPPYARLARAETLTIRSSDFISAIRLQGAGPLLIITKHIWPLCISS
FT                   LIVRVTLDMAGIILAAAGLGFLGLGAQPPSPEWGAMISEGRRFILDYWWVATMPGLAIF
FT                   AVSLAFNLLGDGLRDVLDPKDSSS"
FT   gene            complement(38430..39488)
FT                   /locus_tag="TM1040_0037"
FT   CDS_pept        complement(38430..39488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0037"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62770"
FT                   /db_xref="GOA:Q1GKP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP6"
FT                   /protein_id="ABF62770.1"
FT                   /translation="MAFYSNVPKRQPWLPLPPWARSMGITLLSVSITMLGLLFVTFLIG
FT                   RVMPIDPVLAVVGERASEEQYNAVYLELGLDKQLIIQFFYYVGDVLQGDFGKSLLTARP
FT                   VSEDIARVFPATFELATIGIIFGCVLGVPLGVIAAVRRGSWVDQIARVVALVGYSMPIF
FT                   WLGLMGLLLFYGMLGWVGGPGRQGIFYEDMIPSVTGMILVDSIIAGDWGAFWDAFSHII
FT                   LPASLLGYYSLAYISRMTRSFMLEQLSAEYITTARVKGMSEWAVVMNHAFKNIRVQLIT
FT                   VIALSYANLLEGSVLTEIIFSWPGIGNYITTALLSADMNAVLGGTVVVGLVFIVLNVFS
FT                   DLLYKVFDPRSK"
FT   gene            complement(39490..41088)
FT                   /locus_tag="TM1040_0038"
FT   CDS_pept        complement(39490..41088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0038"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62771"
FT                   /db_xref="GOA:Q1GKP5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP5"
FT                   /protein_id="ABF62771.1"
FT                   /translation="MNAFSKLIGSAALGLALGVTALPAVAATPDNMLVIANRIDDITTL
FT                   DPAQSFEFAGADVIRNMYGKLVNFDPSNLEAGYQPDLAESWTVSEDGKTITFTMREGVK
FT                   FHSGNPVRAEDAAFSLRRVIKLNKTPSFILTQFGFTPENVDEMITVDGNTVSITTDKRY
FT                   ATSFVLNCLTATLGAIVDEKLVMEHDKDGDLGNEWLMTNSAGSGPYKLASWKPKESVTL
FT                   TANPDYYEGAPAMQRVIVRHVQESATQRLMLERGDIDVARDLTPADVDGLAGIDGVEVQ
FT                   REMRGRLMYVSFNQKHPELSKPQVRQALKYLIDYDGMENSFLKNWYVKHQNFLPKTYLG
FT                   AVDENPFSLNIEKAKELLAEAGVPEGLELTVGVREAQERLEIAQSLQNTFSQAGIKLNL
FT                   EVGTGKQVLGKYRARELDIYLGAWGPDYPDPQTNAGTFAYNPDNSDAANATGLLAWRNG
FT                   WDTAGLTDKVAAAVVEGDTVKRADMYHEIQAEFRDTAPFAVMFQLVEQAGISEKVEGLN
FT                   LGGAITAAAYWDVTK"
FT   gene            complement(41146..42195)
FT                   /locus_tag="TM1040_0039"
FT   CDS_pept        complement(41146..42195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0039"
FT                   /product="dipeptidase AC. Metallo peptidase. MEROPS family
FT                   M19"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62772"
FT                   /db_xref="GOA:Q1GKP4"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP4"
FT                   /protein_id="ABF62772.1"
FT                   /translation="MNTPLIFDGHNDLLLRLHNKDVGMDQAGVFGSGGRQIDVDKAKAG
FT                   GFGGGFFAIFVPGEESVSHDEEMMKDTYDLPLPEQVTWHNAIKVALSQAALLIELERQG
FT                   ALQICRSTAEIRTAMEQGLMAAVMHMEGAEAIDRDFHTLDVLHGAGLRSLGPVWSRPTR
FT                   FGHGVPFRYPSTGDTGEGLTEDGFRLIKRCNEMRIMIDLSHMTEAGFWDVARVSDAPLV
FT                   ATHSNAVALTRHSRNLTDRQLHAIRDSDGMVGLNFAVAFLREDGRMDENTPISRMLDHL
FT                   DYLIAEVGEDRVGMGSDFDGATVPAEIGTIAGLPALRRAMRDRGYDDALMKKLCHENWL
FT                   RVLGKTWGE"
FT   gene            42535..43575
FT                   /locus_tag="TM1040_0040"
FT   CDS_pept        42535..43575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0040"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62773"
FT                   /db_xref="GOA:Q1GKP3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP3"
FT                   /protein_id="ABF62773.1"
FT                   /translation="MKAVLYETFKELPKLVTVEDPTPDPDGVVIKVEATGLCRSDWHGW
FT                   MGHDSDIVLPHVPGHEFAGVIVALGKNVRNWTVGDRVTVPFISGCGACSECHAGHQQVC
FT                   HNQQQPGFTHWGSFAEYVGVRQADLNLVALPQEMDFATAASLGCRFATSFRAVVDQAQT
FT                   RAGQWVAVHGCGGVGLSAVMIAQAVGANVIAIDIDDEKLNLAQELGAVATINGARVADV
FT                   PEAVIDLSRGGAHVSLDALGHPLTCFNSIQNLRPRGKHVQVGLMLAEHSTPSVPMAKVI
FT                   AKELEILGSHGMQAHRYDAMLDMIASGKLDPRRLVGREISLDAAPSALVKMDQFQSIGA
FT                   TVITTF"
FT   gene            43680..44879
FT                   /locus_tag="TM1040_0041"
FT   CDS_pept        43680..44879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0041"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62774"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP2"
FT                   /protein_id="ABF62774.1"
FT                   /translation="MQDWDAVVIGGGPAGLMAAGEVARQGHRVLLVEAKPSPARKFLMA
FT                   GKSGLNLTKDEPFEDLLAQYGDSAEWLAPMIKAFDAAAVQDWARGLGQELFTGSTGRVF
FT                   PTVMKGSPLLRAWLQDLDTHRVTRQLGWRWTGWQQDGQLLFGTAAGPQIVTSRATILAL
FT                   GGASWARLGSDGAWAALLASRGVALAPFQPSNAALSVAWSDHMTPHFGAALKAVAWQAG
FT                   ALQARGEATLSQRGLEGGGLYTLTPALREGQPLFVDLSPDLNEGDLARRLAKPRGKTSW
FT                   SNHMRRTLKLATVKMALLQEFGRPLPQDPESLARLIKHLPVRHTGLRPMDEAISTAGGV
FT                   RRDALDDGLMLKAIPGTFCAGEMLDWDAPTGGYLLTACFATGRWAGQAAARYLASSATR
FT                   "
FT   gene            complement(44852..45442)
FT                   /locus_tag="TM1040_0042"
FT   CDS_pept        complement(44852..45442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0042"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62775"
FT                   /db_xref="GOA:Q1GKP1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP1"
FT                   /protein_id="ABF62775.1"
FT                   /translation="MYQVIGVPKTRAFRVLWTLEELGQSYDLVPAQPQSAEARAANPSG
FT                   KVPALVEDGESITDSVAIITYLADKHGALTAPAGTLARARQDAITNMVIDEMDAILWTA
FT                   ARHSFILPEDRRVPEIKDSLRWEFANSIKRINAQLSGEFVAGDQFTIADVLMTHCLNWA
FT                   RGAKFDVEGDAVLDYGKRMRARPAFQRVAELAK"
FT   gene            complement(45518..46546)
FT                   /locus_tag="TM1040_0043"
FT   CDS_pept        complement(45518..46546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0043"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62776"
FT                   /db_xref="GOA:Q1GKP0"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKP0"
FT                   /protein_id="ABF62776.1"
FT                   /translation="MKLSPREAEGYFARPDPGKTGLLIYGADAMRVSLKRQQMLAALLG
FT                   PGAEEEMRLTRMPASELRKDPAQLLDAVKAVGFFPGIRAVFVEDANDSATPAITTALEA
FT                   WQPGDAQIVVTAGQLKASSKLRKAFETHTNAYATGIYDDPPSRAEIERILSEAGVRDVP
FT                   GDSMSALADIANDIGPGDFSRMIEKLSLYKNGDNSPLTLEDIDAVAPQSTEAALDDLLN
FT                   VVAEGRSADIGPVLRRLQAQGTNAVTLCIGATRHFRTLYTIAAHPGGAAQGIGGLRPPL
FT                   YGKRRDRMLRQAQGWGAQKLQNALTILTDTDLQLRSAGQSAPALALTERAMIRLAMLAR
FT                   AR"
FT   gene            complement(46543..47076)
FT                   /locus_tag="TM1040_0044"
FT   CDS_pept        complement(46543..47076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0044"
FT                   /product="lipoprotein putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62777"
FT                   /db_xref="GOA:Q1GKN9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN9"
FT                   /protein_id="ABF62777.1"
FT                   /translation="MLLPDRRKFLKLTLALPLGASLSACGFEPVYGPVGAGTALRDQIA
FT                   FQSPETIGAPRDSDAYYFVRRLETRLGRSGAPAYRMDLTLDTKEVGQAITAEGSITRYS
FT                   LTGTAGYSLVRLSDGQIVASGEVENFSGYSASGTTVQTQAGETDAHERLMVILADQIVT
FT                   RLYAAPGLGRPEGS"
FT   gene            complement(47063..49636)
FT                   /locus_tag="TM1040_0045"
FT   CDS_pept        complement(47063..49636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0045"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62778"
FT                   /db_xref="GOA:Q1GKN8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKN8"
FT                   /protein_id="ABF62778.1"
FT                   /translation="MSRYEASDIEARWQKAWEEAAIFQAKEDHSKPKYYVLEMFPYPSG
FT                   KLHMGHVRNYTMGDVIARYKLSTGHNVLHPMGFDAFGMPAENAAMASGGHPKDWTYSNI
FT                   DTMVEQMKPLGLSLDWSRMFATCDPEYYGQQQALFLDFLEKGLVYRKNAVVNWDPVDMT
FT                   VLANEQVENGRGWRSGALVERRELTQWFFKISDYSDELLEALDGLENWPAKVRLMQENW
FT                   IGKSRGLQFSFERTDGEEAIEVYTTRPDTLMGASFVGISPDHPIAKKLEAESQEVADFV
FT                   AECRKGGTTEEAIETAEKLGYDTGLRVKHPLDPNWELPVWIANFILMDYGTGAIFACPA
FT                   HDQRDFEFATKYNLPIIPVLEPVEGAGELTEAYVPTKAEKVRYVRGFAGDELQTGEEGV
FT                   NTAVDKAEAEGWGQGVTKFRLRDWGLSRQRYWGCPIPVVHCPDCGVVPEKKENLPIALP
FT                   YDEDGKAIDFSVPGNPLDRHPSWRNCACPNCGKPAQRETDTMDTFVDSSWYFARFTAPR
FT                   AETPTDLDAANYWMNVDQYIGGIEHAILHLLYSRFFARAMQICGHLPESAKEPFDALFT
FT                   QGMVTHAIYENAERKDDNGRAIYHYPSEVEERDGGVFVKETGERIKVIPSAKMSKSKNN
FT                   VVDPLAIISTYGADTARWFVLSDSPPERDVEWTASGAEAAYKHLNRVWNLCDRIGEMDP
FT                   DAKGEGDEELLREMHKAIRDVTLGVESFGFNAAIAKLYGFTNTLSKSKASAAVQKQAIK
FT                   TLAQLMSPMTPHLAEDIWAHQGGEGLIANAAWPVADESMLVEDSVTLPIQVNGKRRGEI
FT                   TVAKDLDKAEVEKLALAHEAVQRVLEGAAPKKVIVVPGRIVNVVA"
FT   gene            complement(49724..50212)
FT                   /locus_tag="TM1040_0046"
FT   CDS_pept        complement(49724..50212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62779"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN7"
FT                   /protein_id="ABF62779.1"
FT                   /translation="MRGIKTFFLLSALAVTASCGAFRSLDTSTEVNDTDTIVLAGEGRE
FT                   ANDDKTTIWEAFGPRKSEQRVQVNRYLWAASLEVLDFLPVQSVDPFTGVIITGYGTPPG
FT                   GGRAYRATIHIKDPALEARALNVALQSRGGAVSSATARAVEDAILSRARQLRMADKKI"
FT   gene            50494..51438
FT                   /locus_tag="TM1040_0047"
FT   CDS_pept        50494..51438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62780"
FT                   /db_xref="GOA:Q1GKN6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN6"
FT                   /protein_id="ABF62780.1"
FT                   /translation="MKKILFASTALVATAGVAAAELTIGGSARFGLAYDESQTEETRIE
FT                   QRMRVNITGIAETDAGVKLEARFRLEANEDSHANDISGRGPGAAGFAVSYGGLRVDVGN
FT                   VSNVLDSGDQVDYYGYGVGFTSFLEHNANFNGPATGFGAGSQDATTIKARYNVGDFSAS
FT                   LSYKETRAQAAVANAPGVLGSTAVAADEEWQLGLGYTLANGMAIGAVYSDTDSSGDYWV
FT                   IGLNGTAGAVGYSVIVGDGDNQADASFGASINYEVSSATSIRAVVSDGGAANADTSYGL
FT                   GFRHGLGGGVTLAGGVGSKNDNTLADLGVSFSF"
FT   gene            51557..52213
FT                   /locus_tag="TM1040_0048"
FT   CDS_pept        51557..52213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0048"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62781"
FT                   /db_xref="GOA:Q1GKN5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN5"
FT                   /protein_id="ABF62781.1"
FT                   /translation="MSLSEIKSRIAAAESAAGRVPGSVELIAVSKVQPNERVEAVLEEG
FT                   HRCFGENRVQEAAGKWPQFREKFTGVDLHLIGPLQTNKARQAMELVNVIHSVDRPKLAN
FT                   ALARLAQELGHCPDLFIQVNTGEEEQKAGILPQDADGFVAECRKLDLPIKGLMCIPPVD
FT                   EEPSLHFALLAKMAERNGLNGLSMGMSGDFESAIALGATHVRVGSAIFGARAYSA"
FT   gene            complement(52205..52660)
FT                   /locus_tag="TM1040_0049"
FT   CDS_pept        complement(52205..52660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62782"
FT                   /db_xref="GOA:Q1GKN4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN4"
FT                   /protein_id="ABF62782.1"
FT                   /translation="MGRLLPCTIGKGGLSTAKREGDGATPVGTHHISGMLYRPDRISAP
FT                   QDWARPILPGDLWSDDTQARDYNQMVRAPYPFSHERLRRADPLYDLVLLTDWNWPNATS
FT                   GRGSAIFLHQWRRPGYPTEGCIAFSRQNLRWIAERLRPGAQLIVGSR"
FT   gene            complement(52702..53790)
FT                   /gene="ribBA"
FT                   /locus_tag="TM1040_0050"
FT   CDS_pept        complement(52702..53790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribBA"
FT                   /locus_tag="TM1040_0050"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62783"
FT                   /db_xref="GOA:Q1GKN3"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN3"
FT                   /protein_id="ABF62783.1"
FT                   /translation="MSLMPTMLERIARARVDLRMGLPVILTTGESAILAISVESLSPER
FT                   LTDLRSLGPVTLALTARRAATLKARVYDNDIARVTVPSDAGLAWVQALADPADDLETPM
FT                   KGPLLSEREGDASLPRLAIAMVKSARLLPATAYVALENAGDFALKHDLTLLPQSAAEPL
FT                   LNTSSPLHPVAAARLPMEASEAGRLHIFRPEDGGEEHYAIEIGRPDRSQPVLARLHSAC
FT                   FTGDVLGSLKCDCGPQLRGALSHMGQEGAGILLYLNQEGRGIGLANKMRAYSLQDQGFD
FT                   TVEANHRLGFEDDERDFRLGASILRELGFSSVRLMTNNPGKIAMMEKTGISVVERVPLK
FT                   VGENAFNRHYLATKAAKSGHML"
FT   gene            53960..54646
FT                   /locus_tag="TM1040_0051"
FT   CDS_pept        53960..54646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0051"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62784"
FT                   /db_xref="GOA:Q1GKN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN2"
FT                   /protein_id="ABF62784.1"
FT                   /translation="MAQLKKILLVDDDEDLREALSEQLVMTEDFDVFEAGDGQGAMERA
FT                   KEAIYDLIILDVGLPDTDGRELCRLMRKQGVKSPILMLTGHDSDADTILGLDAGANDYV
FT                   TKPFKFPVLLARIRAQLRQHEQSEDAVFVLGPYTFKPAMKILITEDERKIRLTEKETNI
FT                   LKFLYRSNNGVVPRDVLLHEVWGYNAGVTTHTLETHIYRLRQKIEPDPSNARLLVTESG
FT                   GYRLVA"
FT   gene            complement(54785..55993)
FT                   /locus_tag="TM1040_0052"
FT   CDS_pept        complement(54785..55993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0052"
FT                   /product="Gamma-butyrobetaine2-oxoglutarate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62785"
FT                   /db_xref="GOA:Q1GKN1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN1"
FT                   /protein_id="ABF62785.1"
FT                   /translation="MTGGHHRVVPLCAKAQTALTHDISNARRFLMAQAALQPQNACVLL
FT                   SFSDGTTAQYPYIWLRDNDPEGFHPDTQERITDLSAISPDITVADVELNDSQLLIHWEG
FT                   ADSATSRFDLDWLRSYVPGTRTADPARTGFQHWRCDLGAGGIPRATAQEILSSDLALRT
FT                   WLEQTQIYGISIVEGLADSTEAGMDVARRIGFLRQTNFGVTFEVKSKPNPNNLAYTPIA
FT                   LPLHTDLTNQELPPGFQFLHCLANEARGGGSLFCDGYAIAEDLRRDDPESFELLSTVSV
FT                   PFRFHDQDTDIRNRKKVITLDEDGRVIEICFNAHLADIFDLEPALMQRYYRAYRKFMIL
FT                   TRSTNYLVTLKLKGGEMVVFDNRRVLHGREAFDPQTGYRHLHGCYVDRGEFESRLRVLH
FT                   RGQ"
FT   gene            56222..57010
FT                   /locus_tag="TM1040_0053"
FT   CDS_pept        56222..57010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0053"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62786"
FT                   /db_xref="GOA:Q1GKN0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKN0"
FT                   /protein_id="ABF62786.1"
FT                   /translation="MSFTLATWNINSVRLREPIVVKLLEEEGPDVLCLQECKSPVDKIP
FT                   MEAFRALGYEHMIARGQKGYNGVAILSRLPIEDVGDKDFASLGHARHVAGRLENGVTIH
FT                   NFYVPAGGDEPDREKNVKFGQKLDYLTEMRDWFHAERPEKSVLVGDLNIAPREDDVWDH
FT                   KKLLKVVSHTPIEVEHLDQVMDAGGWADVTRKDIPEGQLYSWWSYRAKDWDAADKGRRL
FT                   DHVWTTADITNAAHSSRILRHARGWEKPSDHAPVFATFDL"
FT   gene            57235..58170
FT                   /locus_tag="TM1040_0054"
FT   CDS_pept        57235..58170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0054"
FT                   /product="Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62787"
FT                   /db_xref="GOA:Q1GKM9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM9"
FT                   /protein_id="ABF62787.1"
FT                   /translation="MMDILGGGASAAPAGDLIKDVTEETFMADVVEASMDVPVVVDFWA
FT                   PWCGPCKTLGPMLEAAVTKAKGAVKMAKINVDENQRLAAALAQQGLPLQSIPTVVGFYQ
FT                   GRPVDMFQGALPQSEIEAFLQKMAEAAGSTADGGLGEALETAEQMLEEGAAADAAQVFA
FT                   AILGEDDKNAAAYSGLARCHVAMGELDQAEAVLNGAPAEISTAAEIEAAHAQIELARQA
FT                   ENAGPVAELRAAVDANPDDHQARFDLAQALHAAGDAEAAVTELLELFRRDREWNEGAAK
FT                   AQLFTIFEALKPNDPVVLNGRRKLSSMIFA"
FT   gene            58198..58842
FT                   /locus_tag="TM1040_0055"
FT   CDS_pept        58198..58842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0055"
FT                   /product="peptidase S16 lon-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62788"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM8"
FT                   /protein_id="ABF62788.1"
FT                   /translation="MIKAADLPDTIPVFPLPGALLLPRAKLPLHIFEPRYLQMLEDVLK
FT                   TPNRVIGMIQPSHARNADGSGLHAIGCAGRVTQFSETEDGRYFITLSGLSRFRVKEEIE
FT                   GFTPYRRCAVDWAGFDMDLGPAECDDGFDRTALMGLLGRYLDARGMSTDWGALDEAGDE
FT                   LLVNSLSMLLDFEPEDKQALLEAPSLSTRRETLVTLMEFALRGGSLEEKLQ"
FT   gene            58839..59024
FT                   /locus_tag="TM1040_0056"
FT   CDS_pept        58839..59024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0056"
FT                   /product="protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62789"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKM7"
FT                   /protein_id="ABF62789.1"
FT                   /translation="MNETTPAFDRHMLEALVCPVTQTVLEYDAEAQELVSRAANLAFPI
FT                   RNGIPVMLTDEARPLE"
FT   gene            complement(59044..60270)
FT                   /locus_tag="TM1040_0057"
FT   CDS_pept        complement(59044..60270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0057"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase / 2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62790"
FT                   /db_xref="GOA:Q1GKM6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM6"
FT                   /protein_id="ABF62790.1"
FT                   /translation="MTDTRDILIVGGGLNGPSLALALAQAGHSVTLIDALPAPLREDAE
FT                   FDGRSYALALASTRLLQQIGIWAVIEDHAQPMNEIKVSDGVAGRGPSPLFLHFEESDLD
FT                   EGPMGYMVEDRYLRRALLKALEAEPKITQISGQPVIAQTVSADAITVTLEDGTQLSGAL
FT                   LVGADGRQSGTAARAGIKRTGWDYGQTALVCAISHAQPHNGIAHQFFMPPGPLAILPLP
FT                   GNRSSIVWSETHAEAARIQALSDQDYLSVLRPRFGSFLGEIDLEGKRFSYPLKLSLANA
FT                   FYGERLALVGDAAHGLHPIAGQGLNAGLRDIASLAEVLTDAARRGEDLASPLVLARYQQ
FT                   WRRFDTTSLALATDVFNKLFSNDNPILRATRDLGLGLTNALPGLRRGFVREAAGLSGDL
FT                   PRLLRGRPL"
FT   gene            60494..61825
FT                   /locus_tag="TM1040_0058"
FT   CDS_pept        60494..61825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0058"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62791"
FT                   /db_xref="GOA:Q1GKM5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM5"
FT                   /protein_id="ABF62791.1"
FT                   /translation="MQDWLTMSAAQLGRGIASGEIDPVALTEAYLTAIDSHPETARIYT
FT                   KVTHERARAEAKAAQERAKAGLRRSPLDGVPISWKDLFDSAGVETESGSDLLKGRIPDT
FT                   DALVLDTATALGSVCLGKTHMSELAFSGLGLNPIKATPPCVNDPEAVPGGSSSGAAASV
FT                   AFGLAAGAIGSDTGGSVRIPSAWNDLVGLKTTSGRVSLEGVVPLCLKFDTIGPLARSVE
FT                   DAALMLALIEGSATAPDLEGATVEGKRFADLRTVAQDDLAPEVATAHAAALDKLREEGA
FT                   EIVPLEVPELPDAMALSAILFTTEAYGLWKDVIEASPDLMFPEILARFRSGAEFSGSDY
FT                   VAAWAKLEQVRMAWDQAVAGFDAVLAPAAPILPPNLARLQSDHDYYVTSNLMALRNTRI
FT                   GNLMGVCALSLPTGTPSCGLQVIGQPDCEEALLRIGAGVEAALA"
FT   gene            61934..63112
FT                   /locus_tag="TM1040_0059"
FT   CDS_pept        61934..63112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0059"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62792"
FT                   /db_xref="GOA:Q1GKM4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM4"
FT                   /protein_id="ABF62792.1"
FT                   /translation="MKFPERFAHLPPYAFPRLRALLDHHAPGGDVVQLTIGEPKHEFPA
FT                   WVTDVIVENASAFNNYPQNEGSDALRGAMADWAAQRYGVTLDPATRVMALNGTREGLYN
FT                   AAMALCPEEKNGQRPVVLIPNPFYQVYMIAAISVAAEPVFVPATDETGHLPDYASLPEE
FT                   VLNRTAIAYICSPANPQGAVASREYWQQLFALAEKYDFKVFADECYSEIYRDTAPVGAL
FT                   TVADEMGLDPERVVLFNSLSKRSNLPGLRCGLLAGGPETLVQVKKLRAYSGAPIPGPLQ
FT                   AAAAKVWADEVHVAENRALYQEKYRIADEVFAGLNGYMSPEAGFFLWLPVEDGEAATLK
FT                   LWQETGVRVLPGAFLAQGKGAENPGHGYIRVALVASEEQTRASLQLLRDCLY"
FT   gene            63232..66279
FT                   /locus_tag="TM1040_0060"
FT   CDS_pept        63232..66279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0060"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62793"
FT                   /db_xref="GOA:Q1GKM3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM3"
FT                   /protein_id="ABF62793.1"
FT                   /translation="MAFQTRSRNPLLDSNMQAAIEKRGKELIGLVLIGVGLLVAAIIGS
FT                   YTPDDSNWMVSTDAPVQNWLGQTGATIAFLLITFLGKGAWAISVFLFAWGTRFLLHKGE
FT                   GRILWPALMLVFWLIVVALHFETLVPDEEWRAFHNAGLGGMIGNTALGALLALLPFGLA
FT                   FLVKSLSFLTAVAMIALGAFVLGFSRDELKRIGRFLLLGVLLAYDMIARLLGRGASGGL
FT                   QAARTWQQRRAERRSDAAYDDDALVYSDPVEPAAFTRAEPQFGLHAPAPTPEPHPEPAT
FT                   STEDRGGLFSRATNLIRRAEPVEMPEPELVEPQPVADVEHAPGDERIAQKIANAVRIRR
FT                   AQALPPEQDPNLPLTKGRGKRPEPLIFNAPAQEATTEPPLSAPVQQIPAAPTITSVIPQ
FT                   APQVEDTVSGPNEAFFVDEVPTEDLPQDPVTSKTAAPEPAPAPAVGSAPRVQITPRVDP
FT                   TPAAPVSEPRAAMAIPVAEPRKAVVEQPQRKPLQPSTRAKAEAQPNLFKEENSDFELPP
FT                   LSLLTNPTAIERHHLSDEALEENARMLETVLDDYGVKGEIVSVRPGPVVTMYELEPAPG
FT                   LKASRVIGLADDIARSMSALSARVSTVPGRTVIGIELPNENREKVVLREILASRDFGDG
FT                   NQHLPLALGKDIGGDSMVANLAKMPHLLIAGTTGSGKSVAINTMILSLLYKLTPEECRL
FT                   IMIDPKMLELSVYDGIPHLLSPVVTDPKKAVVALKWVVGEMEDRYRKMSKMGVRNIAGY
FT                   NGRVSEALAKGEMFSRTVQTGFDDDTGEPVFETEEFEPKKLPYIVVIVDEMADLMMVAG
FT                   KEIEACIQRLAQMARASGIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKVDSRTIL
FT                   GEMGAEQLLGMGDMLYMAGGAKITRCHGPFVSDEEVEEVVNHLKQFGPPDYVGGVVEGP
FT                   DDEKADNIDAVLGLNTGGNTNGEDALYDQAVGIVIKDRKCSTSYIQRKLGIGYNKAARL
FT                   VEQMEEEGLVSAANHVGKREILVPEQ"
FT   gene            66347..66943
FT                   /locus_tag="TM1040_0061"
FT   CDS_pept        66347..66943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0061"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62794"
FT                   /db_xref="GOA:Q1GKM2"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM2"
FT                   /protein_id="ABF62794.1"
FT                   /translation="MKQFVFALALGATSLASAAASAAEQLSLNEISAYLNSFATAKADF
FT                   TQVNDDGSLSTGTLYLRRPGKVRFEYADNAGLVLAEAGTVAIMDPKSNQPPETYPLSRT
FT                   PLSIILARNVNLAQANMVVGHGFDGVSTVVRAQDPKAPEHGSIEMMFTDNPVQLRKWVI
FT                   HGGSGEETTVILGEMQTGLSFPSSLFSISRPKRDR"
FT   gene            complement(67002..67589)
FT                   /locus_tag="TM1040_0062"
FT   CDS_pept        complement(67002..67589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62795"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM1"
FT                   /protein_id="ABF62795.1"
FT                   /translation="MSRIISALALLLALAACGGGYNSPPRDLDDACSIVTERPNYLRAF
FT                   KNTERRWGIPVHVQMATIHQESRFVGNARTPHRFALGIIPMGRISSAYGYGQALDGTWE
FT                   DYKDDTGRRRARRDRIEDATDFMGWYMTRSLQRNGIPLSDARNQYLAYHEGHTGYARGT
FT                   YRSKGWLLNVANKVEARSNAYQVQLSNCRKFR"
FT   gene            67820..68146
FT                   /locus_tag="TM1040_0063"
FT   CDS_pept        67820..68146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0063"
FT                   /product="Hemimethylated DNA-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62796"
FT                   /db_xref="GOA:Q1GKM0"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKM0"
FT                   /protein_id="ABF62796.1"
FT                   /translation="MLKTRAKYNLGQVVRHRKHPFRGVVFDVDPEFANTEEWYEAIPED
FT                   SRPAKEQPYYHLLAENEQTYYVAYVSEQNLVADYSGEPVTHPDLHEMFTGFDDGNYQLQ
FT                   YQLN"
FT   gene            complement(68184..69761)
FT                   /locus_tag="TM1040_0064"
FT   CDS_pept        complement(68184..69761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0064"
FT                   /product="gamma-glutamyltransferase 2. Threonine peptidase.
FT                   MEROPS family T03"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62797"
FT                   /db_xref="GOA:Q1GKL9"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL9"
FT                   /protein_id="ABF62797.1"
FT                   /translation="MRDFQTPGRSAVFAQNGLCATSHPLAAQVAVDVLKRGGNAMDAAI
FT                   AGAVLLGICEPQMTGIGGDCFVLYNRAGETTVRALNGSGRAPKAAQAADLRARGLEAVP
FT                   LNSADAVTVPGAIDAFCHLSETEGKLGLDALLAPSIHYAEEGVPVAPRVAFDWGNDAET
FT                   LQGSARDTYLINGRVPRVGEIFRAPGQAEVLRRIARDGRDAFYSGEIAEDMISALTTRG
FT                   GVHTAEDFAATQATATDPIQGHYKGVDLLEHPPNGQGATAILMLNILKHFDIAGMDPFG
FT                   AARAHIEAEAAKLAYDTRNRFLADPDHMSRLDYMLAPETAEKLAALIDPKRAMASPADI
FT                   SEAVHKDTIYITVVDKDRMAVSLIYSIFHGFGSGIASDKFGILLQNRGAGFCLEDGHAN
FT                   ELAGGKRPMHTIIPAMLAENGRITMPFGVMGGAYQPNGHARFVSNLRDFGMEPQAAMDA
FT                   PRAFTDRGVFNVERGYSDAVRAELTEMGHKVDIPTTAIGGSQAIHIHDTGVLEGASDPR
FT                   KDGCALGY"
FT   gene            complement(70069..70509)
FT                   /locus_tag="TM1040_0065"
FT   CDS_pept        complement(70069..70509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0065"
FT                   /product="putative anti-sigma regulatory factor
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62798"
FT                   /db_xref="GOA:Q1GKL8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL8"
FT                   /protein_id="ABF62798.1"
FT                   /translation="MVETFACSFRATEIEARRGIVLVVQRLKDMGIADTRVDEVQIALA
FT                   EAVNNVVEHAYAETATGDVLIRCNLHSDRLWVEIRDAGTPFPDAKLPEGKPALVDPSTP
FT                   LEDLPEGGFGWFLIRELASDIQYQRNPDNNQLSLCFEIQLTQ"
FT   gene            complement(70543..70887)
FT                   /locus_tag="TM1040_0066"
FT   CDS_pept        complement(70543..70887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0066"
FT                   /product="anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62799"
FT                   /db_xref="GOA:Q1GKL7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL7"
FT                   /protein_id="ABF62799.1"
FT                   /translation="MSLTSTEAGGAQVVTVNAQRIDAAMAIQFKEDMRTETEAGPSRVI
FT                   LDLSHVEFIDSSGLGAIVAAMKQLGKDRKLDLAGLTPMVDKVFRLTRMDTVFSLFDTLQ
FT                   EALDTEHAEN"
FT   gene            70985..72157
FT                   /locus_tag="TM1040_0067"
FT   CDS_pept        70985..72157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0067"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62800"
FT                   /db_xref="GOA:Q1GKL6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL6"
FT                   /protein_id="ABF62800.1"
FT                   /translation="MTKIVIAGAARTPMGGFQGMYDGVSAADLGGAAIKAALERAGATT
FT                   VDEVLMGCVLPAGQGQAPARQAGFAAGLGEEVPATTLNKMCGSGMKAAMVAYDQIALGH
FT                   SDVMVAGGMESMTNAPYLLPKMRGGARIGHGQVIDHMFLDGLEDAYDKGRLMGTFAEDC
FT                   AEHYQFSREEQDAFALGSLSNALAAQESGAFEGEITEVTVKTRKGAVVTDADEQPKSAR
FT                   PDKIPTLKPAFREGGTVTAANSSSISDGAAALVLASETAAAARGLSVRGHILGHASHAQ
FT                   APGWFTTAPVPAARKLMAQIGWDVEDVDLWEVNEAFAVVPMAFMREMGIPREKVNVNGG
FT                   ACALGHPIGASGARIMVTLLNALEKRGLKRGIAAICIGGGEGTAIAIERA"
FT   gene            72257..72724
FT                   /locus_tag="TM1040_0068"
FT   CDS_pept        72257..72724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0068"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62801"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL5"
FT                   /protein_id="ABF62801.1"
FT                   /translation="MRVNYEDLSKVVAALTEGETDEVALMATVVCELHHADDRFDWTGF
FT                   YRVTEPEVLKIGPYQGGHGCLVIPFARGVCGAAARLNETQLVDDVDAFPGHIACSSSTR
FT                   SEIVLPVRNRAGEVIGVLDIDSNQPAAFDRDDQDALETLLHAVFGRLPLQS"
FT   gene            72740..73369
FT                   /locus_tag="TM1040_0069"
FT   CDS_pept        72740..73369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0069"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62802"
FT                   /db_xref="GOA:Q1GKL4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL4"
FT                   /protein_id="ABF62802.1"
FT                   /translation="MSFDAWIIFTLFWIAFVTTPGPNAVNCISNGMNLGFAKAMLGVLA
FT                   ILTQACAFLILSALGVTALIAASPTAFFIAKLVGAGFLIALGIRGWRNATKPAPAAARP
FT                   ARHVYVHALAVATINPKSVAGYLAAFSQFVQPDVPIWSQMLVIMPTALTLTALSYAGFT
FT                   LLGALMGRAALAAVFNVWIRRLLGVCFIIYGVLLGLSSAPTPTAAP"
FT   gene            73397..73768
FT                   /locus_tag="TM1040_0070"
FT   CDS_pept        73397..73768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0070"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62803"
FT                   /db_xref="GOA:Q1GKL3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL3"
FT                   /protein_id="ABF62803.1"
FT                   /translation="MIKGHCLCGQIQFETTARPEASSMCHCSQCRRQSGGIWSSAHVTQ
FT                   DALHITGDVSWYNASPEAKRGFCATCGSFLFWKRSDEDTISFSLGAIDNPTGLKLEKHI
FT                   FVAEKGDYYDIADGVTQQS"
FT   gene            73920..74855
FT                   /locus_tag="TM1040_0071"
FT   CDS_pept        73920..74855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0071"
FT                   /product="rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62804"
FT                   /db_xref="GOA:Q1GKL2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL2"
FT                   /protein_id="ABF62804.1"
FT                   /translation="MSTKPENVDTPQGLSFALTAYIMWGFLPLYMKMLAHIPPTEVVAH
FT                   RVIWSVPIAGVLLLALGRMGDLKAALRSPRVLGMGCVTAAFVSINWGIYVWSVGAGYAL
FT                   EAALGYYINPLFSIALGALLLGERLTRAQMVAVGLATLAVVILTVEAGRLPLAALGLTF
FT                   SWGFYAFFKKSLPIGPNQGFLLEVLILTIPAIGYIAYLTTTGQSHFASVRFDTLLLLGC
FT                   GVVTAVPLIIYANGAKLLKLSTIAILQYIAPTMIFLVAVFVFKEPFGGARMVAFPLIWA
FT                   ALVIYSTSLLREMRRKGRQALTDAAPPREA"
FT   gene            74929..75582
FT                   /locus_tag="TM1040_0072"
FT   CDS_pept        74929..75582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0072"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62805"
FT                   /db_xref="GOA:Q1GKL1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL1"
FT                   /protein_id="ABF62805.1"
FT                   /translation="MTVSSEYCPPSDPLDILHHDAQLLVVNKPAGLLSVPGKGAHLADC
FT                   LIARIQAAFPEALLVHRLDRDTSGVMVFAMTPHAQRHLGLQFEKRMTKKAYVARLTGRL
FT                   EPRSGTVDLPLIVDWPNRPLQKVCHETGKPAHTDWKVISYGENETRVRLSPKTGRSHQL
FT                   RVHMQSLGHPILGDPLYASGAALEHPRMMLHSEELRLKHPEGGASQKFRVKAPF"
FT   gene            complement(75566..76279)
FT                   /locus_tag="TM1040_0073"
FT   CDS_pept        complement(75566..76279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0073"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62806"
FT                   /db_xref="GOA:Q1GKL0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKL0"
FT                   /protein_id="ABF62806.1"
FT                   /translation="MDFRAALGLRVASDAPPDDIRRAIARSDTAVVRSLCLVPDPGVIC
FT                   GKFLRLQRYCALEIRMAVQDVGDRSLRLAIDPAASQDRVEEQLIILHALMERAGLQVRT
FT                   SRQGVIHWQDAPPLPEVDTGTSQRLTDHLHHLIASDPARAWRIEETAAWLGLSTRSLQR
FT                   YLLAEGGRFSATLRHMRTSLASDMLRNSDQSLGEIGFCCGYADQAHFQREFRKVSGQTP
FT                   RRFRSQPRESVKTAL"
FT   gene            complement(76421..77863)
FT                   /locus_tag="TM1040_0074"
FT   CDS_pept        complement(76421..77863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0074"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62807"
FT                   /db_xref="GOA:Q1GKK9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK9"
FT                   /protein_id="ABF62807.1"
FT                   /translation="MLEKREFYINGQWVEPSAANDCAVIDPSTEEPCTVISLGSQADTD
FT                   AAVAAAKAALPGWMATPPAERIALVEKLVEIYNSRAEDLAQAMSSEMGAPIDMSRSSQV
FT                   GAGSWHLNGFIEAAKNFQFERPLGDHAPNDRIIYEAVGVAALITPWNWPMNQITLKFGA
FT                   AAIAGCTMVLKPSEQSPLNAMIFAELVHEAGFPPGVFNLVNGDGAGVGTQLSSHPDVDM
FT                   VSFTGSTRAGTAISKAAADTLKKVHLELGGKGANLVFEDADEKAVKRGVLHMMQNTGQS
FT                   CNAPSRMLVQKSIYDRVVEEAAAVANKVEVGPASQEGRHIGPVVNELQWTKIQDLIQKG
FT                   IDEGARLVAGGTGRPDGLNKGYYVKPTVFADVNNQMTIAREEIFGPVMAIIPFETEEEA
FT                   VEIANDTPYGLTNYVQTQDGARANRLARVLRSGMVEMNGKSRSAGSPFGGMKQSGNGRE
FT                   GGVWGLEDFMEVKAVGGWTPDA"
FT   gene            78109..78759
FT                   /locus_tag="TM1040_0075"
FT   CDS_pept        78109..78759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0075"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62808"
FT                   /db_xref="GOA:Q1GKK8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK8"
FT                   /protein_id="ABF62808.1"
FT                   /translation="MGLRINDVVPNFTAETDQGTITFHDWIGDSWAILFSHPKDFTPVC
FT                   TTEFSAVAQLSEEWAKRNTKVIGVSVDGVEDHKKWKGDIESYGNAPAGFPIIADEGLAV
FT                   SKAFDMLPAEAYLPDGRTPADSATVRSVFIIGPDKQLKLSMTYPMTVGRNFAEILRALD
FT                   GLQMSGKGVATPANWVPGEDVIIPPTVSNEDAKAKFGEFETIFPYLRKTKAPE"
FT   gene            complement(78842..79999)
FT                   /locus_tag="TM1040_0076"
FT   CDS_pept        complement(78842..79999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0076"
FT                   /product="Lipopolysaccharide biosynthesis protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62809"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK7"
FT                   /protein_id="ABF62809.1"
FT                   /translation="MSLPLWKIKRELKRQGRQLKNIGPRLASLLFSRTYYDLFLSGKKT
FT                   VTEGQIPKRPKVAVYLIFPSSGILGSHIEALRYLAQNGYAPVVVSNLPLDEGDLEHLRA
FT                   HAHLVIQRPNYGYDFGGYRDGVLEVAARHTSVERFVLLNDSAWFPLPGSRNWLADAEAL
FT                   ELDFAGAATNYGHTRVDPKNFRDIRWHYSSNHRNFHYCSFALMMSGKLFNDKRFQRFWK
FT                   SFPLTNDKTVTVRRGEIGLTKWVIQQGFSHGSTLDIAALDQRLAEYGIDELRAIAAQTL
FT                   MPQSPSMKEVLEDTVRSAESKEDLVNVILTAIARKGISYAQPRLIHRDYGFAFLKKSPL
FT                   WLDEDASNLTLAFTRDLDGEFGKVLQAEALDLRRTRAAEFAPAPD"
FT   gene            complement(80070..80933)
FT                   /locus_tag="TM1040_0077"
FT   CDS_pept        complement(80070..80933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0077"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62810"
FT                   /db_xref="GOA:Q1GKK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK6"
FT                   /protein_id="ABF62810.1"
FT                   /translation="MTRVTLVTVAYNSAAVLPTLLASIPAGVDCIVVDNGSKDPGEIRD
FT                   LAQAHGAEFIASERNIGFGRGCNLGAARATMEFLFFVNPDAQLAPGAIEALLAAADAHP
FT                   DACAFNPRLREGNGKVAFKRRSKLLPKAQWLPREAADADCELPVLQGSAIFVRRAAFEA
FT                   VKGFDPKIFLYHEDDDLSLRLKADCGPLRLVTGAEVVHLFGESTARSPRTAALKAWYMG
FT                   QSRVYACRKHGMPNAFGNALIEALSKLLSPLTLLSARKRAKHLAFLRGVLAARQCADAL
FT                   KPFDAR"
FT   gene            complement(81035..83170)
FT                   /gene="pnp"
FT                   /locus_tag="TM1040_0078"
FT   CDS_pept        complement(81035..83170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="TM1040_0078"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62811"
FT                   /db_xref="GOA:Q1GKK5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKK5"
FT                   /protein_id="ABF62811.1"
FT                   /translation="MFNVTTKTMQWGEETLTLETGKVARQADGTVIATLGETSVMANVT
FT                   YAREQKPGQDFFPLTVHYQEKYYAAGKIPGGFFKREARPTEKETLTARLIDRPIRPLFV
FT                   PGFKNEVLVMCTVLSHDLVNDPDIVAMIAASAALTISGVPFMGPIAGARVGYEDGEYIL
FT                   NPTVDDMQDLRLNPEQRLDLVVAGTKDAVMMVESEAYELTEEEMLGAVTFAHEQIQPVI
FT                   DLIVSLAEETAKEPFDFTPPDYSDLYAAVKAAGEEKMRAAYAISDKQERVAAVGAAKEE
FT                   IIASLTEEQQEDGNLGSALKKLESVVLRGDVVKNGRRIDGRALDQVRAIECQTGLLPRT
FT                   HGSALFTRGETQGLVVTTLGTGDDEQFIDALHGNFKSNFLLHYNFPPYSVGEVGRVGSP
FT                   GRREIGHGKLAWRALQAVLPAPTDFPYTIRVVSEITESNGSSSMASVCGGSLSMMDAGV
FT                   PLKAPVAGVAMGLVLEEDGSYGILTDILGDEDHLGDMDFKVAGTEAGITSLQMDIKVAG
FT                   ITPEIMKNALAQAKAGRLHILGEMAKSLTEASEFSQHAPRIETMQVPTDKIREVIGSGG
FT                   KVIREIVEVSGAKVDINDDGVIKIASANGEAIQKAYDMIHAIVAEPEEGAVYTGKVVKI
FT                   VDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFDDRGKVRLSMKV
FT                   VDQETGEEIVAEKKEAE"
FT   gene            complement(83364..83552)
FT                   /locus_tag="TM1040_0079"
FT   CDS_pept        complement(83364..83552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK4"
FT                   /protein_id="ABF62812.1"
FT                   /translation="MAAYDRLPAPLRAWLREAALPWSAQSCRRIWQAATREGLSPEAAL
FT                   ARLDAAERKTLERGVRS"
FT   gene            complement(83627..84841)
FT                   /gene="cobW"
FT                   /locus_tag="TM1040_0080"
FT   CDS_pept        complement(83627..84841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="TM1040_0080"
FT                   /product="47 kDa protein (P47K)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62813"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK3"
FT                   /protein_id="ABF62813.1"
FT                   /translation="MSDPRLPVTVLSGFLGAGKTTLLNRILNNREGRRVAVIVNDMSEV
FT                   NIDADLVREGGADLSQTEETLVEMSNGCICCTLRDDLLAEVRRLAAENRFDYLLIESTG
FT                   ISEPLPVAATFDFRDAEGESLSDVARLDTMVTVVDAVNLLNDFASHDLLADRGETLGEE
FT                   DERTLVHLLTDQIEFADVVVLNKVSLASAEQVDAARKIIRSLNADAEIIETDFSEVSAD
FT                   KILDTKLFDFEKAHEHPMWAKELYGFADHVPETEEYGIASFVYRARAPFDPSKLHVVLN
FT                   GNLPGVIRAKGHFWVATRPEWVAEFSLAGALSSVAPLGTWWASVPAERWPTHQQARDYI
FT                   QTHWQEPFGDRRQELVFIGAGIDWPALKATLDACLIPEATAETLQDYADLDDPFPLWRR
FT                   ADQAA"
FT   gene            complement(85005..85274)
FT                   /gene="rpsO"
FT                   /locus_tag="TM1040_0081"
FT   CDS_pept        complement(85005..85274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="TM1040_0081"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62814"
FT                   /db_xref="GOA:Q1GKK2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKK2"
FT                   /protein_id="ABF62814.1"
FT                   /translation="MSITAEEKTRLMKEFATKEGDTGSPEVQVAILTSRINTLTEHFKT
FT                   HKKDNHGRRGLLKMVAQRRKLLDYLKGKEEARYQDLIKKLGIRR"
FT   gene            complement(85539..86606)
FT                   /locus_tag="TM1040_0082"
FT   CDS_pept        complement(85539..86606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0082"
FT                   /product="type I secretion target repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62815"
FT                   /db_xref="GOA:Q1GKK1"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK1"
FT                   /protein_id="ABF62815.1"
FT                   /translation="MLWLASILGMVAVGSAIMIDFESDDADSDETNPDAEADGTGSTIV
FT                   SPDEFLTGVDPAGNDASDTTETDESPQVADGDDTDERNIILGTEDLDQLSGGATDDEIS
FT                   GLGGDDQINGYDGNDYLSGGAGADDLYGAAGEDTLHGDAGDDHLDGGEGQDSLSGGDGA
FT                   DSLLGGLEADSLQGDAGDDTLHGGSGADVVAGGAGSDAVHGNDDDDRVFGGAGEDTLFG
FT                   GRGNDVVTGADDDAERDFINGGDGDDTLIAGASDYVTGGDGADQILLGDWIAQGTVELV
FT                   DFNSAEDQLLLIYDSAQGLPELELEPDPDTPGQTLVRLDGEIAMRLTGAETLTADEILL
FT                   VEAEAGDVAHLPLPE"
FT   gene            complement(86710..87231)
FT                   /locus_tag="TM1040_0083"
FT   CDS_pept        complement(86710..87231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0083"
FT                   /product="protein of unknown function DUF1643"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62816"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKK0"
FT                   /protein_id="ABF62816.1"
FT                   /translation="MITRHHVKGDAPSTALYSDCETYRYSLTRIWEPQGQKVMFVMLNP
FT                   SKATEVQNDPTIERCERRARALGFGGFQATNIFAYRATDPRDMRAAADPEGADNMSVLQ
FT                   AGLDWADMVICAWGTHGAHRNQGPRVAAALRASGRPLHHLGLSKAGHPKHPLYIPYAQQ
FT                   PLLWRQDIEP"
FT   gene            complement(87460..88368)
FT                   /locus_tag="TM1040_0084"
FT   CDS_pept        complement(87460..88368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0084"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62817"
FT                   /db_xref="GOA:Q1GKJ9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKJ9"
FT                   /protein_id="ABF62817.1"
FT                   /translation="MGRKRKGRDISGWLVVDKPAGLTSTAVVNKVRWAFDAKKAGHAGT
FT                   LDPEATGVLAVALGEATKTVPFITDAMKAYTFTVTLGAATNTDDAEGEVIATSAERPTD
FT                   DDIKEALLGFIGEIQQVPPKFSAVKIDGQRAYKLARDGEEVELSARPLWVEELVMLDRP
FT                   DADHVVLEMTCGKGGYVRSIARDLGEKLGCLGHVRELRRIWSGPFDAEDGVTLEQIDAL
FT                   AKSPEIDQFLRPLEEGLADLPELKCTPQGATRLRNGNPGMVIASDVEYGEEAWASLEGK
FT                   AVAVGTFKAGELHPSRVFNQD"
FT   gene            complement(88426..89199)
FT                   /locus_tag="TM1040_0085"
FT   CDS_pept        complement(88426..89199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62818"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKJ8"
FT                   /protein_id="ABF62818.1"
FT                   /translation="MWRALLWGLPLGIVLWSGQASAVECQDLAYEGNRYALCEVDASRE
FT                   ELRLFLRDDTGAVMGHFSTIEDRLEAEGKTLAFATNAGMYHSDRSPVGLYVEDGSQEMR
FT                   LVTNPGPGNFGLVPNGVFCLREGRADVIETLAFEASGTTCKSATQSGPMLVIDGELHPR
FT                   FLKDSDSRYIRNGVGTSADGRRVVFAISRNTVNFHDFAGLFRDHLQLPQALYFDGNISR
FT                   LHAPDLQRSDAGFMMGPVVGVIEDRDTNEGDTLQN"
FT   gene            complement(89204..89599)
FT                   /locus_tag="TM1040_0086"
FT   CDS_pept        complement(89204..89599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0086"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62819"
FT                   /db_xref="GOA:Q1GKJ7"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKJ7"
FT                   /protein_id="ABF62819.1"
FT                   /translation="MAKNKFHDGPGPSQRQLRVGEVIRRTLSEVLARGDIHDPELNRLS
FT                   ITVGEVRTSPDLKIATAYVLPLGGKGQEDVLQLLARNKSELRRAIGKKTGLKFTPDLRF
FT                   QIDETFDRMDDTRRLFNQDAVRRDLED"
FT   gene            89693..90502
FT                   /locus_tag="TM1040_0087"
FT   CDS_pept        89693..90502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0087"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62820"
FT                   /db_xref="GOA:Q1GKJ6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKJ6"
FT                   /protein_id="ABF62820.1"
FT                   /translation="MTDKPGIVITGASGRMGQMLIKTVLDSDKAELAGVVEREGHDWVG
FT                   QDIGIAMGGAALGVVVTDDAGSAFAGAQAVIDFTAPQATIAFSKLAAEAGCVHVIGTTG
FT                   MSEAEIAQLDPAAQDTVLVRAGNMSLGVNLLVQLTKKVAAALDEDFDIEVIEAHHHHKV
FT                   DAPSGTALMLGEAAAEGRGVALAEVSDRGRDGITGARKKGDIGFSAIRGGDIVGEHDVL
FT                   FAAAGERIVLRHMATDRAIFARGALKAALWGQGKDAGAYDMIDVLGL"
FT   gene            complement(90697..90891)
FT                   /locus_tag="TM1040_0088"
FT   CDS_pept        complement(90697..90891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0088"
FT                   /product="protein of unknown function DUF1674"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62821"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKJ5"
FT                   /protein_id="ABF62821.1"
FT                   /translation="MSDTPESNRAKDLPAAAQRALAEAEERRKARDAEKPLPTELGGRD
FT                   GPDPARYGDWEKKGIAIDF"
FT   gene            90990..92264
FT                   /locus_tag="TM1040_0089"
FT   CDS_pept        90990..92264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0089"
FT                   /product="Fmu (Sun)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62822"
FT                   /db_xref="GOA:Q1GKJ4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKJ4"
FT                   /protein_id="ABF62822.1"
FT                   /translation="MTDHPSSASDARRAAVALLDKVLGEGLLLSECQTQILERLEPADR
FT                   ARAQRLALQVLRALERADRVLAKHLRKPPALHVRNALRLGTVELCSGGAAHGVVNDIVN
FT                   LVARHRRHGQLKGLVNAVLRKVATEGPGEWAKLRVPRLPKWLRAPLVQAWGSDAMLAIE
FT                   AAHFKGAPLDLSAKPGADLAALEGAMTPTGSLRLQDAGQVSALPGYEQGAWWVQDAAAA
FT                   LPAQLLNAARGERVLDLCAAPGGKTLQMAAAGAQVTAVDISENRLARLQENLTRTGLSA
FT                   TVVAGDVFEQKGQYDAVLLDAPCSATGTIRRHPDLPHAKDGAGFGGLIELQAQMLAHAW
FT                   GLVRPGGRLVYCTCSLLPDEGECQVEDMLEMFPGARIGDRLKSLSGIDPSWITEEGGLR
FT                   LRPDYWAEIGGMDGFYMAELVKAEV"
FT   gene            92456..94201
FT                   /locus_tag="TM1040_0090"
FT   CDS_pept        92456..94201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0090"
FT                   /product="Heparinase II/III-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62823"
FT                   /db_xref="GOA:Q1GKJ3"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKJ3"
FT                   /protein_id="ABF62823.1"
FT                   /translation="MSKYDRMASRGTRLLNRYTAWKARKQPAATGFVSQPEPRTIGSFA
FT                   RGRQLVAGNLLFAGYLVESDTTGLWDVEAPDFAFEAERQGCTWLDDLAAVGDLKARSKA
FT                   QHWVRGWIDEFGKGTGPGWSPDLTGRRVIRWINHALFLLSGQDKPASDAFYRSLSQQTW
FT                   FLSQRWKGASPGLPRFEALTGLIYAGLALKGCEELADPAVKALAQDCAQQINAEGGLPT
FT                   RNPEELLDVFTLLTWAAAALHEAGRSVPREHHAALDRIAPTLRALRHSDGALARFHGGG
FT                   RGQEGWLDHALAASHVPARPFEGLAMGFARLSARRTSLIIDATVPPVGKASYNAHASTL
FT                   AFELTSGRRPLIVNCGAGENFGLEWRRAGRATPSHSALCIEGHSSARLAAPQKGTGHEF
FT                   LIDAPTDVPIEREDLVDGYRFQGAHDGYAKSYGVTIARSLELSVDGRMVSGEDMVLALD
FT                   DAAKKCFDRALDAGGLRGIGYDLRFHLHPDVDAALDLGGAAVSMALKSGEIWVFRHDGQ
FT                   CDLKLETSVYLEKARLKPRQSLQIVLSGRAIQYATQIRWTLSKAQETAVAVRDLARDDP
FT                   MAYEE"
FT   gene            94226..95815
FT                   /locus_tag="TM1040_0091"
FT   CDS_pept        94226..95815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0091"
FT                   /product="IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62824"
FT                   /db_xref="GOA:Q1GKJ2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKJ2"
FT                   /protein_id="ABF62824.1"
FT                   /translation="MTDLHPVRRALLSVSDKTGLIELGKSLAERGVELLSTGGTAKALR
FT                   DAGLTVKDVSEVTGFPEMMDGRVKTLHPMVHGGLLALRDNDAHVAAMTDHGIGEIDLLV
FT                   VNLYPFEAALKRGAAYDEMIENIDIGGPAMIRAAAKNHAFVNVVVDVEDYGVLLEELDQ
FT                   NDGQTSFAFRQWLAQNAYARTAAYDAAVSNWMAGAIGLDAPRRRAFAGQIAQTLRYGEN
FT                   PHQDAAFYTDGTERVGVATAEQLQGKELSYNNINDTDAAFELVSEFAPEDGPAVAIIKH
FT                   ANPCGVARGATLLEAYNKAFDCDRTSAFGGIVALNMPLDAETAEAITQIFTEVVIAPGA
FT                   SDEAKAIFAAKKNLRLLITEGLPNPQDAGLTTRQVSGGMLVQDKDVGHRAMDDLKVVTE
FT                   KAPTEEQMADLLFAWKVAKHVKSNAIVYVKDGQTVGVGAGQMSRVDSATIAGVKAQRMA
FT                   DAMELPESLAKGSAVASDAFFPFADGLMEAASNGATCVIQPGGSMRDDEVIKAANDAGL
FT                   AMVFTGMRHFRH"
FT   gene            95835..96317
FT                   /locus_tag="TM1040_0092"
FT   CDS_pept        95835..96317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0092"
FT                   /product="signal peptidase II. Aspartic peptidase. MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62825"
FT                   /db_xref="GOA:Q1GKJ1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKJ1"
FT                   /protein_id="ABF62825.1"
FT                   /translation="MRSYALYLAALIALIVDQATKIGVVFGLDLVRVLRIDVAPPLLNF
FT                   RYGENRGINFGLFNDGGDSSRWILIGISLIICAAVFLWVRRSHANSRLMLISAGLVIGG
FT                   ALGNVLDRVLYGYVLDFLNMSCCGINNPYVFNVADVFIFAGAAGLILFEGRAKKPA"
FT   gene            96470..96976
FT                   /locus_tag="TM1040_0093"
FT   CDS_pept        96470..96976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62826"
FT                   /db_xref="InterPro:IPR021395"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKJ0"
FT                   /protein_id="ABF62826.1"
FT                   /translation="MRFVTAPIILSSVLLLGACANKPLHDLDARRNSPDEFLVLPSKPL
FT                   EQPESYAALPEPTPGGSNRTDRNPQAEAIVALGGRPSGAGIPASEGTLVAAASRYGVEG
FT                   DIRETLTAEDTKRRKRAGILANIKLFPVDRYAETYEDDALDPQRVSAAYRRAGVPTPSS
FT                   PPNGE"
FT   gene            97110..98543
FT                   /locus_tag="TM1040_0094"
FT   CDS_pept        97110..98543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0094"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62827"
FT                   /db_xref="GOA:Q1GKI9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI9"
FT                   /protein_id="ABF62827.1"
FT                   /translation="MTTEAAILSGLRASWRSALCAVVMATGLGAPGLMAQETSVDGAGA
FT                   AQTSQSGAEMVTTFTLENGMMVVVVEDHRAPVVQHMVWYRAGSADEPVGQSGVAHFLEH
FT                   LLFKGTDTLEAGELSATVARNGGRDNAFTSYDYTAYFQRVAADRLELMMQMEADRMRNL
FT                   RLTETDIVTEREVILEERNQRTDNDPTALFREQMRAVQYLNHRYGQPVIGWRHEMETLS
FT                   MEDALSYYGTYYAPNNAILVVSGDVQPEAVRKLAETYYGVIPANPDLPERLRSEEPPQT
FT                   AARRLTFADPRVSQPYVQRSYLAPERDSGSQEKAAALYLLSQLLGGGSTSYLANALQFE
FT                   QQVAVYTAAFYSGVSLDDTTFDFVIVPADGVTLDEAEAALDRSVAQFLEAGVDTAQLDR
FT                   IKLQLRASEIYARDDVDRIANRYGRALTSGLTVEDVQDWPRVLQSITEDEIIAVAREVL
FT                   RPQASVTGYLIQSPQEVAQ"
FT   gene            98540..99913
FT                   /locus_tag="TM1040_0095"
FT   CDS_pept        98540..99913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0095"
FT                   /product="peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62828"
FT                   /db_xref="GOA:Q1GKI8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI8"
FT                   /protein_id="ABF62828.1"
FT                   /translation="MSRFKTARRARAFDMRPVKRALMALCLGFALMFAAQMARAEIDIK
FT                   EVTSPGGIKAWLVEDHSIPFAALELRFRGGTSLDAPGKRGAVHLMGGLLEEGAGELRAQ
FT                   DYARALEALAADFSYDADKDTVSISASFLSENRDDVMELLRQTIQEPRFDQDALDRVRA
FT                   QVLVGLRSDQTDPNAIAGKTFAQQAFGDHPYGSDGKGTIESVSALTRQDMFAAHEAVFA
FT                   RDRLYVSAVGDITPEALGALLDELLGDLPAEGAPMPGPAEVLLTGGTTVVPFATPQSVA
FT                   LFGQKGMDRNDPDFFAAYVLNQILGGGSFETRLMQEVRTKRGLTYGVYSYLVPRDLAAT
FT                   YMGSFASANEKMAEAVGVVRDQWQALVESGVTEAELQDAKTYLTGAYPLRFNGNSQIAS
FT                   ILVAMQMDGLSTDYVVTRNQKVEAVTLEDVNRVAKELLDPEGLRFVVVGEPEGLSSTD"
FT   gene            complement(100018..102360)
FT                   /locus_tag="TM1040_0096"
FT   CDS_pept        complement(100018..102360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0096"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62829"
FT                   /db_xref="GOA:Q1GKI7"
FT                   /db_xref="InterPro:IPR011408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI7"
FT                   /protein_id="ABF62829.1"
FT                   /translation="MTIKEIFETMDYGPAPENAAEALAWLVDQGSQFGHFINGDFTAPG
FT                   TVFESKNPATGEVLAELTQATQKDIDAAVKAARAAQEGWAAMGGSGRATYLYAIARLLQ
FT                   KHSRLFAVLETLDNGKPIRESRDIDVPLVQRHFYHHAGHAQLMDDEMSDRAALGVCGQI
FT                   IPWNFPLLMLAWKVAPALAMGNTVVLKPAEYTSLTALLFADICRQAGLPKGVVNIVTGD
FT                   GAVGEMIVNAEVDKIAFTGSTSVGRKIREATAGSGKALTLELGGKSPYIVFDDADLDSA
FT                   IEGLVDAIWFNQGQVCCAGSRLLVQEGVSERFHQKLRARMKTLRLGDPLDKCIDIGAVV
FT                   DPVQHAEISRLVASATNCTVHQSAVNMPAKGCFFPPTLIEGLSPSDPLMQEEIFGPVLV
FT                   STTFRTPAEAVELANNTRYGLAATLWTENVNLALDVAPKLVAGVVWVNGTNMFDAAAPF
FT                   GGVRESGFGREGGVEGLMAYTKPKAQSEALQPVVAFEGNAKSATPEGIDRTAKMFVGGK
FT                   QARPDSGYSKPVYGPKGDLLGHVGLGSRKDVRNAVEAANAAKGWAKTTGHLRAQILYYL
FT                   AENLAARAGEFAARIDAMTGKGEGAAEVEASLQRLFSAAAWADKYDGLAHGVPIRGVAL
FT                   GMKEPVGTIGVLCADEAPLLGLVSAMAPAIAMGNRVVLAASEAFPLAATDLYQVLETSD
FT                   VPAGVVNILTGPHKDLGDTMAKHLDIDAVWSFSSSDLSKMIEAASAGNLKRTWVNNGHA
FT                   FDWSRDQSKRFLQAATEVKTVWIPYGE"
FT   gene            complement(102371..103426)
FT                   /locus_tag="TM1040_0097"
FT   CDS_pept        complement(102371..103426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0097"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62830"
FT                   /db_xref="GOA:Q1GKI6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI6"
FT                   /protein_id="ABF62830.1"
FT                   /translation="MDSQTAEDGTQPPKTSAAKPSAKAKPTAAATQDHEHSDLPRNPGI
FT                   ALDLDWALSLEANTSAIERRCASLPGRRSVKKDYQAAWLLKAISLIDLTTLSGDDTEAR
FT                   VRRLCAKARQPVRADILSALGIDGITTGAVCVYHDMIPAAVRALHGTHIPVAAVSTGFP
FT                   AGLSPFHLRLEEIRESVRAGAKEIDIVISRRHVLSGDWQALYDEMKAFREACGDAHVKA
FT                   ILATGELGTLRNVARASMICMMAGADFIKTSTGKESVNATLPVSLVMIRAIREYYERTG
FT                   FHVGYKPAGGISKAKDALVYLSLMKEELGNRWLQPDLFRFGASSLLGDIERQLEHHVTG
FT                   AYSAGYRHPMA"
FT   gene            103637..104599
FT                   /locus_tag="TM1040_0098"
FT   CDS_pept        103637..104599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0098"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62831"
FT                   /db_xref="GOA:Q1GKI5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI5"
FT                   /protein_id="ABF62831.1"
FT                   /translation="MLNRRHTLLGLGAVAALAATPVVATEGRLDVVATTGMIADAARQI
FT                   GGADVEVTALMGAGVDPHAYRQTRSDIAAMTRADLVLWHGLYLEAQMEDFFHGLARKRE
FT                   VVAVAEAMPKDLLRGHDDYADKFDPHVWMSPELWKHVVREVARALTAARPALADRFAAN
FT                   LERHLGELDRLSDYGRRVVSGVPQENRVLVTAHDAFGYFGRDYGFEVMGLQGISTQSEA
FT                   GLNRIGALVDTLVERQIKAVFVETSVADRSMRALIEGAAAKGHAVAIGGELFSDAMGAD
FT                   GTYEATYVGMLDHNFTTIAGALGAEVPGAGMDGKLGAGH"
FT   gene            104599..105405
FT                   /locus_tag="TM1040_0099"
FT   CDS_pept        104599..105405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0099"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62832"
FT                   /db_xref="GOA:Q1GKI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI4"
FT                   /protein_id="ABF62832.1"
FT                   /translation="MMQLSLASHNGQTAPDTQWDQSPLAIRGLTVSYGEKPAVFSVDMT
FT                   VEPGQMTAIIGPNGAGKSTLLKAALGIVPPVSGRVQVFGRPLDHQRARIAYVPQRASVD
FT                   WDFPTRVIDVVMMGLYRELGLLGRIRGTHHKIARDCLERVGMSEFATRQIGQLSGGQQQ
FT                   RVFLARALAQGADLYLLDEPFAGVDAATEKAIIGVLKALRAEGKTVVVVHHDLATVGDY
FT                   FDNVFLINTRKVAEGPVAEAFTAENLQTAYGGRLATAQIEQIARPL"
FT   gene            105437..106639
FT                   /locus_tag="TM1040_0100"
FT   CDS_pept        105437..106639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0100"
FT                   /product="ABC-3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62833"
FT                   /db_xref="GOA:Q1GKI3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI3"
FT                   /protein_id="ABF62833.1"
FT                   /translation="MLIDALFLQLGYNATLVAIGAALLGAASGITGTFLFLRKRALVSD
FT                   AVSHATLPGVCVAFLILVALGGDGRSLAALLVGSAVSAGIGLWCMNWLTRNTRLAEDAA
FT                   IGAVLSVFFGFGVVLLTVIQTLGVGRQAGLEGFLLGSTAGMLYSDALVIASGGAAVLLV
FT                   ILLTRRPMTMVAFDPEYAAARGLPVDKIDLLMMGLVMAVTVVGLKVVGLILIVALLIIP
FT                   PVTARFWTERADYVVILAGGLGAVAAYLGAVVSALAPNLPTGPIIVLMSFALFALSLLV
FT                   APNRGVLAAVLRHRRFQRRVHIRQGLLALAQAQTIYEPLTLRLLSRAGLVRADGVATKA
FT                   GQARAAKALRDERRWDILRRDQAQEAAAALYDGLREIETVLTPDQIAEIDRKIGTPREA
FT                   F"
FT   gene            106640..107566
FT                   /locus_tag="TM1040_0101"
FT   CDS_pept        106640..107566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0101"
FT                   /product="ABC-3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62834"
FT                   /db_xref="GOA:Q1GKI2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI2"
FT                   /protein_id="ABF62834.1"
FT                   /translation="MGSEFVTLSLTPLLIGIFAAVACALPGNFLLLRKQALIGDAISHV
FT                   ALPGIVVAFLLTGAISTWPMMLGAAGAAVVAVVMIEGIRRLGRIEPGAAMGVVFTTLFA
FT                   AGVLLLEQSDTSSVHLDVEHALYGNLESLIWLDGTGWGSLLDPEALAYLPVELPRMAAT
FT                   LVVVAGFIALFWRPLNISTFDEGFARTMGLRTDLLGLALVIMAAIAAVAAFDAVGSIIV
FT                   IAMFICPPAAARMMTNRLEIQIAWSVVFATLSAILGYVLAGYGPLWIGMNDAVSAAGMI
FT                   ATVSGVILALAALFGPCRTRAGAPSGV"
FT   gene            107657..109591
FT                   /locus_tag="TM1040_0102"
FT   CDS_pept        107657..109591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0102"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62835"
FT                   /db_xref="GOA:Q1GKI1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI1"
FT                   /protein_id="ABF62835.1"
FT                   /translation="MATLDPQISEKPPIEAPAKPARPVIRQLDDGAINRIAAGEVVERP
FT                   ASAVKELVENAIDAGATRITVEIADGGKTLIRVIDNGCGMTPEDLPLALSRHATSKIDG
FT                   SDLLNIHTFGFRGEALPSLGAVGRLAITSRAEGHDAAQIRVSGGHMEPVRPAALRQGSI
FT                   VELRDLFFATPARLKFMRTDRAEMQAISDTVKRLAMAEPSVGFTLRDVSGGGEGRVTFR
FT                   ADPMNGDLFDALHGRLAHVIGREFAENALKIDATREGIRLYGYAALPTYSRGAAVTQFL
FT                   FVNARPVKDKMLTGALRAAYMDFLSRDRHPAAALFIDCDPTLVDVNVHPAKSEVRFRDP
FT                   GLARGLIVSALRHALAEAGHRASSTVAGATLGAMRPEQPTATGAPRVYQMDRPSLGARH
FT                   SAYAAQTPAQPQAPSYAAPPPSDAVGFAEFSGTYSGRLVEETPLEEAQPPAEDQPLGAA
FT                   RGQVHENYIIAQTRDGMVIVDQHAAHERLVYERLKRQLAENGVATQGLLIPEIIELSDG
FT                   DCARLLEVAEDLARLGLGIEAFGGSAVAVRETPAILGEVNAEAMIRDILDELADQGESQ
FT                   LVQARLEAILSRVACHGSIRSGRRMRGEEMNALLREMEQTPHSGQCNHGRPTYVELKLA
FT                   DIERLFGRS"
FT   gene            109602..110837
FT                   /locus_tag="TM1040_0103"
FT   CDS_pept        109602..110837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0103"
FT                   /product="protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62836"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKI0"
FT                   /protein_id="ABF62836.1"
FT                   /translation="MDGMEIAIANMSAAGPVLWAAGAGMLLVLVLLFQSWRTSARTARA
FT                   LEPLSQQMHTLGHVAQQLSAGQDALRGNLQTVSDTQAHAQMQILQTMEARLGDVQQRMN
FT                   DRLAENAMKQARAMSEMQERMAESLHGNAKRTATSLTQLQERLAVIDKAQDNITKLSGD
FT                   VLSLQDILSNKQTRGAFGEIQLNDIVSKALPSDSYAFQHTLSNGKRADCLIHLPNPPGP
FT                   IVIDSKFPLEPYEALRGAETQEARAQAARLLKGALRKHIRDIAEKYILEGETADGALMF
FT                   LPSEAVYAELHANFSDVVREGFSLKVWIVSPTTCMATLNTMRAILKDARMREQAGAIRQ
FT                   ELGLLHKDVERLGDRVGNLDRHFAQAQRDISDIKISADKAGRRAQRLDNFDFEDLNPES
FT                   VSRVVALEHPGE"
FT   gene            110834..112147
FT                   /locus_tag="TM1040_0104"
FT   CDS_pept        110834..112147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0104"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62837"
FT                   /db_xref="GOA:Q1GKH9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH9"
FT                   /protein_id="ABF62837.1"
FT                   /translation="MRPLRHRRTAPDAALLREAELRAEKVVSILRIFVALGLMVVFFLA
FT                   VGEPPEEIADFLREQWIFAVLSMLSYLLLGVFSLWLARSGRFRRWMIWPVVTLDCLFML
FT                   VNAWVGLENISMPGALTFLLPPTWLVPVVMAFAVLRFNPYLQAYCVVLIVAGLGYLSFV
FT                   SDVTVSPDAINRIKHLVSVPPNIVRLTMILLAGVVLVVAAAALRDLLHRTLIETEKRLL
FT                   LTRYLPARLADRIQGETLADVRQEQRQDMAVMFVDIRGFTSWAEGRDPAEVGAFVTEYR
FT                   IRVQKAARETGGMVDKFIGDGAMLLFDGEAAPQRALECAQRLSEEVQDWSETRLKAGRS
FT                   AVSVGIGLHWGEVFSGVVGDEDRLEYTALGDTVNIAARLEQMTKACAMEIIVSDAVLAA
FT                   AGEPAREGWIALEPAPLRGRNQPLALFGQKERPRREAC"
FT   gene            112226..112549
FT                   /locus_tag="TM1040_0105"
FT   CDS_pept        112226..112549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62838"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH8"
FT                   /protein_id="ABF62838.1"
FT                   /translation="MTEIASNKAEQVALMAREIERAEPELRAFIADMNEDEQAELVALV
FT                   WTGRGVFEAEEFEQAVETARREKTTPTEDYLLATPNLAYDIEAGLEALGIDVTAAAEDV
FT                   MGR"
FT   gene            complement(112632..113774)
FT                   /locus_tag="TM1040_0106"
FT   CDS_pept        complement(112632..113774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0106"
FT                   /product="Saccharopine dehydrogenase (NADP+ L-glutamate
FT                   forming)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62839"
FT                   /db_xref="GOA:Q1GKH7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH7"
FT                   /protein_id="ABF62839.1"
FT                   /translation="MTIHWCGTGLSAIPGLRRLLEAGHDVAVWNRTPEKAAEAVGDLTT
FT                   NIHKFSIARLSELLSPADVVVSMLPGDWHVELAELAISKGAHFVSSSYISPEMRALDQK
FT                   AKDAGVALVNEVGLDPGIDHLMAHALVAEYAESPAFDADNEISFLSYCGGIPKIPNPFR
FT                   YKFSWSPLGVLKALRSPSRSIRDFEVLDVARPWDAISSYDAPLATPETFEVYPNRDSLP
FT                   FMEQYHFDKDWKVKTFVRGTLRLNGWTEAWADVFKEVETLEGPEGDARLKEMSDQFWDE
FT                   NAYDEGEPDRVVLCVDLKAEKDGQTKWHKTYVMDAWGDERGSAMARLVSYPVSYAIEAA
FT                   MNGKIAPGVSAAPSDPALVDSWMGRIGALAQHLQVVSHRS"
FT   gene            complement(113804..114856)
FT                   /locus_tag="TM1040_0107"
FT   CDS_pept        complement(113804..114856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0107"
FT                   /product="saccharopine dehydrogenase (NAD+,
FT                   L-lysine-forming)"
FT                   /EC_number="1.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62840"
FT                   /db_xref="GOA:Q1GKH6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR027281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH6"
FT                   /protein_id="ABF62840.1"
FT                   /translation="MTHLWVRAEQRLNEDRVGLTPAGAKALLEAGIRVTVEESSSRAIP
FT                   LQGYIDAGCEIAPENAWPDAPRDAIIFGLKELPDDGTPLPHRHIMFGHAFKGQHSGKEL
FT                   LRRFREGGGTLYDLEYLVDPSGRRVAAFGYWAGYAGAAVTLKAWAAQQRGETCGPVGVY
FT                   KNKDALLADLGRELDATGADRPKAIVIGALGRVGTGAADLCEAMGVAVTKWDMNETASG
FT                   GPFPEILDHDLFLNCIFARPGTPVFVPKEALTAARNLTAIGDVACDPDSDYNPVPVYSR
FT                   ATTWDAPVVRVANDPVLDVMAIDNLPSMLPAESSEDYADQLLASLLTLSDLDAGVWGRA
FT                   KAVFDEHVAG"
FT   gene            complement(114868..115482)
FT                   /locus_tag="TM1040_0108"
FT   CDS_pept        complement(114868..115482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0108"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62841"
FT                   /db_xref="GOA:Q1GKH5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH5"
FT                   /protein_id="ABF62841.1"
FT                   /translation="MQLYYAPNTISVAVAIALEEAGLAYEAVKIDFAEKQQTTRAYHQI
FT                   NPKGRVPALAVEGGILTETGALLEFIADLAPDADLRPSDPVLQARMREVMFYLASTMHV
FT                   NHAHKMRGSRWASNPASFKDMARKVPETMAASCEYICNHGLRGPFVLGDTPCLADFYLY
FT                   VVCTWLEGDGVKLAGFPKLRAFIEAMDARDSVKTVRAKDML"
FT   gene            complement(115503..116159)
FT                   /locus_tag="TM1040_0109"
FT   CDS_pept        complement(115503..116159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0109"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62842"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH4"
FT                   /protein_id="ABF62842.1"
FT                   /translation="MSEITLVRHGQANTAARDEASYDKLSPLGHQQAQWLGDHLRDCKD
FT                   HYARVYCGTLTRHEETARAMGFDAGDIIRDPRLNEMEYFTLAQAMEAQHGLAIPKEREG
FT                   FVAHLPKVFAAWEADCIDTPPESWRDFETRTKAALAEISEGEGPALVVTSGGLISMVMR
FT                   QCLGLDTAATARIALAIMNTSLHRLHNIGGTYAPVLFNGVPHLQAPDRQYARTHL"
FT   gene            complement(116273..116500)
FT                   /locus_tag="TM1040_0110"
FT   CDS_pept        complement(116273..116500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62843"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH3"
FT                   /protein_id="ABF62843.1"
FT                   /translation="MATCLLYNHSESRPARFYRIELAMNLFDEVSLLREWGVKGGKGCS
FT                   TIHIFGNLRDASVAADRHRHRMLKRGYDRA"
FT   gene            complement(116589..117308)
FT                   /locus_tag="TM1040_0111"
FT   CDS_pept        complement(116589..117308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0111"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62844"
FT                   /db_xref="GOA:Q1GKH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH2"
FT                   /protein_id="ABF62844.1"
FT                   /translation="MPDANASPLVTILDDEPEIRQLLTETLEDAGYRTQSFSRARDFEA
FT                   ALKRVTPDVCLVDLSLPDTDGLALVHRLALEQGASVIIISGRAQVQDRVTGLELGADDY
FT                   ITKPFDPAEVVARIRVRLRDTSRGGQPDTGDRAEFSGWTAHFDRYALEDENGEETAFSH
FT                   AEGEVLRLFLESPKRLISRAQMMERLGGGAGDSFDRAMDVRISRLRTKLREDPKNPRLI
FT                   KTIYGAGYIFLGDVSWR"
FT   gene            complement(117301..119205)
FT                   /locus_tag="TM1040_0112"
FT   CDS_pept        complement(117301..119205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0112"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62845"
FT                   /db_xref="GOA:Q1GKH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH1"
FT                   /protein_id="ABF62845.1"
FT                   /translation="MKQNTAQRMAMIDAGLNLIAQAMSIYDRNLRLAACNHRFQEMFSL
FT                   PPELVQEGATFEDTIRFIAVQGDYGPIDDIDSFVQLRVEQARAFVPHYVERQRANGHVI
FT                   SIEGAPLPEGGWVTVYTDITRTKRVEELLRARSEELSDQVMSYTEELSATNRKLAATIT
FT                   TLEETQRQLTQTEARTRLTTEMMPAHIAHVDADGHYTFTNGRLSKVFPGRPSDILGQHI
FT                   AEALGSAAYARIAPHLSAAYQGESPVFEFTEDQDSRRLRVAFTPDNEGGVFILSMDVTE
FT                   ETQTRVALQQARKREIAAQMTSGLAHDFSNLLTIILGMQTRLDRMTLPEGAGELVEATL
FT                   SAARRGGRLLDRMAEMTSHRGLRPQATDLHALLDEMKILATPSLPQGIGLSVLDNTSEG
FT                   PVLLDPGRLQDALLNLILNARDACGTSGQITVAAHLVGQTWIEFSVSDTGPGFSVQALE
FT                   NALNPFFTTKGQEGSGLGLSMVYDMVKSAGGDIRISNTVSGAMVTLRLPYRPAPMAAGG
FT                   IALLVEDSDTLRATYRQVLMDLGYSVIEATSVDEAVALLADVEGIALILSDIKLEGDAT
FT                   GVDLCTRLGPDAPPVVLMTSLPHTDPLYRAALTLAPLLPKPFESAHLMALLQQKADHA"
FT   gene            119466..121451
FT                   /locus_tag="TM1040_0113"
FT   CDS_pept        119466..121451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0113"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62846"
FT                   /db_xref="GOA:Q1GKH0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKH0"
FT                   /protein_id="ABF62846.1"
FT                   /translation="MSQTAAQTSSGAGQLMSVPALLERNATVHANRPAYREKEFGIWQS
FT                   WTWKETAEEIEALALGLMNLGVAEGDFIAIIGRNRPSLYWSMVAAQSVGAVPVPVYQDS
FT                   SAEEMAYVLDHCGAAYVIAGDQEQVDKVLEVQDTLTNLKHMIYVDPKGLRKYDHHQLHQ
FT                   YSHVQEQGRAARDELSSDLAARKAKLTYDSTCVMLYTSGTTGRPKGVVLSNRNVIESAK
FT                   NASTFDKLTENEDILSYLPMAWVGDFIFSLGQSYWCGFCVNCPESEDTMMTDLREIGPT
FT                   YFFAPPRVFEGQLTNVMIRMEDAGKLKQKMFHHFLAHAKKVGGLILDGKPVGMMDRLKY
FT                   RLGDLLVYGPLKDTLGYGRIRVGYTAGEAIGPEIFDFYRSLGINLKQLYGQTEATVFIT
FT                   VQPDGEVRADTVGVPAPDVEIKIDDKGEIHYRSPGTFVEYYKNAESTASTKDAEGWVAT
FT                   GDAGFIEESSGHLRIIDRAKDVGKMASGAMFAPKYVENKLKFYPDILEAVLFGNGRDRC
FT                   VAFINIDLTAVGNWAERNNIAYASYQELAGHPRVLETIRNHVEAVNVSVAQDEMLSGCQ
FT                   VHRFVVLHKELDADDGEMTRTRKVRRRIVEEKFADIIAALYDGSEQISTRTEVTYEDGR
FT                   KGAISATLTCVDAKVQSPMAQQVAAE"
FT   gene            121536..122354
FT                   /locus_tag="TM1040_0114"
FT   CDS_pept        121536..122354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0114"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62847"
FT                   /db_xref="GOA:Q1GKG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG9"
FT                   /protein_id="ABF62847.1"
FT                   /translation="MLDAADSYVTEDGRTIGGVVMEMKNITLRFGGVVAIKDISFDIRE
FT                   GEIRAIIGPNGAGKSSMLNVISGFYVPQEGEVWFHGAKRPPMKPYEVARQGIARTFQNI
FT                   ALFDGMSVLDNVMTGRLNYMKAGMFQQAFWKGRAEKEEVENREVVEKIIDFLEIQAIRK
FT                   TPVARLPYGLKKRVELARALAAEPKLLLLDEPMAGMNVEEKEDMSRFILDVNDEFGTTI
FT                   ALIEHDMGVVMDLSDRVVVMDYGKKIGDGTPDEVRNNQDVIDAYLGVSHD"
FT   gene            122393..123379
FT                   /locus_tag="TM1040_0115"
FT   CDS_pept        122393..123379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0115"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62848"
FT                   /db_xref="GOA:Q1GKG8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG8"
FT                   /protein_id="ABF62848.1"
FT                   /translation="MPDQLIFAMEVTLNGLMAGVLYALVALGFVLIYKASGIFNYAQGV
FT                   MALFAAMTLVGIMQGQVPFSHLINAVFGGHITHFGWTVPSFVAIMMTVAVMVLLAWLVQ
FT                   VLVMKHLVGQEPIILFMATIGLAYFLEGVADLMWGSEIKTLDVGLPQGINLWIDETTFG
FT                   IFGYGFFIDNLDIVATVIAALLVTGLVLFSQYTKQGRAMRAVADDHQAALSVGISLNYI
FT                   WVLVWSVAGFVALVAGIMWGTKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIG
FT                   VGEKLFEFLIGPMVGGATENWFAYVLALIFLVFRPQGLFGEKIIERV"
FT   gene            complement(123416..123841)
FT                   /locus_tag="TM1040_0116"
FT   CDS_pept        complement(123416..123841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62849"
FT                   /db_xref="GOA:Q1GKG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG7"
FT                   /protein_id="ABF62849.1"
FT                   /translation="MTVMLERLRQLEAARKRGDLTDAQYRDARSKLLSVVEDAEVEPTG
FT                   PRPRTTATRSQAARPRSRPAAPAPTRRAAPAAAPHSDSVEPQDMSFFWGLVLVGLCGAA
FT                   MITFLIGRLIGDITIALTLAVTVVAAVVIAAFQRMQG"
FT   gene            123944..124204
FT                   /locus_tag="TM1040_0117"
FT   CDS_pept        123944..124204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62850"
FT                   /db_xref="GOA:Q1GKG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG6"
FT                   /protein_id="ABF62850.1"
FT                   /translation="MAKLISILNVIAWSGFWAFGYLALTGEGYTGGQVTVATLLAALGL
FT                   FAGIFAYLKLVRISERKGYAKPSNRMTRTQRDDAQSKWGEV"
FT   gene            124243..125319
FT                   /locus_tag="TM1040_0118"
FT   CDS_pept        124243..125319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0118"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62851"
FT                   /db_xref="GOA:Q1GKG5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG5"
FT                   /protein_id="ABF62851.1"
FT                   /translation="MFYREAGDFKLSYVEDSQTFPIKFDRYRYYAVLALAFGVVPFVVN
FT                   DYWVNAILLPFLIYAIAAIGLNILVGYCGQVSLGTGGFMAVGAYACYKLMTAFPEVSMF
FT                   IHVLLAGGITALVCVLFGLPSLRIKGFYLAVATLAAQFFLVWLFNRVPWFYNYSASGQI
FT                   NAPERDVFGIIITGPNAPAWATYLFCLIFLTFCAIVARNLTRGTQGRTWMAIRDMDIAA
FT                   EIIGVNPLKAKMTAFAVSGFFVGISGALFFAVYLGAVEVGEAFGINKSFLVLFMVIIGG
FT                   LGSIFGSFAGAAFLVLLPVILKVVGVDWLGWPTDIVAHFQLVIVGALIITFLILEPHGL
FT                   AQLWRVAKEKLRLWPFPH"
FT   gene            125411..126694
FT                   /locus_tag="TM1040_0119"
FT   CDS_pept        125411..126694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0119"
FT                   /product="branched-chain amino acid ABC transporter
FT                   periplasmic branched-chain amino acid binding protein
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62852"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG4"
FT                   /protein_id="ABF62852.1"
FT                   /translation="MKLKLTSVALSALIAASPAMADLVFPDLSYRTGPYAAGGIPFSDG
FT                   YNDYFTLVNERDGGIGGVKARVIECETGYNTEKGVECYESTKGEGALVYQPLSTGITYQ
FT                   LIPKVTADGIPLHTMGYGRTSAANGKVFSNVFNYPANYWDGASGVINYLLEENGGDLNG
FT                   KKIALVYHNSAYGKEPIRTLEELSKKHGFELSLLPVDHPGQEQKSQWLQIRRDRPDNVV
FT                   MWGWGVMNQVAIQEASNIRFPMENFIGVWWSGAEHDVMAAGDKADGYKAVTFHNVGRDF
FT                   PIFEDIQTHVVDKGLAAGAGDQIGNVLYNRGMYAAMLAVEAAKTAQEIHGTAEIDASMM
FT                   RDGMEALSITAEKMNALGMPNFGPSFDVSCENHGGPGLVGVTQWDAETQTWSLVSGFNP
FT                   TDQEVIDALVAEDSASYAAENNIEERCN"
FT   gene            126813..127649
FT                   /locus_tag="TM1040_0120"
FT   CDS_pept        126813..127649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0120"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62853"
FT                   /db_xref="GOA:Q1GKG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG3"
FT                   /protein_id="ABF62853.1"
FT                   /translation="MLDAANSTDVQAETLLEVNNIEVIYNHVILVLKGVSLNVPKGGIT
FT                   ALLGGNGAGKTTTLKAISNLLHSERGEVTKGSVRYRGRDVHEQDPAELVKTGVIQVMEG
FT                   RHCFEHLTVEENLLTGAYTRGDSNAKIQEDLELVYTYFPRLKERRKSQAGYTSGGEQQM
FT                   VAMGRALMSRPETILLDEPSMGLAPQLVEQIFEIVKSINENEGVTFLLAEQNTNVALRY
FT                   AHYGYILESGRVVMDGPAAELRENPDVKEFYLGMSDEGRKSFRDVRSYRRRKRWLS"
FT   gene            127666..128883
FT                   /locus_tag="TM1040_0121"
FT   CDS_pept        127666..128883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0121"
FT                   /product="phenylacetate-CoA ligase putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62854"
FT                   /db_xref="GOA:Q1GKG2"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG2"
FT                   /protein_id="ABF62854.1"
FT                   /translation="MTYFDKLETRSAEERAADLATLLPEQIARAKAAPGFATQLADVDP
FT                   KKITSVSALAELPVLRKSDLSAAQSAKPPFGGFTVKPAHGFAHIFQSPGPIYEPGGVDH
FT                   DWWRMGRFLHAAGVGERDVVQNCFGYHLTPAGMIFENGARAVGAAVLPAGTGQTELQVT
FT                   AARDVGATTYAGTPDYLKVILDKAEEMGVELGFKKAAVGGGALFPSLRQEYADRGISCL
FT                   QCYATADLGNIAYESAAMEGMIVDEQVIVEIVTPGTGTPVAPGEVGEVVVTTLNRDYPL
FT                   IRFATGDMSAVMPGQSPCGRTNMRIKGWMGRADQTTKIKGMFVRPEQVAALVDKHDEIV
FT                   KARVVASRNGEMDVMTVRIEANGGDEITFARSVVDVLKLKGTVDIVTPGSLPKDGLVIE
FT                   DQRSYD"
FT   gene            129006..130685
FT                   /locus_tag="TM1040_0122"
FT   CDS_pept        129006..130685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0122"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62855"
FT                   /db_xref="GOA:Q1GKG1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG1"
FT                   /protein_id="ABF62855.1"
FT                   /translation="MTHASQTQAPAPRRKTSARIKGARRFQVVAWVVAIACLLPMAAVA
FT                   IAALTGGVETITHLGQTVLPRYARTTVYLVLLVSLGTFSIGVGAAWLVTMTRFPGARFF
FT                   EIALVLPLAFPAYVLAYGYTFLLDHPGIVQTTLREVTGWGPRDYWFPEIRSLGGAALML
FT                   VLVLYPYVYLLARAAFLQQSASAFLAARALGDSSWRAFWRVSLPMARPAVASGVLLTVM
FT                   ETIADYGTVAYFGVQTFATGIYTSWFSMADRAGAAQLALCLLGFALMLAVAERISRGRA
FT                   RYHHAGKQQAALPPATLSRGKAAGAIILCALPVVFGFLVPLISLTLMGLNSEQNLLSRR
FT                   YISFITNSLTLASTAAVVTLLAAVCLGFYQRLKPGRLSSTAANVSRLGYAVPGGVIAVG
FT                   LMVPFAAFDNALDAWMQANFGLRTGLLVTGSIWLLVVAYMVRFMAAALGAYEGGQATVH
FT                   ANMDAAARSLGQSPLGMLRRVHLPILTPSLLTALLIVFVDVMKELPATLIMRPFNFDTL
FT                   AVQAHRLAADERLEGAAVPSLVIMAVGLLPVILVCRQVRRRS"
FT   gene            complement(130689..131552)
FT                   /locus_tag="TM1040_0123"
FT   CDS_pept        complement(130689..131552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0123"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62856"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKG0"
FT                   /protein_id="ABF62856.1"
FT                   /translation="MRIPVTIISGYLGAGKTTLINSLLGEDHGLRLSVLINDFGSINID
FT                   EALISNKTVDSVALTNGCVCCSLGDDLALSVNDLVSRAEPPDHILIETSGVAEPVAIAN
FT                   ALLNDSRLSYAGIVTVVDGSNFSTLMDDPLLKPQVTQQICAADLVLVSKLEHESDDGVI
FT                   AALGALGARTPTLTSDIELSRLLFDITPLPRSKSTVSHPGYVSWHHRSTEVIDRRALGD
FT                   KLAERPEGLYRMKGFVLTSGGAYQLHIVGRHVEARRCDANETLLVALGPEQRISHDQIE
FT                   AWWTGS"
FT   gene            complement(131939..132949)
FT                   /locus_tag="TM1040_0124"
FT   CDS_pept        complement(131939..132949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0124"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62857"
FT                   /db_xref="GOA:Q1GKF9"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF9"
FT                   /protein_id="ABF62857.1"
FT                   /translation="MKIKVFTTVIAASLATTAVADGVVNLYSSRHYDTDERLYTDFEEA
FT                   TGITINRIEGKADELVARMQAEGANSPADVLITVDTSRLERAKNAGVLQSIDSDILEER
FT                   IPANLQDSDNQWFGFSQRARIVFYDKTDVANPPADYMDLAKPEYKGMVCHRSSSNVYSQ
FT                   TLLSAIIENHGEEAARDWAEGIVANFARDPQGGDTDQLRGLISGECDVSIANTYYFARA
FT                   LRKDVKGLSAEIEKIGVAFPAQDAEGAHMNLSGAGVAAHAPNRENAIKFLEYLASDQAQ
FT                   EYFSGGNDEFPAVPGVSKSESVAQLGEFKADDVDLSKVAKNVPTAQKIFNEVGWE"
FT   gene            complement(133310..133435)
FT                   /locus_tag="TM1040_0125"
FT   CDS_pept        complement(133310..133435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0125"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62858"
FT                   /db_xref="GOA:Q1GKF8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKF8"
FT                   /protein_id="ABF62858.1"
FT                   /translation="MKVKNSLRSLKNRHRDCRVVRRKGRVYVINKTQRKFKARQG"
FT   gene            complement(133517..133591)
FT                   /locus_tag="TM1040_R0001"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(133517..133591)
FT                   /locus_tag="TM1040_R0001"
FT                   /product="tRNA-Val"
FT   gene            133740..134600
FT                   /locus_tag="TM1040_0126"
FT   CDS_pept        133740..134600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0126"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62859"
FT                   /db_xref="GOA:Q1GKF7"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF7"
FT                   /protein_id="ABF62859.1"
FT                   /translation="MSGQAYSIEMPQGWQSPVVIASPHSGSNYPKTFVSQSILDANRLR
FT                   SSEDAFVDQLFAAAPRLGMPLLTAKMPRAYVDLNRSSDELDPALIEGARRRGQNPRIAS
FT                   GLGVIPRVVANGREIYRGKIPMDEAVARIDDYWVPYHAALQRLLDASHTRFGRAILIDC
FT                   HSMPHEAIESCSPRRERRPQIVLGDRFGAAADAAIVDQVEAAFAEVGFRVARNSPFAGA
FT                   YITQTYGRPFRHQHAIQVEIDRSLYMHEADVAPNDGFDDVRARLTLALQRIAQLGEDLT
FT                   PMAAE"
FT   gene            complement(134637..135908)
FT                   /locus_tag="TM1040_0127"
FT   CDS_pept        complement(134637..135908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0127"
FT                   /product="DNA polymerase IV; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62860"
FT                   /db_xref="GOA:Q1GKF6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF6"
FT                   /protein_id="ABF62860.1"
FT                   /translation="MPALCRECLHCFDPGTSPRGPKRCPVCRSPRVKQHEELLSLSIAH
FT                   MDCDAFYASVEKRDNPELADKPVIIGGGHRGVVSTACYVARIRGVRSAMPMFQALKLCP
FT                   DAVVIKPRMEVYAETSRAIRAMMDELTPEVEPLSLDEAFMDLSGTERLHGAAPAVMLAR
FT                   LVKRMKDELGVTGSIGLSHNKFLAKVASDLDKPRGFSVIGKAETAEFLRDKPVRLIWGI
FT                   GPAAQASLEKAGIRAFSDLLRWERRDLHDRFGSMGDRLWHLARGEDRRKVSARAPVKSI
FT                   SKETTFFEDTMHSEVLDGHLWRLAEQVSDRAKAKGLAGRVVTLKLKRANHSTLTRRQSL
FT                   HSPTQYADQIYRTARRLLDQTIQQGPFRLLGCGISELAPEAQADATGDLLDPDATKRAN
FT                   AERATDEIRKRFGKEAIRKGRSLR"
FT   gene            136011..136430
FT                   /locus_tag="TM1040_0128"
FT   CDS_pept        136011..136430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0128"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62861"
FT                   /db_xref="GOA:Q1GKF5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF5"
FT                   /protein_id="ABF62861.1"
FT                   /translation="MSFKGAKLLLFLGPHLLVILRDQKAGIPFPGHWDFPGGGREGDET
FT                   PQACALRETYEEVGLILPESRIHYSRRYPRPDGATWFFAAEIGARCVGDIKFGDEGQGW
FT                   DLMTPEDYIAHPLGIPRFKVRLQDYLQSGRRAAEI"
FT   gene            complement(136844..137569)
FT                   /locus_tag="TM1040_0129"
FT   CDS_pept        complement(136844..137569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0129"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62862"
FT                   /db_xref="GOA:Q1GKF4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF4"
FT                   /protein_id="ABF62862.1"
FT                   /translation="MTSPLADDRLIVAMDVPNALEGLKLAEQLGDAVSFYKIGLGMLTG
FT                   GGLALANELKQELGKKIFLDMKLFDIGATVENAVRGLAQFDLDFLTVHGDPYVVRAAKE
FT                   GAAGKDLKILAVTILTSLDRDDLDGAMIKSGEIKDLVQERAGKAFSAGADGVIASPQEA
FT                   AMIRSLPEAEGKLIVTPGVRPVGADLGDQKRVTTPAQALASGVDHIVVGRPIWQAEAPR
FT                   VAAESILQEMNSPQAKAPN"
FT   gene            137814..140432
FT                   /locus_tag="TM1040_0130"
FT   CDS_pept        137814..140432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0130"
FT                   /product="ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62863"
FT                   /db_xref="GOA:Q1GKF3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF3"
FT                   /protein_id="ABF62863.1"
FT                   /translation="MDLNKFTERARGFVQASQTIALREGHQRLTPEHILKALLDDDQGM
FT                   ASNLIAHAGGNIARVSEAVEAAIGKLPKVSGDAGQIYLDGQTAKVLDEAAKVAEKAGDS
FT                   FVPVERLLTALALVKSKAKDALDAGGVTAQKLNEAINDVRKGRTADTATAEDTYEALKK
FT                   FTLDLTERAREGKIDPIIGRDDEIRRAMQVLSRRTKNNPVLIGEPGVGKTAIAEGMALR
FT                   IVNGDVPESLKDKRLLALDMGALIAGAKYRGEFEERLKGILNEVTDAAGEIILFIDEMH
FT                   TLVGAGKSDGAMDAANLIKPALARGELHCIGATTLDEYRKYVEKDAALARRFQPVMVTE
FT                   PTVEDTISILRGIKEKYELHHGVRIADAALVSAATLSNRYITDRFLPDKAIDLMDEAAS
FT                   RLRMEVDSKPEELDALDRQILQMQIEEEALKLEDDAASKDRLEHLQKELADLQERSREM
FT                   TAQWQSERDKLASARDLKEQLDRARAELDIAKREGNLAKAGELSYGVIPGLEKQLSEAE
FT                   QKEEQGLMVEEAVRPEQIAAVVERWTGIPTSKMLEGEREKLLRMEDGLHKRVIGQNAAV
FT                   TAVANAVRRARAGLNDENRPLGSFLFLGPTGVGKTELTKAVAEFLFDNDSAMVRIDMSE
FT                   FMEKHAVARLIGAPPGYVGYDEGGVLTEAVRRRPYQVVLFDEVEKAHPDVFNVLLQVLD
FT                   DGVLTDGQGRTVDFKQTLIILTSNLGAQALSQLPDGADAADAKRDVMDAVRAHFRPEFL
FT                   NRLDETVIFDRLGRHDMDGIVEIQLGRLAKRLAQRKITLELDEGAKTWLADEGYDPVFG
FT                   ARPLKRVIQRALQNPLAEALLAGDIKDGEIVPVSAGAEGLVIGDRVGSSDRPLPDDAVV
FT                   H"
FT   gene            140622..142115
FT                   /locus_tag="TM1040_0131"
FT   CDS_pept        140622..142115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0131"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62864"
FT                   /db_xref="GOA:Q1GKF2"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF2"
FT                   /protein_id="ABF62864.1"
FT                   /translation="MGFAMNAVSILAVMFICLIGVLGLVALIMFLIDRSQTQDAIRRNY
FT                   PVLGRFRHLFSTLGEFFRQYFFAMDREELPFNRAQREWIARACAGVTNTVAFGSTRNTS
FT                   VPGTPIFVNAPFPPLDDQFASAEPMLIGPTARVPYNAPSFFNISGMSYGALSRPAITAL
FT                   SRGAREAGVWLNTGEGGLSPFHLDGGCDIVFQIGTAKYGVRDTAGNLSDARLKELAEIP
FT                   QVKMFELKLAQGAKPGKGGILPAEKVNAEIAEIRGITEGEASISPNRHLDIANYDDLLD
FT                   IVARIREVTGKPVGIKTVAGSEVALREMFLNFAARPEDVPDCITIDGGEGGTGAAPMPL
FT                   IDLVGMSVREALPLVCNLRDEYGFKDRIRLISSGKLVNPGDVAWALAAGADFVTSARGF
FT                   MFSLGCIQALKCNRNTCPTGITTHDPRFQKGLVVEDKYKKVARYAREVIHEVETIAHSV
FT                   GVDEPRKMRRRHVRIVGEGGASVPMNVDQPSYGSRGSNA"
FT   gene            complement(142088..142489)
FT                   /locus_tag="TM1040_0132"
FT   CDS_pept        complement(142088..142489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62865"
FT                   /db_xref="GOA:Q1GKF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF1"
FT                   /protein_id="ABF62865.1"
FT                   /translation="MTDVSMNPLTVILGIKILVTLGLTHLFLFAPQKRLNGLMAQYGDS
FT                   PLTYRLYGLTLLVLLGMYFSGLIAALGGEVSHEVLALGILSNGGAAVLMQAWSGHPTLR
FT                   RASWIFAGIAVALLAALLFPDQALLPLLP"
FT   gene            142784..143686
FT                   /locus_tag="TM1040_0133"
FT   CDS_pept        142784..143686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0133"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62866"
FT                   /db_xref="GOA:Q1GKF0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKF0"
FT                   /protein_id="ABF62866.1"
FT                   /translation="MAKRWTDDLTAADVTPEAVFWNRRKLLAGLAGAGLGSIASGAIAD
FT                   DALEPNTWEEVTTYCNFYEFGTGKTDPATYAHEMTTSPWEVEIDGLVDNPGTYGFEQIL
FT                   AEMTLEERIYRFRCVEAWSMVIPWQGFELADLLNLAGVQEGAKYVAFETLLRPSEMPGT
FT                   RYPVLDWPYREGLRLDEAMHPLTLMATGIFGKPLPNQNGAPLRLVVPWKYGFKSIKSVV
FT                   KITLTDQEPPTSWNMANAREYGFYSNVNPEVDHPRWSQATERRIGGGLFSRRQPTLMFN
FT                   GYEKEVASLYDGMDLTKYF"
FT   gene            143686..144285
FT                   /locus_tag="TM1040_0134"
FT   CDS_pept        143686..144285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0134"
FT                   /product="Ferric reductase-like transmembrane
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62867"
FT                   /db_xref="GOA:Q1GKE9"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE9"
FT                   /protein_id="ABF62867.1"
FT                   /translation="MDLSTLNTALRRVPSWLVYLCGLAPAVWLFWQGLTGALGVEPIKA
FT                   LEHRYGELALQFLIASLAVTPLRRIVGLNLMSHRRALGLLSFVYVVCHLLVWLLLDVQI
FT                   PSQILADIAKRPYITVGMLAFVLLVPLALTSNVVSIRKLGTRWRKLHKLSYPAAILAAV
FT                   HFVLLAKGFQIEPLLYLGGIGVLLVLRLRLPAPKRA"
FT   gene            144346..144612
FT                   /locus_tag="TM1040_0135"
FT   CDS_pept        144346..144612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62868"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE8"
FT                   /protein_id="ABF62868.1"
FT                   /translation="MRRACTRALHAKPEFILMKIKDILKICGKNDSFAKKGLRAFVVMR
FT                   RTPFTGGAEARLAAAGTLLTDRKDGYDAQERLGHSSMDVGGGA"
FT   gene            144962..146416
FT                   /locus_tag="TM1040_R0002"
FT   rRNA            144962..146416
FT                   /locus_tag="TM1040_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            146556..146632
FT                   /locus_tag="TM1040_R0003"
FT                   /note="tRNA-Ile5"
FT   tRNA            146556..146632
FT                   /locus_tag="TM1040_R0003"
FT                   /product="tRNA-Ile"
FT   gene            146698..146773
FT                   /locus_tag="TM1040_R0004"
FT                   /note="tRNA-Ala6"
FT   tRNA            146698..146773
FT                   /locus_tag="TM1040_R0004"
FT                   /product="tRNA-Ala"
FT   gene            147318..150161
FT                   /locus_tag="TM1040_R0005"
FT   rRNA            147318..150161
FT                   /locus_tag="TM1040_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            150399..150513
FT                   /locus_tag="TM1040_R0006"
FT   rRNA            150399..150513
FT                   /locus_tag="TM1040_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            150565..150641
FT                   /locus_tag="TM1040_R0007"
FT                   /note="tRNA-Met5"
FT   tRNA            150565..150641
FT                   /locus_tag="TM1040_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(150726..151112)
FT                   /locus_tag="TM1040_0136"
FT   CDS_pept        complement(150726..151112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0136"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62869"
FT                   /db_xref="GOA:Q1GKE7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE7"
FT                   /protein_id="ABF62869.1"
FT                   /translation="MALTKIYAIDDDMLDRKMLQRVVERSGKVNSLELYSYAESAIEEL
FT                   ERCDRLPELILLDINMPRMNGFEFLEIVDEKLSQAQPPVKVALLTTSSNPADARKAESF
FT                   ASVGWFLSKPLGRDMLDQLVSEFS"
FT   gene            complement(151103..152278)
FT                   /locus_tag="TM1040_0137"
FT   CDS_pept        complement(151103..152278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0137"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62870"
FT                   /db_xref="GOA:Q1GKE6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE6"
FT                   /protein_id="ABF62870.1"
FT                   /translation="MTMSMLESEVTEAWAEQYETAFVTYCNTGSEEALIEAYAFAREGL
FT                   AASMTLAVFACLHHAAFFKLLEQSGPGNNLYERALDFYLEGVSVFDMAIHGYQNNVARL
FT                   KEEVTERRRIEEDLRAATFELSRQRSDLDIQVRQRTAELRERAEELEQSNRLLLQTNKE
FT                   TSEFSYALSHDLKSPINTIGMLLDAIREELPPDSESECADLVSDASLTAERMKRLIDDV
FT                   LQYSQVVGNTLERELVDMSQLCQDALSDMRHAIDEAQADISCSHLPVVRGSAFQLAIML
FT                   RNFLSNALTYRDASRPLRVEISAGPTAETGRVLISIADNGIGMPPDCHARIFNLFTRLH
FT                   TYSDFEGSGIGLALCKRVANNHNSDIEVESVEGQGTIFSFSIESEEVDTWH"
FT   gene            complement(152275..152919)
FT                   /locus_tag="TM1040_0138"
FT   CDS_pept        complement(152275..152919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62871"
FT                   /db_xref="GOA:Q1GKE5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE5"
FT                   /protein_id="ABF62871.1"
FT                   /translation="MASHLTDGVIHATTRAASLHWCIAQATKTDGALNGDGYLLKRDED
FT                   TLLFALADGVGSGQLAHDASSACLRILAASDDMDLPSLFETCHTQLTSTRGAALGLVKF
FT                   FLGQGFLEWAAVGDIEGCIYPTEPTSSRTISMMQRGGTLGHYFTGITPQQHAWPPTSML
FT                   ALCTDGVSRKFRERHPNDQAPREFADSCFNDFGRDNDDRTLATFSWTQEGT"
FT   gene            complement(152904..153326)
FT                   /locus_tag="TM1040_0139"
FT   CDS_pept        complement(152904..153326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0139"
FT                   /product="putative anti-sigma regulatory factor
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62872"
FT                   /db_xref="GOA:Q1GKE4"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE4"
FT                   /protein_id="ABF62872.1"
FT                   /translation="MNAILTETDLVQLEIEDDRDVVTARSNGRKMAAEMGFSRPDQALI
FT                   ATAISELARNIVNYAGKGGIELGKLQKPGYVGIQVVAHDEGPGIADIESAMIDGFSTGN
FT                   SLGLGLPGTKRIVDEFQLQSAPGDGVTVTAVKWLRI"
FT   gene            complement(153323..153679)
FT                   /locus_tag="TM1040_0140"
FT   CDS_pept        complement(153323..153679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0140"
FT                   /product="anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62873"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE3"
FT                   /protein_id="ABF62873.1"
FT                   /translation="MALRVPILSQGELLIASIQEELSDSEILDLQARILDEVAAKKARN
FT                   VIVDVSLLDVLDSFGTRTLSEIAAAVRLRGAQMVIVGIQPEVAMAMVLLGLSLEGVPTA
FT                   LDLDHGIELLKARP"
FT   gene            complement(153682..154578)
FT                   /locus_tag="TM1040_0141"
FT   CDS_pept        complement(153682..154578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0141"
FT                   /product="anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62874"
FT                   /db_xref="GOA:Q1GKE2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE2"
FT                   /protein_id="ABF62874.1"
FT                   /translation="MSQIISSTISEDTTGMNDAFGWFDVSAEDRTRVSALEPLVRDNID
FT                   EIINDFYERAGGFDHSALKIQDKNSLELIKEEQKRHFLELMDAGLGEDYFQTRKNAGIF
FT                   NERFGVSPSFYMGAYSYFYDRICDIVKREAKNKDEAIEIFLSLHRIAACHKSLTIEAFA
FT                   KAREQTIEDREREISELPVPVLKMREGLLLVPVVGTLDSHRARLLTSRMLDEISKVGAR
FT                   AVVLDITGVPAVDSAVANHLIQSMGAARLMGAHSVLTGISSDVAQSLVKLGVTGETLNP
FT                   AGDLQRGIETAEALLDG"
FT   gene            complement(154810..156234)
FT                   /locus_tag="TM1040_0142"
FT   CDS_pept        complement(154810..156234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62875"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE1"
FT                   /protein_id="ABF62875.1"
FT                   /translation="MAGKTLNKNNLVALGAEMLADLLLESVKGDAARQRRVRMALAANQ
FT                   GPETVAADVRKRFASIRRARSFISRKTQKTLAKELANHTQLIEARIAPHAPDLAFDLLW
FT                   AQLHLANDILDRTDDSQGVIANVMQEAMAAVTRLSSSLTRDPVALADDIFEAVSTDSYG
FT                   VFDTTVEALAEALGGSGLARLETLAERAREAPLSDADLLLFGYITDPQQREDRARNARD
FT                   RASEMLLLDIADLRGDVDAWLSHYAPEELTQDAIAPEASARLLDAGRAEEALALIEQAL
FT                   PNGDLWHDKADLDDAHFACLEALGRQEDLRSALWARFERRLCPRALRQYLKRLPDFDDI
FT                   EAAEQARQHVLTFAPIEVALGYCLDAPDLSLASELILARHPEIDGETFTCLAPLAEALR
FT                   AEFPLPAVLLWRAMIDDTLSEARAARYRHAARQLTACETEDAQISDYRGHPPHGAYLRD
FT                   LQKAHARKSGFWGRLS"
FT   gene            complement(156335..156646)
FT                   /locus_tag="TM1040_0143"
FT   CDS_pept        complement(156335..156646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0143"
FT                   /product="ETC complex I subunit conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62876"
FT                   /db_xref="GOA:Q1GKE0"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKE0"
FT                   /protein_id="ABF62876.1"
FT                   /translation="MRARIYRPARNAMTSGMAKTRKWVLEYAPADAREVDPLMGWTSSS
FT                   DTQSQVRLKFDTKEEALEYADDHGIEVEVHEPKTRKPNLRAGGYGENFATNRRGPWTH"
FT   gene            156843..159035
FT                   /locus_tag="TM1040_0144"
FT   CDS_pept        156843..159035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0144"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62877"
FT                   /db_xref="GOA:Q1GKD9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD9"
FT                   /protein_id="ABF62877.1"
FT                   /translation="MPYAHSDKTLPMMADRAPERREKLEGGKKFVMQTAFSPAGDQPTA
FT                   IAELSQGVLDGERDQVLLGATGTGKTFTMAKVIEETQRPAIILAPNKTLAAQLYGEFKG
FT                   FFPDNAVEYFVSFYDYYQPEAYVPRSDTYIEKESQINEQIDRMRHSATRALLERDDVII
FT                   IASVSCIYGIGSVETYSAMTQDLIVGQDYDQRQIMADLVAQQYKRNDQAFQRGAFRVRG
FT                   DTLEIFPAHLEDRAWKLSFFGEELESITEFDPLTGERTGSFEKIRVYANSHYVTPKPTL
FT                   NQAVISIKNELRQRLDNLVSEGKLLEAQRLEQRTNFDIEMLEATGHCNGIENYSRYLTG
FT                   RAPGEPPPTLFEFIPDNAIVFADESHVSVPQIGGMYKGDHRRKMTLAEHGFRLPSCMDN
FT                   RPLKFEEWDAMRPQSVFVSATPAAWEMEQSGGVFAEQVIRPTGLLDPEVEIRPVGMQVD
FT                   DLLDEIRDVTARGYRTLATVLTKRMAEDLTEYLHEQGIKVRYMHSDIDTIERIEILRDL
FT                   RLGAFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSETSLIQTIGRAARNSEGKVI
FT                   MYADRITGSMERAIAETNRRREKQIAYNEEHGITPETVKKNVDDVLAGLYEGDTDMSRV
FT                   TATIDKPLHGANFEAHLDGLREQMRKAAENLEFEEAARLRDEVKRLEAVDLAIADDPLA
FT                   RQSAVEAAAEEATRTRGRSTAGKAGQRGGNVKRRGR"
FT   gene            complement(159057..160424)
FT                   /locus_tag="TM1040_0145"
FT   CDS_pept        complement(159057..160424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0145"
FT                   /product="Deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62878"
FT                   /db_xref="GOA:Q1GKD8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD8"
FT                   /protein_id="ABF62878.1"
FT                   /translation="MEWTQLLNPRRLCRPDYADKPNRPAYLQDYDRILFSEPFRRLAQK
FT                   TQVHPLYDHDHVHHRMIHSMETSSVGRSLGIQVGEALVADGRLEDGLQHVMAGTVQAAC
FT                   LVHDIGNPPFGHSGEASIGAWFAQQFAANNGTGIGIAAGIAPEHRAEFEAFEGNAQGFR
FT                   IVSRLEMARREGGMRLSYATLGAFAKYPCTASAAADAQDTYVGLKKFGCFAGEEALFAE
FT                   VASALGLPQERTPSGERWWRRHPLAFLVEAADDICYRILDLEDAATVGDLGGEVVSEIL
FT                   EEITGKPNRSPEPEMTLRERTGMQRAMAIGAAIDSAVEAFLEHYDAIMDGTFNDGLMEV
FT                   SSKAATFARLKEISNARIFTAQRKTALEVVGRKVIFTILDEFHALFVALKACDWDAQRL
FT                   LKEHGYWTQLVRAVDLDLRGVTDDYTAAHALTDFVSGMTDRYAIRVRDMITGQVPS"
FT   gene            complement(160500..161540)
FT                   /locus_tag="TM1040_0146"
FT   CDS_pept        complement(160500..161540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0146"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62879"
FT                   /db_xref="GOA:Q1GKD7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD7"
FT                   /protein_id="ABF62879.1"
FT                   /translation="MATAEITVRGAGIFGLSIAWACHRRGARVQVIDPAGPGAGSSGGL
FT                   VGALAPHVPENWNPKKAFQLESLLMAEGFWAEVEATGGISAGYGRLGRLQPISDDRALE
FT                   LAHARRETAAELWQDNAIWEVRPTTDFAAWCPPSPTGMVIHDTLSARMHPRRACAALVA
FT                   ALRAGGIEVEGDGRDEGQVVHATGYQGLLDLNALSPRLVGTGVKGQAALLAYDAGDVPQ
FT                   LYADGLHIIPHADGTLAIGSTSEREFLHPDEPDAQLDQVISRAIAAMPQLAGAKVLERW
FT                   AGVRPRARTRAPMLGEYPGRVGHFIANGGFKIGFGMAPKVAEVMAELLLDGNDTIPEGF
FT                   RVSDNF"
FT   gene            161599..162282
FT                   /locus_tag="TM1040_0147"
FT   CDS_pept        161599..162282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0147"
FT                   /product="protein of unknown function DUF752"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62880"
FT                   /db_xref="GOA:Q1GKD6"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD6"
FT                   /protein_id="ABF62880.1"
FT                   /translation="MADQQARLSWREGDLPVSDQFDDPYFSLQNGLLETEHVFLAGNDL
FT                   PARFGPGFHIAELGFGTGLNMLAAWRAWEESGQDTPLHFTSFEAFPMTPSDMARALEAF
FT                   PAVSPWADRFLAKWSGGGRCDLGSLQLNVILGDAREALPVWSGAANAWFLDGFAPAKNP
FT                   ELWQEDLMQAVADHTAAGGTAATYTAAGFVRRGLETAGFTVERSPGFGRKRHMTRAVLT
FT                   PAAED"
FT   gene            162286..163173
FT                   /locus_tag="TM1040_0148"
FT   CDS_pept        162286..163173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0148"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62881"
FT                   /db_xref="GOA:Q1GKD5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD5"
FT                   /protein_id="ABF62881.1"
FT                   /translation="MDQLMAKNDTRMGILLMIGATIIFALQDGISRHLASEYNVFMVIT
FT                   IRYWFFAAFVITLALRQTGSIRAAAQTSQRWVQIFRAFVLVAEICVMVLAFTVLGLVES
FT                   HAVFVCYPLLIAALSGPILGEQVGWRRWAAIGVGFIGVLIILQPGSGVFQIAALIPLLA
FT                   ALMFALYGLLTRYVARRDTTATSFFYTGVYGMLFVTPLGVWWWEPMTAADWGWMATLCV
FT                   TGALGHWLLIKCYEMAEASAVQPFAYMQLPWAAMIGLLVFGEDMRTNVIIGAAIVVAAG
FT                   LFTFWRESLKRAAR"
FT   gene            complement(163129..165096)
FT                   /locus_tag="TM1040_0149"
FT   CDS_pept        complement(163129..165096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0149"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62882"
FT                   /db_xref="GOA:Q1GKD4"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD4"
FT                   /protein_id="ABF62882.1"
FT                   /translation="MTRRLACSLLICATLFGAPALARGLDTALPLMRDGQWQEALIDAG
FT                   SEGSIQRDIIEWHRLRAGEGTARDVLSFIDRRPDWPGMDYLRRQSEETLAKAGHSAILA
FT                   FYRDMPSAQTAEGALSLGEALIEAGRTGEGQAEIVRAWRSMAMPQEVHDAYLARHKTLL
FT                   AAHHEARLSRLLWDGHKVSSRRMLELVSDGARKLAEARIALQEQANGVDAAIAAVPDAL
FT                   KDDAGLAYDRFAWRDAKRRQDDAIAMMFERSTSAEALGEPAKWLRRRADFARQLMRDND
FT                   NTRAYKLAAYHFATPDAGYGYADNEWIAGYVALRKLDDAELAVYHFTRFLAAVESPISV
FT                   GRAGYWLGRAYAQLGEIDKAHAAYRLGAKYQSSYYGLFSAQALGRSFDPRLTRPEAPNW
FT                   RNAPFLQSSVYAAGIALLEAGEVSLAERFLTHLVESLPPDQALQLGQMAVDMKLPHLAV
FT                   MISKRAAQDGLELAGAYYPLHPVTDLDLPMAPEMVLAIARRESEFDPVVVSHAGARGLM
FT                   QVMPGTAELVAKGLGILEEHAVARLTSDWQYNAKLGATYLAALAKEFDGNVVLMAAGYN
FT                   AGPHRPIAWMERYGDPRDPKVDVIDWIEHIPFNETRNYVMRVTESLPVYRARLGEAPLP
FT                   VPFSRELSGRTLQAFAPKGE"
FT   gene            165208..166107
FT                   /locus_tag="TM1040_0150"
FT   CDS_pept        165208..166107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0150"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62883"
FT                   /db_xref="GOA:Q1GKD3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD3"
FT                   /protein_id="ABF62883.1"
FT                   /translation="MKTTNWSVPMFKGSMPALVTPFRNGELDLDTLKHLVEWHIAEGST
FT                   GLVPVGTTGESPTLTHEEHELVIKVVVETAAGRVPVIAGAGSNNTVEAIRFVEYAHRVG
FT                   ADAALVVTPYYNKPTQRGMIAHFSALHDCADIPIIIYNIPPRSVVDMSPATMGELAKLP
FT                   RIIGVKDATGKLERVSQQRASCGADFIQLSGEDATALGFNAHGGVGCISVTANVAPKLC
FT                   AEFQAATLAGDYKKALDYQDRLMPLHEAIFIEPGLVGAKYGMSKLGLCTEEVRSPLTGL
FT                   EDSTKAKIDAAMAHAGLL"
FT   gene            complement(166208..167086)
FT                   /locus_tag="TM1040_0151"
FT   CDS_pept        complement(166208..167086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0151"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62884"
FT                   /db_xref="GOA:Q1GKD2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD2"
FT                   /protein_id="ABF62884.1"
FT                   /translation="MNHGTENTGTDAFLSVRPRLFAVAYRMLGSVADAEDILQDAYLRW
FT                   QSAPRGEVRDPTGYLVRVVTRLCLDQLKSARVKRETYTGAWLPEPLLTEDPAELIDHDV
FT                   SVALLLALERLTPLERAAFLLHDVFGNSHDEVASALDRSPSACRQLVSRARRHVQSERP
FT                   RSQVAPEESRALTEAFFRASKTGDMAALTQLLAQDVELVSDGGGKAMAALNPIYGRDKV
FT                   MRLAEGLARKYGAHLPPRWRFAMLNGLPAILSQEPEGLVQATALEIRDGRIAKVYVIRN
FT                   PEKTAHLAAVL"
FT   gene            complement(167083..167544)
FT                   /locus_tag="TM1040_0152"
FT   CDS_pept        complement(167083..167544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0152"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62885"
FT                   /db_xref="GOA:Q1GKD1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD1"
FT                   /protein_id="ABF62885.1"
FT                   /translation="MTQRLDQFAAAGDLFKPMMQQEELLKTSGLEFSLIELVKLRASQI
FT                   NACAFCIHMHTHDARNAGESEDRMHLLPAWRESTLYTPRERAALAWTEALTLVADTAAP
FT                   DADYELVAKAFSPREQVALTLLIGAINAWNRIAIGFRTPHPAAKEASAA"
FT   gene            complement(167639..168676)
FT                   /locus_tag="TM1040_0153"
FT   CDS_pept        complement(167639..168676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0153"
FT                   /product="conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62886"
FT                   /db_xref="GOA:Q1GKD0"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKD0"
FT                   /protein_id="ABF62886.1"
FT                   /translation="MPETSPSPRLPLSIARLRSRAKVLFPGVAVSFIVAATAQFLAEHY
FT                   ATPAMLMALLLGIAVSFLGEEGRTVPGVAFSARTLLRLGVALLGVRVSMMVLAGLGLPL
FT                   IFLTAGGVVATIFFGLWVARFFGQEWRFALLTAGSVAICGASAAMAIAAILPRDKSSEQ
FT                   RLIFTVMGVTVLSTIAMILYPILAGSLQFDHIQAGVFLGGTIHDVAQVVGAGFSISEET
FT                   GDTATLVKLIRVSMLAPVVLVASLFIRARIETSAEGRQPPLLPGFVIGFIALAALNSLA
FT                   LIPPVVADFLSACSRWLLLIAIAAVGMKSNLKQVLSVGGAAIGLLVTETVFIAGLILLG
FT                   ILLLT"
FT   gene            complement(168851..169603)
FT                   /locus_tag="TM1040_0154"
FT   CDS_pept        complement(168851..169603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62887"
FT                   /db_xref="GOA:Q1GKC9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC9"
FT                   /protein_id="ABF62887.1"
FT                   /translation="MLVDLPFALTAMQGLFLAAALFFAAVIRGYSGFGFSAIFIVIASM
FT                   VTNPLPLIPVVFTCEIAMTAFQARGIRAHIDWHRAIALLVGAAIAVIPAVALMARLEPT
FT                   HARMVVSALILLLSLILLSGWQLRRPIGALGHAGVGILSGTANAAGVGGLPTAAFLSAQ
FT                   AMPPAAFRATMIIFLTGIDLMALPTMSAHGLVTSETAWAAVMAFPILALGVWCGSRGFA
FT                   NARPDGFRQKVVILLATLATISLIRAMF"
FT   gene            complement(169615..171393)
FT                   /locus_tag="TM1040_0155"
FT   CDS_pept        complement(169615..171393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0155"
FT                   /product="thiamine pyrophosphate enzyme-like TPP binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62888"
FT                   /db_xref="GOA:Q1GKC8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017820"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC8"
FT                   /protein_id="ABF62888.1"
FT                   /translation="MRMTTEEAFVKTLQMHGIEHAFGIIGSAMMPISDLFPKAGITFWD
FT                   CAHEGSAGMMADGYTRVTGNMSMMIAQNGPGITNFVTAVKTAYWNHTPLLLVTPQAANK
FT                   TIGQGGFQEVEQMKLFEDMVAYQEEVRDPSRVAEVLNRVICNAKRASAPAQINIPRDMW
FT                   TQVIDIALPEILTFERPAGGAQAVSEAASLLSEAQNPVILNGAGVVLSGGGIAASMALA
FT                   ERLDAPVCVGYQHNDAFPGTHPLFVGPLGYNGSKAAMELIRDADVVLCLGTRLNPFSTL
FT                   PGYGIDYWPTEADIIQVDINPDRIGLTKPVRVGIVGDAAKVADGILQQLSEDAGDAGRS
FT                   ARKAHIAATKSRWAQQLAAMDHEDDDPGTTWNARARSAKPDWMSPRMAWRAIQSALPSD
FT                   AIISSDIGNNCAIGNAYPTFEAGRKYLAPGLFGPCGYGLPAIMGAKIGCPETPVVGFAG
FT                   DGAFGISVNELTAIGRAEWPAITQVVFRNYQWGAEKRNSTLWFDDNFVGTELDTKVSYA
FT                   GIAQACGLKGVVARTMEELTATLRHAIEDQGRGITTLIEALINQELGEPFRRDAMKKPV
FT                   AIAGISAADMRPQARA"
FT   gene            complement(171551..173017)
FT                   /locus_tag="TM1040_0156"
FT   CDS_pept        complement(171551..173017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0156"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62889"
FT                   /db_xref="GOA:Q1GKC7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC7"
FT                   /protein_id="ABF62889.1"
FT                   /translation="MAISVETFFLNTDAQGTLQAQIQEMIAAGILSGRFRAGEKLPSSR
FT                   KLAQHLGVSRITVTLAYTELVANDYLSARGRSGYFVSQTAPVPPSFSPIQKEADSVDWN
FT                   RAITQDFTGGDSPPKPRDWRNYRYPFIYGQADATLFDHANWRLCALRALGQKDFAAMTG
FT                   DYFDQDDPLLIEYIARNTLPRRGVIARPEEILITLGAQNALWTVVQLLLQPGRKAAIED
FT                   PSYYTLRDQLSHTGCDLDVIAVDEDGLPPAQIATNTDVIFTTPSHQSPTTATMPMARRK
FT                   ALLSRATEIGAVVVEDDYEFEMSFRNQPSPALKSIDRDGRVIYLGSFSKSLFPGLRLGY
FT                   LVGSEPFIRQARALRANVLRHPPGHVQRTVAYFLSLGHYDAQIRRTAKVLQERRAVLER
FT                   AVEAEGLCPANRSLYGGSSLWMQAPDQVNMGQVGLKLREKGVLIEPGAPFFARDTRRHN
FT                   FYRLGYSSIASERIPQGIAHVAEAIRDSQS"
FT   gene            173159..173482
FT                   /locus_tag="TM1040_0157"
FT   CDS_pept        173159..173482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0157"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62890"
FT                   /db_xref="GOA:Q1GKC6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC6"
FT                   /protein_id="ABF62890.1"
FT                   /translation="MDEAVAAQGFAAMGSEARLEVLRVLVRAGETGVSVGDIRERTGIA
FT                   ASTLAHHLKFLAAAGVVSQEKVGRSTICRADLAHLERLAGYILSECCLDEKLGQVARVA
FT                   NDG"
FT   gene            173475..174506
FT                   /locus_tag="TM1040_0158"
FT   CDS_pept        173475..174506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0158"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62891"
FT                   /db_xref="GOA:Q1GKC5"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC5"
FT                   /protein_id="ABF62891.1"
FT                   /translation="MADTSLSLRPMRAALEGMQSPWTLGALILAVVALVDGANFWPVLS
FT                   FAAQALLSTSKYILFAVTLLAYLKATGAEAMVARAFVGRETRMIFLAALLGGLAPFCSC
FT                   EVIPFIAGLLALGAPLSAVMAFWLSSPLIDPPTLLITAAALGWPFALAKAVSAVALGLF
FT                   GGFVVKALRRGGLFAEPLKRAPVKSCCGCAAPATDARPNWRFWQDAERREIFRGQFVEN
FT                   ALFLLKWLAFAYVLEALLVTYVRPEWIAAIVGGEGVVPIAIAAVVGMPAYLNSYVAPPL
FT                   LAGLMSQGMSAGAALAFMIAGAVSSIPAMAAVWSLVKPRVFATYLGLGVSGAILSGVVF
FT                   QMI"
FT   gene            complement(174832..176232)
FT                   /locus_tag="TM1040_0159"
FT   CDS_pept        complement(174832..176232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0159"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62892"
FT                   /db_xref="GOA:Q1GKC4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC4"
FT                   /protein_id="ABF62892.1"
FT                   /translation="MHGTFTDNDLSHVIEADKAHVWHHLVQHKPFETSDPRIIVEGKGM
FT                   RVWDQNGKEWLDAVSGAVWTVNVGYGRESICKAVYDQMMKMCYFAQAAGSVPGALYAEK
FT                   LIEKMPGMSRVYYCNSGSEANEKAFKMVRQIAHKKYGGKKTKILYRDRDYHGSTLAAMS
FT                   AGGQDERNAQYGPFAPDFVRVPHCMEYRKHELGLEHLSGEEFGIAAANLIEEVILREGP
FT                   ETVGALCLEPVTAGGGVIEAPEGYWPRVQEICKTYDVLLHIDEVVCGIGRTGTHWFGYQ
FT                   HYGIKPDFVTMAKGVASGYAAIACMVTTEEVFELFKDDTSDKLNYFRDISTFGGCTAGP
FT                   AAALENMRIIEDEGLLENCTKMGERMISNLRVLQEKHAVIGDVRGKGLFLGAELVTDRD
FT                   TKEPVEEALAQKVVAECGNHGVIIGVTNRSVPGRNNTLCFSPALIATADDIDKITDAVD
FT                   KALTTVFG"
FT   gene            176517..177329
FT                   /locus_tag="TM1040_0160"
FT   CDS_pept        176517..177329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0160"
FT                   /product="protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62893"
FT                   /db_xref="GOA:Q1GKC3"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC3"
FT                   /protein_id="ABF62893.1"
FT                   /translation="MTEFTLMVAPNGARRGKADHPALPMTAPELAETALACHRLGAQAL
FT                   HLHVRDAEGVHSLDAGRYREAMSLVSEAVPTMGIQITTESAGLFDVGAQLACLEALRPA
FT                   AASVSVREMARDKSLAARAYALCSEAGTQVQHILYTPECVEQLEAWYADGTVPDEMRDV
FT                   ILVLGQYATGQPARPAMLPPFLALIAPLDLRWSLCAFGPEEHACLLAAVEAGGQVRIGF
FT                   ENSLGPMGGPAWADNAASVEAFLNLTVARGHTLDPHQNMPGANLRELT"
FT   gene            177326..178654
FT                   /locus_tag="TM1040_0161"
FT   CDS_pept        177326..178654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0161"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62894"
FT                   /db_xref="GOA:Q1GKC2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC2"
FT                   /protein_id="ABF62894.1"
FT                   /translation="MSHVFPRHTKSDLPTAVGGDGCYLIDANGKRYFDGSGGAAVSCLG
FT                   HSDAAVIKAVQEQVEKLAFAHTGFMTSEPAEALADLLISKAPGTLDRVYFVSGGSEATE
FT                   AAIKLARQYHLERGEPQRRHLIARRQSYHGNTLGALAAGGNAWRRQQFDPLLIGVSHIA
FT                   PCYEYVDRSDGESSFDYGQRVANELEAEILRLGPDTVMAFMAEPVVGATLGAVPAVEGY
FT                   FKRIREICDTYGVLLILDEVMCGMGRTGHLFACDADGVAPDILCIAKGLGAGYQPIGAM
FT                   LCSSAIYDAIAQGTGFFQHGHTYLGHPVATAAGLAVVNQMLERDLVSRVAEKGTQLQAA
FT                   LMERFAQHPNVGDIRGRGLFRGLELVQDRDSKAPFDPAHGLAARIKRAALEAGLICYPM
FT                   SGTRDGRMGDHILLAPPFILSETQIEEICDKLAIAIEEGLASI"
FT   gene            178748..179851
FT                   /locus_tag="TM1040_0162"
FT   CDS_pept        178748..179851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0162"
FT                   /product="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62895"
FT                   /db_xref="GOA:Q1GKC1"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC1"
FT                   /protein_id="ABF62895.1"
FT                   /translation="MPRHRDDTAPRRQKRTAIMSQYTQTPGARPQQVLCDLRSDTVTRP
FT                   DAGMRAVMADAEVGDDVYGEDPSINRLESALAERAGKEAALFLPTGTQSNLVAMLAHCG
FT                   RGEEVITGRDYHVYKYEAGGASALGGVVLDALRVSEDGGLEPAEIAAAIKEDDSHHPIS
FT                   RLLSLENTHNGKVVSLARLDKSIAVARDAGLAVHLDGARVFNAVTALGCELTDIAGRFD
FT                   SVSICLSKGLGAPVGSVLVGPTEIIVRARRLRKMVGGGMRQAGVLAAAGLYALEHNVTR
FT                   LAEDHARAAELAETLRGLGAGMVAHNTNMVFFTPEAGNNAALGAALAEAGVVISAGGTG
FT                   AIRMVLHKDVTSEGFEATLAALRSHYG"
FT   gene            complement(179945..180706)
FT                   /locus_tag="TM1040_0163"
FT   CDS_pept        complement(179945..180706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0163"
FT                   /product="putative carboxyphosphonoenolpyruvate
FT                   phosphonomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62896"
FT                   /db_xref="GOA:Q1GKC0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKC0"
FT                   /protein_id="ABF62896.1"
FT                   /translation="MSQIEKATRFAALHQKGDPVVLYNIWDAAGAKALAENGAPAVATG
FT                   SLSMAAAHGYADGESIPLDFVLRIVARICETVSVPVTVDFEGGYATAPSEVGENVRKVL
FT                   RAGAVGINFEDRVVGGSGLHPVSVQVDRIHAIKTVAAEEGVPLFINARTDLFLGRDPET
FT                   HRDQLPEALERAAAYSEAGACGFFVPGLTELDLIAHCVEHTHLPVNVMMRGQAQSLKEI
FT                   AALNVARVSYGPGPFFKFLTDLKAAEARLRA"
FT   gene            complement(180902..181501)
FT                   /locus_tag="TM1040_0164"
FT   CDS_pept        complement(180902..181501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0164"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62897"
FT                   /db_xref="GOA:Q1GKB9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GKB9"
FT                   /protein_id="ABF62897.1"
FT                   /translation="MAAQDNSDIEALIALMAKLPGLGPRSARRAVLHLIRKRALVLTPL
FT                   ADAMSRVAETARECLNCGNVGTSDICALCEDETRANGELCVVEDVADLWAMERAGVFKG
FT                   RYHVLGGTLSALDAIGPEDLRIPRLVDRVSTEGVSEVILALNATIDGQTTAHYIADQLS
FT                   GRVKLTSLAQGVPIGGELDYLDDGTISAALRARKEI"
FT   gene            complement(181645..181989)
FT                   /locus_tag="TM1040_0165"
FT   CDS_pept        complement(181645..181989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0165"
FT                   /product="conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62898"
FT                   /db_xref="GOA:Q1GKB8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB8"
FT                   /protein_id="ABF62898.1"
FT                   /translation="MFKGLSGLGDMAGMMKKAQEMQSKMGEMQEELHNIMVVGEAGAGL
FT                   VKATASAKGDLKSLDIDPSIFNGDDKEVVEDLILAAVKDAQTKAAERAQDEMTKLTEGL
FT                   GLPKDMKLPF"
FT   gene            complement(182088..183914)
FT                   /locus_tag="TM1040_0166"
FT   CDS_pept        complement(182088..183914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0166"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62899"
FT                   /db_xref="GOA:Q1GKB7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB7"
FT                   /protein_id="ABF62899.1"
FT                   /translation="MSEHSPEISDAVQSGQYQVLARKYRPETFADLVGQDAMVRTLKNA
FT                   FAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGEDGQGGPTTEPCGKCEHCTAIMEG
FT                   RHVDVMEMDAASRTGVGDIREIIDSVAYRAASARYKIYIIDEVHMLSTSAFNALLKTLE
FT                   EPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLLRRIATSEQAEIADDAL
FT                   ALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDLMDMILRGDAA
FT                   AALTELSAQYAEGADPMAVLRDLAEITHWVSVVKITPDAAEDPTISPDERARGQDMAAR
FT                   LPMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPSPEELLRKLQDTPPP
FT                   PHPGGPGGGHPMQGMGSPAAGGGGGAPAYASAPPQGAPGGDPRGGHTMSTSGGQSAVLA
FT                   QRADSALARYPSFEHVIELIRHHRDVKLLVEVETGVRLVSYQPGRIEFTPAANAPQDLA
FT                   ARIGTALQNWTGSRWVVSIAPDGDAPTIAELRDAAQNALRAEASAHPLVQAVLQNFPKA
FT                   KITKIRTQEELAAEVQAEALPEVEDEWDPFEE"
FT   gene            184138..184677
FT                   /locus_tag="TM1040_0167"
FT   CDS_pept        184138..184677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0167"
FT                   /product="protein tyrosine phosphatase / dual specificity
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62900"
FT                   /db_xref="GOA:Q1GKB6"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB6"
FT                   /protein_id="ABF62900.1"
FT                   /translation="MVSATKLQPQQAEPTLSLHALSVGDGILALSRAPGAGGDYAADLR
FT                   LIHEWRPSMVISMTTRVEHVILGVETLGTDIQGLGSRWFHMPVEDYQTPTKDLEDHWHQ
FT                   VSALARQALSGGGRVLVHCRGGCGRSGMAVLRLMIESGEPPDAALARLRALRPCAVETD
FT                   AQMAWAYGRRRQAPPA"
FT   gene            complement(184688..185185)
FT                   /locus_tag="TM1040_0168"
FT   CDS_pept        complement(184688..185185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62901"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB5"
FT                   /protein_id="ABF62901.1"
FT                   /translation="MSRSSLRPLDPSAEGTRMTDHTETRDAGTHEFVSTTCLHLGRPCP
FT                   AAQRMLAALAKALDSARGLTKDDFEISGESRLDGCEKACPARFAASHARIRVFCDVQAT
FT                   TKTETLDRFADAMLSADGGSAHGTSSADMPRAFGEARPARPPVQAPSIRHPQGAQRPRL
FT                   MS"
FT   gene            185651..185750
FT                   /gene="ffs"
FT                   /locus_tag="TM1040_R0008"
FT   misc_RNA        185651..185750
FT                   /gene="ffs"
FT                   /locus_tag="TM1040_R0008"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            complement(185822..187720)
FT                   /locus_tag="TM1040_0169"
FT   CDS_pept        complement(185822..187720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0169"
FT                   /product="5'-Nucleotidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62902"
FT                   /db_xref="GOA:Q1GKB4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB4"
FT                   /protein_id="ABF62902.1"
FT                   /translation="MTQDDQDATGTQEEAGDQPGVTGRLRVLATSDVHSHLLGFDYYAD
FT                   QEHPGIGLSRTAQLIAEARKEAAEAGDIAVLLDNGDWLQGSPLAEPALATDSALAPAIH
FT                   AFEVLGYDAVGLGNHEFNYGLSALSRVLSALPCPAVSSNITPLSADDTLPVHKHLILTR
FT                   HFRRATGGQDGVAEVKIGLLSVLPPQTMLWDADHLAGRLHVDDMLRSAKAAISDLRASG
FT                   ADVVIALAHTGEGDDTARDGMENALRPLSRLPGLDAAIGGHTHLLLPPPDGSGRDWEIP
FT                   VVMPGSGGSHLGVIDLGLRQTPQGWRVEGGSAALRAVAHQTRDGLRPVVSEAPDLVLAL
FT                   RDVHEQTRAEMAAKVGTLSEAHHSYFTYFAEDRALALIATAQAAAVQPMLLKSEYADLP
FT                   LLSAVAPAKFGGRAGPLNYTDVPPGEISRRHVADIYSYPNELRCIIVNGHQVRDWLEMS
FT                   AGLFNQLEPDADARLLADPARPGHNFDVIFGLQYEIDPREHARFDAEGRRLHEGPGRIR
FT                   NLQWNGRPMHGDQQFAVAFNSYRSSGGGNFRMLMDAPGLPLPPQMIRDVVGAYVASAHD
FT                   LSAVFPAPWRFSPDLGVDAIALTGPGARRHLHELPENVARSATELDTGFLALKLRL"
FT   gene            187981..188964
FT                   /locus_tag="TM1040_0170"
FT   CDS_pept        187981..188964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0170"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62903"
FT                   /db_xref="GOA:Q1GKB3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB3"
FT                   /protein_id="ABF62903.1"
FT                   /translation="MKRAEQVTFGGSGLDRAALLRADGDALQTLWDAADVQIMLLWRGK
FT                   PLCVFAPDHAEIEGLAFLNARDPLVSGRRAEALFLGRSAEGAGYFAVSLEDWQPEGLDT
FT                   TTLDSFLDPSEQRHPDLPDSYAFLELRRVMTHLSARDAELAATAKAMLSWHASHGFCAC
FT                   CGEPSRVEQAGWQRRCPSCNAPHFPRTDPVVIMLITRGDRVLMGRSPGWPEGMYSLLAG
FT                   FVEPGETLEAAVRREVLEESGVRVGEVGYLASQPWAFPMSLMFGCSGVALSEDITLDPQ
FT                   ELEDAFWMTRQEAMDAIAGHHPKVRAPRKGAIAGFLLENWVADTLE"
FT   gene            189050..189517
FT                   /locus_tag="TM1040_0171"
FT   CDS_pept        189050..189517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62904"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB2"
FT                   /protein_id="ABF62904.1"
FT                   /translation="MHFETKEDTDSPIDEVFAAVTDFESFERSAIRRGVEVRRNGDSDA
FT                   APEDLSWDVVFMFRGSERKMRVEVAECDRPNTVVFAATGSGMTGLLRVDLMALSPRRTR
FT                   MTVRLEMKPKTLAARLLVQSLKLARNKLNRRYRKRVAEFVDLLENRQSQTA"
FT   gene            189692..191749
FT                   /locus_tag="TM1040_0172"
FT   CDS_pept        189692..191749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0172"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62905"
FT                   /db_xref="GOA:Q1GKB1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB1"
FT                   /protein_id="ABF62905.1"
FT                   /translation="MYRLLDCITQEHDYAFVAVAALICVIGSLLSVHMSGRLTEWTGKR
FT                   KIVQLPLAGLVTGATIWSTHFIAMTAYDPGYEHGYEPVLTATSLFVGVIGSFAANASLA
FT                   FVPGRGAPVLAGGLFGLTVSAMHYTGMQAYLVPGTLYWNTGAVAASVLLGVGLGALSYV
FT                   LMARPMRGIVGRLGPALVMVLAICLMHFTGMSAIEVLFDVAVDVPPKTISDNAMALLVF
FT                   AVTAIILLIAMASASIEVNMEDDARDQLNHAATHDPLTGMPNRMWLTRKLDALKIRLDE
FT                   NETRRCAIMTIDLNLFKEVNDVYGHSAGDAVLRCVALRMMQHEGEGECVTRVGGDEFVA
FT                   IKEGFRRMEEVLSFAERLHAAIVEPVDLEDVSLRVGASIGIATTMDDGRDPADLLHKSD
FT                   VAMYRAKSDPDTPICRFNAEMDRRSREKTQIVHDLRLAVDNDEFELVYQLQNALDTMEP
FT                   VGFEVLLRWNHPKRGRVSPDVFIPIAEETGLIRDIGHWVLREACREASLWRRPFSVAIN
FT                   VAPQQLVQPSFVEDVMDILMETGLDPARLELEVTEASIIDDQAHTLKVMHKLKSIGIRI
FT                   AMDDFGTGYSSLATLQAFPFDKIKIDRSFVQDVHKDAQRAAIVRSTLLLGAALDIPVLA
FT                   EGVEVEDELRFLRAESCSSVQGFYFGKPMPRDDMRAIACRDDGEADVGVA"
FT   gene            191860..192174
FT                   /locus_tag="TM1040_0173"
FT   CDS_pept        191860..192174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0173"
FT                   /product="transposase, IS5 family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62906"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKB0"
FT                   /protein_id="ABF62906.1"
FT                   /translation="MARLKPFFPKSHGRPRVDDRRVLSGIIFINRNGLRWCDAPSAYGP
FT                   HKTLYNRWKRWNDKGIFAQMMAGLAAEHGEEKTVMIDATYLKAHRTATSLGVKKGGVDA
FT                   "
FT   gene            192195..192584
FT                   /locus_tag="TM1040_0174"
FT   CDS_pept        192195..192584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0174"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62907"
FT                   /db_xref="GOA:Q1GKA9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA9"
FT                   /protein_id="ABF62907.1"
FT                   /translation="MTTKLHAICDSRGRPLNLFVTAGQVSDYNGARALLSSLPDVEWLL
FT                   GDRGYDADWFREALNDKGIRACIPGRKQRKKPVKYDKRRYRRRNRIEIMFGRLKDWRRI
FT                   ATRYDRCPKVFLSAIALAALVIYWL"
FT   gene            complement(192594..195974)
FT                   /locus_tag="TM1040_0175"
FT   CDS_pept        complement(192594..195974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0175"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62908"
FT                   /db_xref="GOA:Q1GKA8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA8"
FT                   /protein_id="ABF62908.1"
FT                   /translation="MEPNRTHRPVETFSTARLSPPHAGPGYAELCVTSNFTFLTGASHP
FT                   EELVTRAAELGLAAIAITDRNSLAGVVRAWSALKELRREAEAGIQIRSHQRVDPSSRQK
FT                   IDTSAPLEPPAAPTLPKLIVGCRLVLRDSQTDWIALPRDRAAYARLTRLLTLGKRRAPK
FT                   GECHLDARDLMAACRGMSLIALPQSDLKTAIPEIRRMQQCFPHYVFLGAAPRYDGSDQA
FT                   YLAACAHAAQITSAPMVAVGDVLMHRASRRPLADVLTCMREHITIDEIGSRALPNSERR
FT                   LKAGADMARLFQAHPAALRRTLEIADKCSFDLGELSYDYPHEIVDGETPQARLERLAAE
FT                   GLRRRYPDGPTQKAVVLMDKELKLVAELGFAAYFLTVHDIVQYAKSQNILCQGRGSAAN
FT                   SILCYLLGITDVSPDMITMVFERFVSRYRGEPPDIDVDFEHERREEVIQWIYQKYGRDR
FT                   AGLCATVIHFRSRAAIREVGKVMGLSQDVTAGLSGQIWGMSNGGVDLKRIEELGLDIQD
FT                   RRLMQTIRLIGEIIGFPRHLSQHVGGFVITKGRLDELAPIENAAMEDRTVIEWDKDDID
FT                   ALGILKVDVLSLGMLTCLQKSFALLKAHEGETLSIGTVPQEDAKTYAMLCRADAVGVFQ
FT                   VESRAQMNFLPRMQPREFYDLVIEVAIVRPGPIQGDMVQPYIRRRNGLEEPEPFGPELE
FT                   QVTKRTLGVPLFQEQAMQIAVVGAGFTPEEADHLRRSLASFRRMGTIGTFRDKFINGML
FT                   DKGYSQEVAARCFSQIEGFADYGFPESHAAAFAMLAYVSAWLKCHHPAVFACALLNSQP
FT                   MGFYAPAQIVRDAREHGVEIRPICVNASDWDNQLERRPDGALALRLGFRQIKGFREEDA
FT                   GWITAARGNGYPDPESLWLRAGLRPDVLTRLAEADAFSDMGLTRRDALWQVKAIRSAKP
FT                   LPLFDDPIDGESISEPAVDLPVMHLGEEVVEDYISTRLTLRAHPMELLRPALPGLTPHA
FT                   ALLDAPLGRHTVCGLVITRQRPGTASGVIFLTLEDETGVSNVVVWPKIYEQYRRIVMGG
FT                   RLLQVRGYLQREGIVVHLIAQEITDMSHRLSDLGHPLDEAVGITQPQADDAPRPRQATT
FT                   SARHPREQAKRLFPSRDFH"
FT   gene            complement(195974..197275)
FT                   /locus_tag="TM1040_0176"
FT   CDS_pept        complement(195974..197275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA7"
FT                   /protein_id="ABF62909.1"
FT                   /translation="MTYSDARAFCPDLRSQVAHPPEDQRFLQGLRRWATRYCPWVGLEG
FT                   DDGLVLDVTGSTHLFGGEEAMLTQMRRRLARAGMTVRIGLGNTRGAAWALAHHGEGIAP
FT                   AGDMLEALAPLPVAALRLDTNTSVALQRLGIRTIRELATTPRAPLTRRFGPTALMRLDQ
FT                   ALGNQPEEISPQAEPPHYGVRLTLPEPIGLVGDVMAGIRRLLEQLCPKLQAQEVGARRL
FT                   CVTLGRVDRDSQQIELRLARPLHDAHRILPLFERGLKDLDAGFGIERLRLEATVVEPLP
FT                   ARQLTHVSAARKDKLEDLISRLGTRVGLENIQRFLPADSHIPERSFIISPAAYSDPAPH
FT                   WTLPRPRPLLLFAPEPIAGRTPRPPQRFRWRRMALTTGRAIGPERICPEWWMEDEAWRS
FT                   GLRDYWRVETQEGRRLWLFFTPQAPSWFVQGEFA"
FT   gene            complement(197394..197981)
FT                   /locus_tag="TM1040_0177"
FT   CDS_pept        complement(197394..197981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62910"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA6"
FT                   /protein_id="ABF62910.1"
FT                   /translation="MANAPLPFPLVEGRAHEVCGAGAYSFAFALAAARGGQVLWVRETW
FT                   EAARINPDGFAEFINPADLLLCNAPSQIDALAATEEALRSGAVALVVVSLTKPLGLTEG
FT                   RRLQLAAKEGKSIGLALIPEGMGSNAAETRWRCSPHFDAAETSLNRPSPSPDDSTLQRW
FT                   ELIKNKSGTLGVWYVRWDRASRRLAMVSPAGK"
FT   gene            complement(198056..198667)
FT                   /locus_tag="TM1040_0178"
FT   CDS_pept        complement(198056..198667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0178"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62911"
FT                   /db_xref="GOA:Q1GKA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA5"
FT                   /protein_id="ABF62911.1"
FT                   /translation="MSKAGQVRGRGRPRKFDEQVVRQTILSVFWEKGYAATSLDDLSKA
FT                   TGLVRPSLYAAFGNKEEMFLRAMDDFVIRVQSDLNRQVPRDATPEDALRIIYTAMLEIY
FT                   SGAHAKGCLVFSTAVAEAPAHPEIRARLAQRLVQTDAQFRRLFDHTAPGASETARQAAA
FT                   EMAAAVLHSLGLRVRAGAEPDEVRRFIETAARSIAAGLAP"
FT   gene            complement(198664..199296)
FT                   /locus_tag="TM1040_0179"
FT   CDS_pept        complement(198664..199296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0179"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62912"
FT                   /db_xref="GOA:Q1GKA4"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA4"
FT                   /protein_id="ABF62912.1"
FT                   /translation="MLLTDLVTPPDTALCAAAEEMARMASDPFLYNHVSRSYIFGALAA
FT                   RATGTQYDPELFYIAAMLHDLGLTETYMAEDRFEVDAAEAAAKFLAAQNVEQSRIDRVW
FT                   DAIALHTTFSIPQKKSPEAALVQIGAGLDVGVMPHDHITPEVMEQVLDAYPRLGFKKAM
FT                   EQALIKVYAAKPMTAMHNFGADVAHRHVPDFHPPHFCDVLHGADFPE"
FT   gene            complement(199436..200230)
FT                   /locus_tag="TM1040_0180"
FT   CDS_pept        complement(199436..200230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0180"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62913"
FT                   /db_xref="GOA:Q1GKA3"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA3"
FT                   /protein_id="ABF62913.1"
FT                   /translation="MTGVLTGKRGLIMGVANERSIAWGIAKAMHEAGAELAFTYQGEAF
FT                   GKRLEPLAASVDSDFMVDVDVTDDASLDTAFAQLGARWPKIDFLVHAIAYSDKNELTGR
FT                   FINTSRANFKNSMDISAYSFIEVARRAYPLMQENGGGTMMTLTYGGSNRVTPNYNVMGV
FT                   AKAALESATRYLANDLGPDGIRVNAISPGPMKTLAGAAIGGARKTYKHTEQNAPLRSNA
FT                   TLEAVGGTAVYLASDAGAYTTGEIIRVDGGFHVLGMPQQEHL"
FT   gene            complement(200236..201465)
FT                   /locus_tag="TM1040_0181"
FT   CDS_pept        complement(200236..201465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0181"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62914"
FT                   /db_xref="GOA:Q1GKA2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA2"
FT                   /protein_id="ABF62914.1"
FT                   /translation="MRRVVVTGLGIVSSIGNNAEEVIASLRAGKSGIVASEEMAEHGFR
FT                   SQIAGTLKIDPAEHVDKRTLRFMGPGAAYAHIAMGQAIADAGLSEDQVVNERTGLVAGS
FT                   GGPSTSSMLTAHQTVLKTGATKRIGPFAVPKCMSSTISANLATAYKIKGINYSITSACS
FT                   TSLHCIGNAAEQIMMGKQDVMFAGGGEELDWTLSCLFDAMGAMSSKYNETPEKASRAFD
FT                   QDRDGFVISGGGGIVVLEDLEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMR
FT                   LALQTLPEGRKVSYINAHGTSTPVGDVGEVEAARRVFGAGNVPPISSTKSMTGHAQGAA
FT                   GALEAIFCLLMLDNDFITPSINVETLAEGIEEGEVATQYVENAGLDSVMTNSFGFGGTN
FT                   GSMVLSKYKE"
FT   gene            complement(201548..202057)
FT                   /locus_tag="TM1040_0182"
FT   CDS_pept        complement(201548..202057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0182"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62915"
FT                   /db_xref="GOA:Q1GKA1"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA1"
FT                   /protein_id="ABF62915.1"
FT                   /translation="MAQYPNSFDKEDLLKCARGELFGPGNAQLPAPPMLMMDRITEVSA
FT                   DGGEHGKGHILAEFDITPDLWFFDCHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWQGRG
FT                   YALGVGEVKLTGMVRPDRKMLTYRVDFTKAIQTRRLTMGVADGIVEADGEVIYQVKDMK
FT                   VALSES"
FT   gene            202285..202713
FT                   /locus_tag="TM1040_0183"
FT   CDS_pept        202285..202713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0183"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62916"
FT                   /db_xref="GOA:Q1GKA0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GKA0"
FT                   /protein_id="ABF62916.1"
FT                   /translation="MTPTHEENANKWLMEAGLRPTRQRVTLAALLIGDGQHRHVTAESL
FT                   FDAAKDDGAAVSLATVYNTLRAFCDAGVLQEITVDGSKSYFDTNVHDHPHYYWEGEGRV
FT                   SDAPSEELVIQSLPEPPEGMEIASVDVVIRLRHKAERG"
FT   gene            complement(202858..203727)
FT                   /locus_tag="TM1040_0184"
FT   CDS_pept        complement(202858..203727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62917"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK99"
FT                   /protein_id="ABF62917.1"
FT                   /translation="MHYRALGDFLQTGKPILSKGPVALIFIEDEVEIGTTLRHHLNCGF
FT                   KAVVALMPDAFDIPEDVAPLIHRVPYDCSSANSVTMAMNQIIAAATPGCWLYYCYNSEY
FT                   LFYPFCETRTVSEMLTFHTEERRNAMLTYVIDLYAGDLAAHPGAVSIENAHLDKSGYYA
FT                   QGRKDPETGHPRERQLDFFGGIRWRHEEHIPETSRKIDRIALFQAKPDLTLQSDHTFND
FT                   QEYNTYSCPWHHNLTAAICSFRAAKALKRNPGSTFDIQSFKWHNSAPFEWHSRQLLDLG
FT                   LMEPGQWF"
FT   gene            203892..205214
FT                   /locus_tag="TM1040_0185"
FT   CDS_pept        203892..205214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0185"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62918"
FT                   /db_xref="GOA:Q1GK98"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK98"
FT                   /protein_id="ABF62918.1"
FT                   /translation="MSAPKKLYIKTYGCQMNVYDSERMAETLGGQGYVETQTPDDADMI
FT                   LLNTCHIREKAAEKVYSELGRFKGLKAEKPDLKIGVAGCVAQAEGEEIMRRQPLVDLVV
FT                   GPQSYHRLPEMEAKAGTGEKVLDTDFPEEDKFEKLKRRPKAKRGPTAFLTVQEGCDKFC
FT                   AFCVVPYTRGAEVSRPVDRVLREAEDLVERGVREITLLGQNVNAYHGAGPNGDMTLAQL
FT                   IWELDKIDGLERIRFTTSHPNDMMDDLIEAHGTCKKLMPYLHLPVQAGSDKILKRMNRS
FT                   HTAESYIRLIERIRAARPDILISGDFIVGFPEETEEDFQATLDLVEEVKYGTAYSFKYS
FT                   TRPGTPAAERAQVDPKEADDRLQRLQAVLTRQQREVQDSMVGRELGVLFEKAGRFAGQM
FT                   VGKSDYLHAVHVADCDAKIGDLRRVRIVSSGANSLAGELID"
FT   gene            205559..206137
FT                   /locus_tag="TM1040_0186"
FT   CDS_pept        205559..206137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0186"
FT                   /product="OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62919"
FT                   /db_xref="GOA:Q1GK97"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK97"
FT                   /protein_id="ABF62919.1"
FT                   /translation="MFDQVFAKTSAVLACVGFSIVLSGASPALAQDGNQIRAERYVPTI
FT                   WVDPDGCEHWVMDDGAEGYMTTHMTPDGKPVCRRGQLCGMMPTDQFFPTNGSTVNAAGR
FT                   KRLQEWFQSVMPGTRSFVVAGHTDSRASDEYNMALSQRRADAVAQIGRSVGARIKDVRA
FT                   YGERSPRVPNRGAANLAQNRRVEIYCIRR"
FT   gene            206149..206454
FT                   /locus_tag="TM1040_0187"
FT   CDS_pept        206149..206454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0187"
FT                   /product="lipoprotein putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62920"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK96"
FT                   /protein_id="ABF62920.1"
FT                   /translation="MKTTKAIAILMLGLSLAACSDNGDKTRDRNFFDGGDGDLAGLVAG
FT                   IWVDPQGCEHWIVDDGVEGYLDPRRTPDGRPVCNSDLPRNTASGPFKSGSRFADPI"
FT   gene            206670..207686
FT                   /locus_tag="TM1040_0188"
FT   CDS_pept        206670..207686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0188"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62921"
FT                   /db_xref="GOA:Q1GK95"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK95"
FT                   /protein_id="ABF62921.1"
FT                   /translation="MATSVLPPSSEHAQPPEVLLEFPDNRLLIELCGEFDRNLAEIEQR
FT                   LGVQIVRRGNQLIVHGDADMRQQAGELLQVLYERLESGRPVEREDIDREIRLDRSDEDG
FT                   GAGPDSQLEMFSGGKVEIKTRKKLVEPRTDAQKVYVKNLFEHEMAFGIGPAGTGKTYLA
FT                   VAVGVSMFIQGHVDKIILCRPAVEAGERLGFLPGTQEEKVDPYMQPLYDALNDFLPGKQ
FT                   LAKLKEEKTIEIAPLAFMRGRTLSNAFVVLDEAQNATTMQMKMFLTRLGEGSRMVITGD
FT                   RSQVDLPRGVQSGLQDAERLLSPIPKISFNYFTAKDVVRHPLVAAIIEAYDKDENSA"
FT   gene            complement(207790..208269)
FT                   /locus_tag="TM1040_0189"
FT   CDS_pept        complement(207790..208269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0189"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62922"
FT                   /db_xref="GOA:Q1GK94"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK94"
FT                   /protein_id="ABF62922.1"
FT                   /translation="MPTALDIRPADPASAPVKPLLEAHLKHTSTTSSPEACHALDLDAL
FT                   KAPEIHFFAAYDNDIAVGCGALKDLGQGQMEVKSVHVAASARGRGIARALMLRLHAFAA
FT                   QSGARTLFLETGSDQLPAFDAARALYERLGYTYCAPFGDYTAHPESAFMRYACAG"
FT   gene            208272..208856
FT                   /locus_tag="TM1040_0190"
FT   CDS_pept        208272..208856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0190"
FT                   /product="protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62923"
FT                   /db_xref="GOA:Q1GK93"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK93"
FT                   /protein_id="ABF62923.1"
FT                   /translation="MGSFIGRVLSKVLFFRGGSSYGGRMILDVVIEDARWDAAALEKQA
FT                   QEAVSATLAYLELEDEDWEVTVLGCDDARIADLNAEFREKPKPTNVLSWPAQELAAAQD
FT                   GGQPTPPEVDFMGDAALGDIAISYDTCVKEANLAHKSREDHVRHLLVHGTLHLLGYDHI
FT                   RDGDATIMETLEVGILGKLGIPDPYIIEDGP"
FT   gene            208879..209781
FT                   /locus_tag="TM1040_0191"
FT   CDS_pept        208879..209781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0191"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62924"
FT                   /db_xref="GOA:Q1GK92"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK92"
FT                   /protein_id="ABF62924.1"
FT                   /translation="MGDIEGSSNAAHRALQDIEATEPHVDGAETPGFLSKIFGSFSPSA
FT                   EDDEPESGEDEVLADPPPGMMNLRRLRVEDVAIPTAEIDAVPVTISREDLVRVFRDSGF
FT                   TRIPVYEGTLDTPLGFVHLKDLALTYGFDCENDDFDITPMLRPLLFVPPSMPIGVLLTK
FT                   MQAERRHMALVIDEYGGVDGLVTIEDLIEQVVGEIEDEHDSGEDQTWVQEKPGCYVAQA
FT                   RTPLVDFENEIGIPLTQHEDVDGEEIDTLGGLVFMLSGRVPARGEVIEHPEGAEFEVVD
FT                   ADPRRIKRLRVRLPGIAAE"
FT   gene            209778..211304
FT                   /locus_tag="TM1040_0192"
FT   CDS_pept        209778..211304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0192"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62925"
FT                   /db_xref="GOA:Q1GK91"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK91"
FT                   /protein_id="ABF62925.1"
FT                   /translation="MNLPQRLGRLGSYGLAAGAGALMAQGLAPVSAVWATPISLLVVAA
FT                   LFHHASSPRAAAVVGWLFGCGYFGFGLSWIMEPFQVDAATFGWMAPFALMLMAAGLALF
FT                   WGVAFWGAARLGRGNGRIFALIGGWTLMELARAYVLTGFPWAGFAQLALIGDLALRAVP
FT                   WVGPHGVALAILLAILPLVLIRRRPLLAIGPAALVGVVTIWLPQGQPFGGHLPLTEQTV
FT                   RLVQPNAPQAEKWLPEKRWSFVQRMLEYTAAEPEQAFGNRPDLVIWPETAIPTLQNYID
FT                   DFRPALVEATRGSELLYGIQREENGRYMNSAVVMNAAGEALDIYDKMHLVPFGEYMPLP
FT                   QFWERFGVFGLASRAKGGYAPGTERRLLQTSAGRALALICYEGVFAQDVNAAPERPDYL
FT                   VLITNDAWFGSYSGPYQHLVQAQLRAAEQGLPMVRVANTGITAVIDPYGQIRDSLALNT
FT                   SGYLDARLPAPLPPTLYSGTGDWPAALVAAFLLGVSVLPRLRLKRRRTLA"
FT   gene            211416..212597
FT                   /locus_tag="TM1040_0193"
FT   CDS_pept        211416..212597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0193"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62926"
FT                   /db_xref="GOA:Q1GK90"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK90"
FT                   /protein_id="ABF62926.1"
FT                   /translation="MSRTNYTFTSESVSEGHPDKVCDRISDAVLDALIAEEPEARVAAE
FT                   TFATTNRVVIGGEVGLSDQAKLKDYMGKIDEIARACIKDIGYEQDKFHHETVEITNLLH
FT                   EQSAHIAQGVDAAGDKDEGAGDQGIMFGFATDETDALMPAPIQFSHAILRRLAEVRKNG
FT                   TLPVLGPDAKSQISVRYDAGKPVEVTSLVLSTQHLDEKLTSADIRALVEPYIRETLPEG
FT                   WLTDNTVWHVNPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRS
FT                   AAYAARYLAKNVVAAGLAHKCTLQLSYAIGVAAPLSIYVNTHDTGAVPDENIETAIRKC
FT                   MDLTPRGIRTHLGLNKPIYQRTAAYGHFGRAPEADGGFSWERTDLTEALKGAV"
FT   gene            212764..213438
FT                   /locus_tag="TM1040_0194"
FT   CDS_pept        212764..213438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK89"
FT                   /protein_id="ABF62927.1"
FT                   /translation="MAMAAWKKTIWVHAAVVCVALVALAGPALARKGSDKRLYVDGATL
FT                   VFDTESVSKGQPGEIVVSDIDLFRSMLQERSGIETLRLNSSGGSVYASSEIAWIVSDYG
FT                   LHTQVDGECVSACVDIFLAGARRQMTLGSKIGFHRRSWSPEAVEGYYNDLRENQGWDTP
FT                   FVFGSWIYADTQREMYEYLSYLVERGVEAGFAIETLQVDSGDEWYPSRLQLMAAGVLRE
FT                   AP"
FT   gene            213570..214337
FT                   /locus_tag="TM1040_0195"
FT   CDS_pept        213570..214337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0195"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62928"
FT                   /db_xref="GOA:Q1GK88"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK88"
FT                   /protein_id="ABF62928.1"
FT                   /translation="MSDSDASRPSAIASDGPDAAGKHASGAPWRNFYGRFKGKTLKPNQ
FT                   VRDLDEMLPELSPGAVGWDENPEREPLDLEAQFQGRDVWLEVGFGGGEHLVHQAESNPD
FT                   VGIIGAEPYVNGVAMLLGKLRKSSAENVRVHAGDARDLMDVLPAQSLSRAFLLYPDPWP
FT                   KARHHRRRFVTQEHLEPLARVLKPGAIFRVATDIPDYVRQTLEEVPKAGFKWLAEGPED
FT                   WRKPWGDWISTRYEQKALREGRTPHYLTFQRQD"
FT   gene            complement(214406..215035)
FT                   /locus_tag="TM1040_0196"
FT   CDS_pept        complement(214406..215035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0196"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62929"
FT                   /db_xref="GOA:Q1GK87"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK87"
FT                   /protein_id="ABF62929.1"
FT                   /translation="MFLDKLNWRYAAKKMDPSKPVSEDKVAQIVEAIRMAPTSSGVQPF
FT                   ELLVIRNKDLREKIRPVSWDQAQITDGSHLLVFAAWDNYTEERIDAVVAQMVEERGDSE
FT                   LLQNYFANLKEMLLPRPAEVNHAHAAHQAYIALGFALAAAAELGVDSTPMEGFDPDQVD
FT                   EILDLRAKGLRAKVLLPLGTRAEEGDWLLPMPKVRKSKAALVTEID"
FT   gene            complement(215228..215839)
FT                   /locus_tag="TM1040_0197"
FT   CDS_pept        complement(215228..215839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0197"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62930"
FT                   /db_xref="GOA:Q1GK86"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK86"
FT                   /protein_id="ABF62930.1"
FT                   /translation="MAFTIAIDGPAAAGKGTISKAVAAHFGFGHLDTGLLYRAVGAKML
FT                   DGDNPVAAAEALDVSDLDREDLRTPEVAQAASKVAVIAAVRAALVDFQRAFARRSGGAV
FT                   MDGRDIGTVICPEAEAKLFVTASADVRARRRFLELTAKGSVITLDEVLADVKARDERDM
FT                   NRAEAPLRPAEDAVIIDTSALSIDDAVAKAIAAIEARKPR"
FT   gene            complement(215899..216381)
FT                   /locus_tag="TM1040_0198"
FT   CDS_pept        complement(215899..216381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0198"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62931"
FT                   /db_xref="GOA:Q1GK85"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK85"
FT                   /protein_id="ABF62931.1"
FT                   /translation="MADVDLSRMPPPQGLRVVTGGPLDPQALAELRAEAMRPSLEASGR
FT                   FDPGRVRRRFLDRYDPTATAAFYDGSELVGVLVLRQMPDHLYLDHLYLAPTHQGTGLGA
FT                   QILQSIQEEIARPSRQEIRLIALTGSPAGPFYERAGFQRTGSDGIDDSYRWRPQPA"
FT   gene            complement(216374..217726)
FT                   /gene="aroA"
FT                   /locus_tag="TM1040_0199"
FT   CDS_pept        complement(216374..217726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="TM1040_0199"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62932"
FT                   /db_xref="GOA:Q1GK84"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK84"
FT                   /protein_id="ABF62932.1"
FT                   /translation="MSGHGTPIPMTSRRASPLKGEAHVPGDKSISHRSLILGAMAVGET
FT                   KISGLLEGEDVLDTAKAMQAFGAEVVNHGGGEWSVFGVGVGGFAEPENVIDCGNSGTGV
FT                   RLIMGAMATSPITATFTGDASLNKRPMARVTDPLALFGAQSVGREGGRLPMTIVGAAEP
FT                   VPVRYEVPVPSAQVKSAVLLAGLNAPGKTVVIEREATRDHSERMLAGFGAEITVEDTKE
FT                   GRVITLTGQPELKPQVIAVPRDPSSAAFPVCAALITPGSDVLVPGIGLNPTRAGLFYTL
FT                   QDMGADLTFENPRTEGGEPVADLRAKYSPDMKGIEVPPERAASMIDEYPVLSVVASFAT
FT                   GTTMMAGVKELRVKESDRIDAMAKGLRANGVTVEEGEDWWSVEGCGPEGVKGGGTAESF
FT                   LDHRIAMSFMVMGMGAQNPVSVDDGSPIATSFPIFERLMGDLGASIIRTDG"
FT   gene            218325..220001
FT                   /locus_tag="TM1040_0200"
FT   CDS_pept        218325..220001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0200"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62933"
FT                   /db_xref="GOA:Q1GK83"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK83"
FT                   /protein_id="ABF62933.1"
FT                   /translation="MAQTTSMEEFEALLQESFEMDTPEEGSVVKGKIIAIEAGQAIIDV
FT                   GYKMEGRVELKEFANPGEAPEVSVGDEVEVYLRAAENARGEAVISREMARREEAWDRLE
FT                   KAYADDQRVEGAIFGRVKGGFTVDLGGAVAFLPGSQVDVRPVRDAGPLMGLKQPFQILK
FT                   MDRRRGNIVVSRRAILEESRAEQRAEVIGNLSEGQAVDGVVKNITEYGAFVDLGGVDGL
FT                   LHVTDMAWRRVNHPSEILSIGETVKVQVIKINKETHRISLGMKQLQEDPWDLVGAKYPL
FT                   ESVHKGRVTNITDYGAFVELEPGVEGLVHVSEMSWTKKNVHPGKIVSTSQEVDVMVLEI
FT                   DGAKRRVSLGLKQTMRNPWEVFAETHPEGTQVEGEVKNITEFGLFIGLDGDIDGMVHLS
FT                   DLSWDERGEDAIQNYRKGDMVSAVVSEVDVEKERISLSIKALGGDKFADAVGGVKRGSI
FT                   VTVEVTAIEDGGIEVEYEGMKSFIRRSDLSRDRAEQRPERFSVGDKVDVRVTNIDSKTR
FT                   RLGLSIKAREIAEEKEAVEQYGSSDSGASLGDILGAALKSE"
FT   gene            complement(220102..220743)
FT                   /locus_tag="TM1040_0201"
FT   CDS_pept        complement(220102..220743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62934"
FT                   /db_xref="GOA:Q1GK82"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK82"
FT                   /protein_id="ABF62934.1"
FT                   /translation="MRPFSTGALALVAAMTVGFSSPGAAGNKHDHAHTHDEEVYKGYFD
FT                   DSQIQPRTLSDWEGDWQSIYPFLVDGTLDPVLAHKAEHSEKTAEDYRAYYEIGYATDVD
FT                   AITIQGQTVTFTANGASYGGEYVSDGYEVLTYKKGNRGVRYVFAKESGDALAPAFIQFS
FT                   DHHIAPKKVSHYHLYWGDDRAEVLKELTNWPTYFPASYSGDDIVHDMIAH"
FT   gene            221101..221388
FT                   /locus_tag="TM1040_0202"
FT   CDS_pept        221101..221388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0202"
FT                   /product="integration host factor beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62935"
FT                   /db_xref="GOA:Q1GK81"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK81"
FT                   /protein_id="ABF62935.1"
FT                   /translation="MIRSELIQKIADENPHLYQRDVERIVNTVFEEVTNAMSRGDRVEL
FT                   RGFGAFSVKKRDARVGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKEE"
FT   gene            221389..221739
FT                   /locus_tag="TM1040_0203"
FT   CDS_pept        221389..221739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62936"
FT                   /db_xref="GOA:Q1GK80"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK80"
FT                   /protein_id="ABF62936.1"
FT                   /translation="MRYIRYAVWGVLAVVLVSVSLANRGLVSLKLMPEALAELVGFNPS
FT                   ITLPLFVVVLGGLALGVALGYVLEYLREYKHRREARVKHGEVKKLSREVKRLKRQKHEG
FT                   KDEVLALLDDAS"
FT   gene            221741..222388
FT                   /locus_tag="TM1040_0204"
FT   CDS_pept        221741..222388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0204"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62937"
FT                   /db_xref="GOA:Q1GK79"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK79"
FT                   /protein_id="ABF62937.1"
FT                   /translation="MADIRVKICGMKTRADMEAAAAAGAAYVGLNFYAKSARSVTIAQA
FT                   AALASDAPVGLAKVGLVVNPTDADLDAITGSVPLDMIQLHGQESVERVAEIKTRYGLPV
FT                   MKVIGVAEAADLDPIDLYAQVADQLMVDAKAPKGAKLPGGNGISFDWQLLASKKYWQAP
FT                   WMLAGGLTPENVAEAIRKTGARQVDVASGVESAPAQKDPDLMRAFVEAAQAV"
FT   gene            222662..223507
FT                   /locus_tag="TM1040_0205"
FT   CDS_pept        222662..223507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0205"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62938"
FT                   /db_xref="GOA:Q1GK78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK78"
FT                   /protein_id="ABF62938.1"
FT                   /translation="MKSIPSLDDLDLFARIAQAGGLAVVARQSGVSVPTLSRRMRALEL
FT                   QIGVHLFERGSHGYRVTALGRAFLSETRAFQAEAQRLRRMVATPLMAEVRITAGSWTSA
FT                   FLAQQLPRFWQEDAQWRPAFLEADTRLDIARRGADIGIRNQRPEQAWLAGRYTGLITYA
FT                   VYAISDQVRGYVVLPENQAKTPSARWVWSHHGGEVAATARSPRMVADLACAGVGQVVLP
FT                   RFAAAMFPALQQVGPEIAELSHEEWLVCHHDGRHDPPVRAALEGIAAVLTDTTLRPIGA
FT                   "
FT   gene            223721..224980
FT                   /locus_tag="TM1040_0206"
FT   CDS_pept        223721..224980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0206"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62939"
FT                   /db_xref="GOA:Q1GK77"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK77"
FT                   /protein_id="ABF62939.1"
FT                   /translation="MAEDLINSFMNGPDENGRFGIFGGRFVSETLMPLILSLEEEYEKA
FT                   KVDPDFWAEMDDLWKNYVGRPSPLYFAERLTNHLGGAKVYMKRDELNHTGAHKVNNVLG
FT                   QILLARRMGKTRIIAETGAGQHGVATATVCAKFGLKCVVYMGAHDVRRQAPNVFRMRLL
FT                   GAEVIPVTSGRGTLKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSVIGKE
FT                   VRWQLAEQEGEGRLPDTVIAAIGGGSNAMGLFHPFLDDPSVNIIGVEAGGKGVDEKMEH
FT                   CASLTGGRPGVLHGNRTYLLQDDDGQILEGFSISAGLDYPGIGPEHAWLHETGRAQYVS
FT                   ITDKEALEAFQLSCAMEGIIPALEPSHALAHVTKIAPELPKDHIIVMNMCGRGDKDIFT
FT                   VARHLGFDMSDTEEGRDLEE"
FT   gene            complement(225112..225483)
FT                   /locus_tag="TM1040_0207"
FT   CDS_pept        complement(225112..225483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0207"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62940"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK76"
FT                   /protein_id="ABF62940.1"
FT                   /translation="MDARVEEDGTGRRQAYNVCLEPCAIERGMRIIGGKWTGSILWHLK
FT                   DGPVRFNDLSRMIGGASKKMISERLRQLETQGLITRTVMETAPVSVHYEITELGRTALG
FT                   FLDELRKWSESLPEGLTTS"
FT   gene            225625..226233
FT                   /locus_tag="TM1040_0208"
FT   CDS_pept        225625..226233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0208"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62941"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK75"
FT                   /protein_id="ABF62941.1"
FT                   /translation="MSKILILNGAQPYPFAPGGLNATLAERARARLLAQGHEVRLTTVA
FT                   EGYDVEQEVANHQWADAIILQFPVNWMGVPWSFKKYMDEVYTAGMDGRLCAGDGRTADA
FT                   PKANYGMGGTLGGTRYMISATFNAPAEAFDTPDEPFFEGASMDDLLRPVHLNAKFFDMA
FT                   PLPSFAAFDVMKNPEIDADLIRFDAHLDSLFAEAEDVAT"
FT   gene            226220..226921
FT                   /locus_tag="TM1040_0209"
FT   CDS_pept        226220..226921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0209"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62942"
FT                   /db_xref="GOA:Q1GK74"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK74"
FT                   /protein_id="ABF62942.1"
FT                   /translation="MSQPDIILYTANTMNGWKPLIFLHEAEIDYELVNVDFSKKEQHAP
FT                   DYVKMNPNGKIPTIWDRSEGRAIFESGAILWHLAEKYGRFLSSDPVERSETLQWLFFQV
FT                   GHIGPIMGQAMFFQRIAKPNGDEVPYAIKRYVDESRRLLEVLDTRLAGRDWLVGTEMSI
FT                   ADIATYPWARSHFWATVEVEGLPHLQAWFDRLDAMPKVQEALQLPEPRPSAFGKGDIAA
FT                   AASANAARFKE"
FT   gene            226926..227567
FT                   /locus_tag="TM1040_0210"
FT   CDS_pept        226926..227567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0210"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62943"
FT                   /db_xref="GOA:Q1GK73"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK73"
FT                   /protein_id="ABF62943.1"
FT                   /translation="MTLRVDIVSDVVCPWCVIGYLQLAKAAAETGTDLEVHWHPFELNP
FT                   QMAPEGENLREHLAAKYGTTPEDSRAARLRLTELGAALGFAFDYADDMRMVNTFRAHQL
FT                   IDWAEDQGKAHEMKRALFAAFFTRREDLNDVSVLADVAESLGLDRVAAVAMLEGGERAD
FT                   AVREKQQFWTSKGITGVPAMIFERQYLVTGAQGEETYARILTELSETTPA"
FT   gene            227730..228554
FT                   /locus_tag="TM1040_0211"
FT   CDS_pept        227730..228554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0211"
FT                   /product="Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62944"
FT                   /db_xref="GOA:Q1GK72"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK72"
FT                   /protein_id="ABF62944.1"
FT                   /translation="MRARLMLLLSALVMCFAAPVWAETRLLDRASVVAPHDGRVSDFLA
FT                   VDIGAGTRCVLSGSDLTRRHAPWSSFKIPNFVIALETGVATGPDHWRAWDPSLRPAAGF
FT                   WPKSWRQGQTLETALQRSVVWYFQDIARDVGGSRYREILKRWSYGNAEAPDGDDGFWLY
FT                   GPLAISVEEQVAFVSALLSGGIARSQDTLAALFAATRDSEDKGRIIYGKTGSGPLEQGR
FT                   AGAGFEGWYVGWVTRQDRAPVAFAHYVRARTYADLRVFRRDQSLILLEACGF"
FT   gene            complement(228609..229106)
FT                   /locus_tag="TM1040_0212"
FT   CDS_pept        complement(228609..229106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0212"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62945"
FT                   /db_xref="GOA:Q1GK71"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR019883"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK71"
FT                   /protein_id="ABF62945.1"
FT                   /translation="MTPTPRTFSHIGLSVPDLDAAVKFYSEVLGFYVLMPPSKVVEDDS
FT                   AIGVMCTDVFGPGWEHLRIAHLSTGDGIGIELFEFAGNHAPDDNFAFRRHGTFHFAIQD
FT                   PDLEGLLEKIIAAGGKQRMPVREYFPGEKPYRMVYVEDPFGNIFELYSHSYELTYSAGA
FT                   YA"
FT   gene            229195..230097
FT                   /locus_tag="TM1040_0213"
FT   CDS_pept        229195..230097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0213"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62946"
FT                   /db_xref="GOA:Q1GK70"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK70"
FT                   /protein_id="ABF62946.1"
FT                   /translation="MVIILVLNSTWLETFTVLAEEGHFTRAAARLNMTQPGVSQHLRKL
FT                   EQQLGRALISKEGKRFTLTSAGEAVRDLGLARRVEEQALRDTITRDDPDRGELRIACSG
FT                   SFAMLFYPRAIALMKEAPGLVIHVEATPQARVLEGVLAGHFDLGIVSDVPHHPRVEAQQ
FT                   LGQEELCLLLPAEVEDPVSFETLEALGLVAHPDVANYADDLFSRNFPIDFAGADRLKLR
FT                   TYINQISQIPSPVAAGVGYTLLPRSGLAAFAQSAQIRTARLPQPRYRELWRITRRGRIA
FT                   SARLKRVLAVVEDIAATLG"
FT   gene            complement(230182..230928)
FT                   /locus_tag="TM1040_0214"
FT   CDS_pept        complement(230182..230928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0214"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62947"
FT                   /db_xref="GOA:Q1GK69"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK69"
FT                   /protein_id="ABF62947.1"
FT                   /translation="MKLFVGLGNPGAKYAGNRHNIGFMALDQIASDHGFSPWKSKFQAQ
FT                   MSEGTLSGEKVILLKPQTFMNNSGQSVGEALRFFKLTPADVVVFHDELDLAPSKCRVKN
FT                   GGGHAGHNGLRSIHAHIGADYGRVRLGVGHPGHKDAVAGYVLRDFPKADQGWLDDLMRG
FT                   LSDGAAALATGDSGRFMNAVALRVAPPRSSTGEASKGRKKAQKSEPGVAKTPAKAATPE
FT                   APAAGDIPAAPEDSRSPMQKLLDKFK"
FT   gene            231109..231594
FT                   /locus_tag="TM1040_0215"
FT   CDS_pept        231109..231594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62948"
FT                   /db_xref="GOA:Q1GK68"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK68"
FT                   /protein_id="ABF62948.1"
FT                   /translation="MKDAISGRSQSPAGARLLHRLGAKAAVIACGLSVAGCAAVESGPA
FT                   VPAKSGSTVFEARQSLAFCAPQGPKGAKAAVTSSYIASMLFLGILPGAVIAAAGEEHTR
FT                   SQGAVNAVDDCLKDQGYERRELTAEETTAIKQRDRYAREQLLSHLIGGGTLADYTGP"
FT   gene            complement(231708..232337)
FT                   /locus_tag="TM1040_0216"
FT   CDS_pept        complement(231708..232337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0216"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62949"
FT                   /db_xref="GOA:Q1GK67"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK67"
FT                   /protein_id="ABF62949.1"
FT                   /translation="MANEIPDLECQVRAGTGKGAARAARRANLVPGVVFGGDADPLAIQ
FT                   IPYNVLLKRLKAGRFKSTLFNLKVEGHDDVRVICRDVQRDVVKDLPTHFDLMRLRRTSK
FT                   INLFIPVEFINEEECVGLKRGGVLTVVRAEVELVVTAGDIPEKLTVDLTGKAIGDVIHI
FT                   SDVTLPEGSKPTIDRDFVIANISAPSGLKSADDEAEGEDAEEAAAE"
FT   gene            complement(232430..233146)
FT                   /locus_tag="TM1040_0217"
FT   CDS_pept        complement(232430..233146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62950"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK66"
FT                   /protein_id="ABF62950.1"
FT                   /translation="MHSGRAATITKISAHKLACRSRTGYFMGMLIFTPQALAFVALPKT
FT                   GTTAIEKALRPHADIVFRKSQKHTSAQRFHRRIRPFVRSTFGIALESFAVLRDPEDQIR
FT                   SWYKYRCRDDIRDKPEFAGHLSFDAYVGAVLSEDPPPCAQIGSQYRMLSGRGGRILVDH
FT                   LFAYERWDQLETFLADRFGHRIIFEPHNVSPFAKAELSPSLQRKLRAARRAEFDLHARL
FT                   MDTDGKLQPRLRNMAD"
FT   gene            233213..234322
FT                   /locus_tag="TM1040_0218"
FT   CDS_pept        233213..234322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0218"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62951"
FT                   /db_xref="GOA:Q1GK65"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK65"
FT                   /protein_id="ABF62951.1"
FT                   /translation="MGFCVGAFAAYVPQLKSQAGLSDAEFGLALLIGAAGAVGAMWLAP
FT                   RVDRLLGHAAMTICALLLATAFLLPGLAQSWAGFAAAMFLASGAGGLLDVVMNARLSGL
FT                   EARSGRSLMNLNHGLFSLAYALAALVAGLVREAGVPPVWCFAGILLVSGLLALGMRDEV
FT                   PPAPAEDPQGNASLPLPGAMIVIAGLIVLIAFTAEQATEHWSALHLERAFGANAAEGAL
FT                   GPAILGFTMGIGRLSGQELVRRVAEGRLMQIAAALAASGLILAAFAPVQALAYAGFAIL
FT                   GLGVSTVGPTALAWVGKTIPSRLRAAAISRLVMIGYCGFFVGPPVIGFIAEVFGLRLAL
FT                   ALMGAMLLCITVLLVPALRASARKSELIA"
FT   gene            complement(234369..235532)
FT                   /locus_tag="TM1040_0219"
FT   CDS_pept        complement(234369..235532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0219"
FT                   /product="L-lactate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62952"
FT                   /db_xref="GOA:Q1GK64"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK64"
FT                   /protein_id="ABF62952.1"
FT                   /translation="MPVITNIEDLKRIYARRVPKMFYDYAESGSWTEQTFRENSTDFDQ
FT                   IRLRQRVAVDMAGRSTASQMIGQDVAMPVALAPVGLTGMQCADGEIKAARAAEAFGVPF
FT                   TLSTMSINSIEEVSEATSKPFWFQLYTMKDDDYIRRLIARAKDANCSALVITLDLQILG
FT                   QRHKDLKNGLSAPPKLTPKTIANLMTKWAWGIEMLGAKRRNFGNIVGHVEGVSDASSLG
FT                   SWTAEQFDPSLDWGKIEKLKEMWGGKVILKGILDEEDAKMAAKVGADAITVSNHGGRQL
FT                   DGALSSIRMLPRIMDAVGDQVEVHLDSGIRSGQDVLKALALGATGTMIGRAFVYGLGAM
FT                   GQKGVTRALEVIHKELDTSMALCGEKHVTDLGRHNLLVPEDFTGRWA"
FT   gene            235564..235827
FT                   /locus_tag="TM1040_0220"
FT   CDS_pept        235564..235827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK63"
FT                   /protein_id="ABF62953.1"
FT                   /translation="MFSYQYLTVLASQPVVTMHLRISASLSVNICWNHYVCVHEPAEQE
FT                   ASGELPEFRQLTNARLGVFVAPIAEQPGVFVILVLAPANRSF"
FT   gene            236023..237453
FT                   /gene="hik"
FT                   /locus_tag="TM1040_0221"
FT   CDS_pept        236023..237453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hik"
FT                   /locus_tag="TM1040_0221"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62954"
FT                   /db_xref="GOA:Q1GK62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK62"
FT                   /protein_id="ABF62954.1"
FT                   /translation="MSDPAYDAMTPEELRAALMQERRLRAELEESMERKSQSLRRANAS
FT                   LVSLARQIDRMVKERTEDLARDRAEAEAESAAKTQFLATMSHEIRTPLNGVLGMASALA
FT                   DTELAERQSQILGVLRESGQLLLNIVDDILDLSKIEEGKLELERLPTDVVALIETVYRQ
FT                   FKPRIEAKGLNFSSIYGEGLAQGPAWVHIDPTRFQQVLTNLLSNAIKFTDTGAIALSSS
FT                   LVLQHDGELILCVAVRDTGVGLTDAQVERLFQPYMQADASVARSHGGTGLGLAIARQIC
FT                   ERMGGTLTCRSHEGDGSEFCATFRAAPAEPVVSSHDPQDENELEALRAQRWKVLVAEDN
FT                   RTNRMVLHHILRGYDLDLYWVDNGEEAVKTWRQERPDLVLMDVNMPQLDGVSATSVIRQ
FT                   EEADAQAAPVPIIAVSANALVHQIKSYLASGMTDHVAKPIRKKKLLSAMARALKSRPTL
FT                   PPVPEEPADKGAARVLSP"
FT   gene            complement(237554..238408)
FT                   /locus_tag="TM1040_0222"
FT   CDS_pept        complement(237554..238408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0222"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62955"
FT                   /db_xref="GOA:Q1GK61"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK61"
FT                   /protein_id="ABF62955.1"
FT                   /translation="MKFRHIRQATEIEKGLHMTRPTTRIDAKFAELAAAGKKAFVTYVM
FT                   AGDPDYDTSLEVVKGLPAAGVDVIELGLPFTDPMADGETIQLAGQRALEAGMTLERTLQ
FT                   LARDFRKEDDTTPIVLMGYYNPIYSRGVETFLSDAKEAGIDGLIVVDLPPEEDSELCLP
FT                   AQAAGLNFIRLATPTTDDARLPRVLQNTSGFVYYVSITGITGAAEAEAADVGPEVARIK
FT                   AATDLPIIVGFGIKTPERAQTIASISDGAVVGSAIVAEIGAGKSPAEVLAFVKTLADGA
FT                   HAG"
FT   gene            complement(238456..238968)
FT                   /locus_tag="TM1040_0223"
FT   CDS_pept        complement(238456..238968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62956"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK60"
FT                   /protein_id="ABF62956.1"
FT                   /translation="MRKIIIAATLISTLLQSHALRAQELTFGLGHAEFNNEIAESGAYF
FT                   SAEYLGPRDWQVWGFDAGLGVAGHIHETGDVFFGGGLQAQRDIGRGWFIEASLMPGLYF
FT                   ENEARNDLGSNFEIRSLIGIGRDLRGGKRLSLALTHMSNASLARENPGLNTITLRLHMP
FT                   LGQRALN"
FT   gene            239155..240252
FT                   /locus_tag="TM1040_0224"
FT   CDS_pept        239155..240252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62957"
FT                   /db_xref="GOA:Q1GK59"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK59"
FT                   /protein_id="ABF62957.1"
FT                   /translation="MGFKMGIVGLPNVGKSTLFNALTKTASAQAANFPFCTIEPNVGEV
FT                   GVPDARLDKLAAIAQSKQIIPTRMTFVDIAGLVKGASKGEGLGNQFLANIREVDAIAHV
FT                   LRCFEDGDVTHVDGRVDPVADADTIETELMLADLESIEKRRANLVRKLKGNDKEAQQQD
FT                   RLLAAAQAMLEDGKPARLVEVDAEDQKAWTMLQLLTTKPVLYVCNVGESESVEGNAHSA
FT                   KVAEMAAAQGNAHVIISAQIEEEISQLEPEEAQMFLDEMGLAEAGLDRLIRAGYELLHL
FT                   ETYFTVGPKEARAWTIRSGTAAPQAAGVIHGDFEKGFIRAETIAYDDYIACGGESGAKE
FT                   AGKMRAEGKSYIVKDGDVMHFLFNT"
FT   gene            240406..241329
FT                   /locus_tag="TM1040_0225"
FT   CDS_pept        240406..241329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0225"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62958"
FT                   /db_xref="GOA:Q1GK58"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK58"
FT                   /protein_id="ABF62958.1"
FT                   /translation="MTTKLIIDTDPGIDDAMAIFYAAAAPDIELLGLTTIFGNVTTKMA
FT                   TRNALRLLEAAELDLPVAHGAEKPLVLPPFEPSAHVHGDEGFGDIPAVNPKGQAIAEDA
FT                   ADFLIRMAREHKGELVVCPVGPLTNIAIAIERDPEFVKNCKRIVIMGGSLEAGGNITPH
FT                   AEANIYHDPHAAEAVFAAAAGKVVMVGLDVTLKILCTPEDFDGIKERSPELGGMLKDMS
FT                   VFYIKFYQEVANLNGCSLHDPAAVIACTHPDLFKTRAVKLAVSVEEETSGKTQLAEDGR
FT                   GDTHVAMDVDAEAVKALFLKRLSLLP"
FT   gene            241515..241712
FT                   /locus_tag="TM1040_0226"
FT   CDS_pept        241515..241712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0226"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62959"
FT                   /db_xref="GOA:Q1GK57"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK57"
FT                   /protein_id="ABF62959.1"
FT                   /translation="MATINPVKFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALAAAF
FT                   FAVVDLLIRTGLNGVLGLFG"
FT   gene            241908..242441
FT                   /locus_tag="TM1040_0227"
FT   CDS_pept        241908..242441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0227"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62960"
FT                   /db_xref="GOA:Q1GK56"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK56"
FT                   /protein_id="ABF62960.1"
FT                   /translation="MAKRWYSVSVLSNFEKKIAEQIRTAVVEQGLEDEIDEVLVPTEEV
FT                   IEIRRGKKVSTERRFMPGYVLVHMEMSDQGYHLISSINRVTGFLGPQGRPMPMRDAEVQ
FT                   GILGRVEEGVEAPRTLISFEVGEKVKVNDGPFEDFDGMVEGVDDENQKLKVTVSIFGRE
FT                   TPVELDFTQVTKQV"
FT   gene            242545..243768
FT                   /locus_tag="TM1040_0228"
FT   CDS_pept        242545..243768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0228"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62961"
FT                   /db_xref="GOA:Q1GK55"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK55"
FT                   /protein_id="ABF62961.1"
FT                   /translation="MKLLVVSTNAALTMGGEAMKALQYMQQLLADGRDATLITHERCRE
FT                   ALAGQLPEDRVIYVHDSRAMKACWRTPGLGRLVNSFFHLEVARICRGFNPSEVVIHYLC
FT                   PISPVEQRFPPKGYRYVIGPLSGNIFYPEGFRHLAGRGLRLQHQAYRPLQMALGLLSRQ
FT                   FTRASTVLVSGYDRTREALGWAGCPEARMQDVWDAGLSPDFFARSRIRPGKNPAHFVWI
FT                   GRMVPYKGADLALRALALAPAEARLTLYGDGPDRAELEALARDLGLMSRVTFAGWLAHG
FT                   DLSEALGQYRALLFPSLKEANGIIVQECMAIGLPVVALRWGGPVGLADDTEALFVEAQN
FT                   AVQVEQDLAAAMARLTEDPALAEALSDAARRKAENEFPWPQVAQSWCSAALRAQDAAAA
FT                   EPKHRGGG"
FT   gene            243929..244354
FT                   /locus_tag="TM1040_0229"
FT   CDS_pept        243929..244354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0229"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62962"
FT                   /db_xref="GOA:Q1GK54"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK54"
FT                   /protein_id="ABF62962.1"
FT                   /translation="MAKKLVGSMKLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAK
FT                   TADMEPGAPCPTVITYYQDKSFTMDIKTPPASYYLKKAAKIKSGANNPSRETAGTVTAA
FT                   QVKEIAEAKMKDLNANDIEAAMQIILGSARSMGIEVK"
FT   gene            244356..245054
FT                   /locus_tag="TM1040_0230"
FT   CDS_pept        244356..245054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0230"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62963"
FT                   /db_xref="GOA:Q1GK53"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK53"
FT                   /protein_id="ABF62963.1"
FT                   /translation="MAKLGKRTRAAREAFAGKSNLTIEEAVALVKANATTKFDETVEIA
FT                   MNLGVDTRHADQMVRGVVGLPNGTGKTMRVAVFARGPKADEAKEAGADIVGAEDLMETI
FT                   QGGTIDFDRCIATPDMMPVVGRLGKVLGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQF
FT                   KAEKGGVVHAGVGKASFDEAKLVENVRAFVSAVAKAKPSGAKGAYMKKIVLSSTMGPGV
FT                   TLDVDGAVSE"
FT   gene            245198..246118
FT                   /locus_tag="TM1040_0231"
FT   CDS_pept        245198..246118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62964"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK52"
FT                   /protein_id="ABF62964.1"
FT                   /translation="MAQANRQLWRVGAIMNEPLAEVLKFCAWYLERGAHELVICFDNPD
FT                   DPAIARLAGHPRIRAIPCTAAFWGALDLTPDVAFVTRQNAALTWIYHQYPDGWLLNVDA
FT                   DEFLYLVGRDVADLLAEVPAEKKSLRVRTAERVLTEENPTCAHFRLPMARPVRRAVYGE
FT                   DAPLFGPRREGLVGHSHGKSFVRSGIRGLVLRQHWPRGLRDDGADELVLGHQDRAYLLH
FT                   MIGARYDIWRDKVTWRSASRGFTTGLTERIAAAQAAPAPEESLRDLHRRLHAATPARLS
FT                   ALRARDVLLTVPLELDALAEAHFGA"
FT   gene            246441..246959
FT                   /locus_tag="TM1040_0232"
FT   CDS_pept        246441..246959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0232"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62965"
FT                   /db_xref="GOA:Q1GK51"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK51"
FT                   /protein_id="ABF62965.1"
FT                   /translation="MDRAQKEKVVEELGQIFESSGVVVVAHYTGLTVSEMQDLRARARD
FT                   AGGSVRVAKNRLAKIALEGKPCESMSDLLTGMTVLTYSEDPVAAAKVAEDFAKENKKFE
FT                   ILGGAMGENALDRAGVEAVSKMPSREELIASIVGCIGAPASNIAGAIGAPASNIASILS
FT                   TIEEKAEAA"
FT   gene            247040..247417
FT                   /locus_tag="TM1040_0233"
FT   CDS_pept        247040..247417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0233"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62966"
FT                   /db_xref="GOA:Q1GK50"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK50"
FT                   /protein_id="ABF62966.1"
FT                   /translation="MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVMVAAG
FT                   GDAAGGAAEEEKTEFDVVLKNAGASKINVIKEVRGITGLGLKEAKELVEAGGKIKEGVD
FT                   KAEAEDIKGKLEAAGAEVELA"
FT   gene            247712..251851
FT                   /locus_tag="TM1040_0234"
FT   CDS_pept        247712..251851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0234"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62967"
FT                   /db_xref="GOA:Q1GK49"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK49"
FT                   /protein_id="ABF62967.1"
FT                   /translation="MAQTFLGQKRLRKYYGKIREVLDMPNLIEVQKSSYDLFLRSGDAP
FT                   QPLDGEGIKGVFQSVFPIKDFNETSVLEFVNYALERPKYDVDECMQRDMTYSAPLKVTL
FT                   RLIVFDVDEDTGAKSVKDIKEQDVFMGDMPLMTPNGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHSSGKLLFACRIIPYRGSWLDFEFDAKDIVFARIDRRRKLPVTTLLYALGLD
FT                   QEGIMDAYYNTVNFKLEKSRGWVTPFFPERVRGTRPTYDLVDAATGEIICEAGKKVTPR
FT                   AVKKMIDEGNITELLVPFEHIVGKYVAKDIINEENGAIYVEAGDELTLEYDKDGDIIGG
FT                   SVKELLDAGITDIPVLDIDNVNVGPYMRNTMAQDKNMSRETALMDIYRVMRPGEPPTVE
FT                   AASALFDTLFFDSERYDLSAVGRVKMNMRLALDAEDTQRTLRKEDIVACIKALVELRDG
FT                   KGDVDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVEIDTVMPQDLINAKP
FT                   AAAAVREFFGSSQLSQFMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYG
FT                   RMCPIETPEGPNIGLINSLATFARVNKYGFIETPYRVVKDGQVTDEVHYMSATEEMRHT
FT                   VAQANANLDEDNRFVNDLVSTRQSGDYTLAPNESVDLIDVSPKQLVSVAASLIPFLEND
FT                   DANRALMGSNMQRQAVPLLRAEAPLVGTGIEEIVARDSGAAIMAKRAGVIDQIDAQRIV
FT                   IRATSDLELGDAGVDIYRMRKFQRSNQNTCINQRPLVKVGQTVEKGEVIADGPSTDMGE
FT                   LALGKNVVVAFMPWNGYNYEDSILISERIARDDVFTSIHIEEFEVAARDTKLGPEEITR
FT                   DIPNVGEEALRNLDEAGIVYIGADVEPGDILVGKITPKGESPMTPEEKLLRAIFGEKAS
FT                   DVRDTSLRVKPGDYGTVVEVRVFNRHGVEKDERALQIEREEVERLARDRDDELGILDRN
FT                   IYARLRDLLLGKTAVKGPKGVRGNTVIDEDLLDNQLTRGQWWMLALEEEQDAQILEALN
FT                   EQYEAQKRALDARFEDKVEKVRRGDDLPPGVMKMVKVFIAVKRKLQPGDKMAGRHGNKG
FT                   VISRVVPMEDMPFLADGTPVDFCLNPLGVPSRMNVGQILETHMGWAARGLGLKIDDALQ
FT                   DYRRTGDLTPVRDAMREAYGEDVYEEGISSMDETQLIEAAGNVTRGVPIATPVFDGAKE
FT                   DDVNDALVRAGFDQSGQSILFDGRTGEQFARPVTVGIKYLLKLHHLVDDKIHARSTGPY
FT                   SLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYESIVK
FT                   GEDNFEAGVPESFNVLVKEVRGLGLNMELLDAEVEE"
FT   gene            251905..256137
FT                   /locus_tag="TM1040_0235"
FT   CDS_pept        251905..256137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0235"
FT                   /product="DNA-directed RNA polymerase subunit beta-prime"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62968"
FT                   /db_xref="GOA:Q1GK48"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK48"
FT                   /protein_id="ABF62968.1"
FT                   /translation="MNQEITNNPFNPLTPPKVFDEIKVSLASPERILSWSYGEIKKPET
FT                   INYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYRGVVCEKCGVEVTLQKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRIGLMLDMTLRDLERVLYFENYVVIEPGLTDLQYGQMMT
FT                   EEEYMDAQDAYGMDAFTANIGAEAIREMLAAIDLEAEAEHLRAELAEATGELKPKKIIK
FT                   RLKVVESFLESGNRPEWMIMTVIPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLIELRAPDIIVRNEKRMLQESVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGR
FT                   FRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYSRLEAKGLSSTVKQ
FT                   AKKLVEKERPEVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPTLIEGKAIQLHPLVCS
FT                   AFNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNVLSPANGAPIIVPSQDMILGLYYLT
FT                   LEREGMKGEGKIFGNLDEVQHALDAGEVHLHSKVTVRVPQIDEEGNEVFQRFETTPGRA
FT                   RLGSLLPKNAKAPFELVNRLLRKREVQQVIDTVYRYCGQKESVIFCDQIMTMGFREAFK
FT                   AGISFGKDDMVIPDNKWTIVDDTRDQVKDFEQQYMDGLITQGEKYNKVVDAWSKCNDKL
FT                   TEAMMSTISAVKKAEDGSDMEPNSVYMMAHSGARGSVTQMRQLGGMRGLMAKPNGDIIE
FT                   TPVISNFKEGLTVLEYFNSTHGARKGLSDTALKTANSGYLTRRLVDVAQDCIVREHDCG
FT                   TERAITAETAVNDGEVVASLGERILGRVAADDVKRPGTEEVLLAAGQLIDERMADTIEE
FT                   AGVQSMRIRSPLTCESEEGVCAMCYGRDLARGTMVNSGEAVGIIAAQSIGEPGTQLTMR
FT                   TFHIGGVAQGGQQSFLEASQEGKIVFENTNTLTNANGEVLTIGRNMKLIIQDEHGEERS
FT                   SHKLGYGTKLFVKEGQEVKRGDKLFEWDPYTLPIIAEKPGTAKYVDLVSGLAVREETDD
FT                   ATGMTQKIVIDWRAAPKGSDLKPEIILVGDDGEPVRNSLGNPLTYPMSVDAILSCEDGQ
FT                   KIEAGDVVARIPREGAKTKDITGGLPRVAELFEARRPKDHAIIAEIDGYVRFGRDYKNK
FT                   RRISIEPADESMEAVEYMVPKGKHIPVVEGDFVQKGDYIMDGNPAPHDILSIMGVEALA
FT                   NYMIDEVQDVYRLQGVKINDKHIEVIVRQMLQKWEISDSGETTLLKGEHVDKQEFDAAN
FT                   EKALARGKRPAQGEPILLGITKASLQTRSFISAASFQETTRVLTEASVQGKKDKLVGLK
FT                   ENVIVGRLIPAGTGGATQQVRHIAASRDNVVLEARREEAEAAAALAAPMADDAADADFL
FT                   VETPESRD"
FT   gene            256298..257110
FT                   /locus_tag="TM1040_0236"
FT   CDS_pept        256298..257110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62969"
FT                   /db_xref="InterPro:IPR021466"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK47"
FT                   /protein_id="ABF62969.1"
FT                   /translation="MAATFKMVGVIRFSLLTPTFNADRYPDLEAAAAAIFAPDRMALRL
FT                   HLFETLCLPSLVRQSDAAFHLVVATSDRLPAVILQHLQALLAPHDHMQLIQFAPENHYQ
FT                   ILKEAYRAVPQQGESHRILFRLDDDDALDRHYVARCKRLAAGLVPLQTEAVSPIALAFN
FT                   RGYYLIREEGQPPVVMDSCERAPLSAGTALVQPIAARGNPYRYNHRKFAQHYTLYSDIS
FT                   VPSFVRTVHGDNHSTPAMMGLTARQSDAEMDADLQRHFDLSLSDLKAI"
FT   gene            257154..257993
FT                   /locus_tag="TM1040_0237"
FT   CDS_pept        257154..257993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0237"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62970"
FT                   /db_xref="GOA:Q1GK46"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK46"
FT                   /protein_id="ABF62970.1"
FT                   /translation="MLGSMAFFTFNDTLVKLVGETVPLWQIVTVRGVLASLLLLGLARA
FT                   MGALRFDFSRRDWGLVLARCATEMGATYFFLSALLQLPLANVTAVLQMLPLTVTLCAAL
FT                   FLGEAVGWKRSLAIAVGFVGMLLIVRPGGADFGPATAYAVLAVGVLTLRDLVTRQMSAA
FT                   VPSLTVTFLSAFAVMLFGLGLGIGESWQPMGLREWGLLAGTSVLILLAYLFAVMTIRVG
FT                   EVSAVAPLRYTGLVWALLLGWAVFGEFPSGLTLLGAVIVVLAGLFTLLRERQVAENT"
FT   gene            complement(257972..258856)
FT                   /locus_tag="TM1040_0238"
FT   CDS_pept        complement(257972..258856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62971"
FT                   /db_xref="InterPro:IPR021466"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK45"
FT                   /protein_id="ABF62971.1"
FT                   /translation="MPRQQALPRWDRPAIVAQDYLRGDFEMQVIGLCRFSYPAIGGFQI
FT                   EHQSHAERIAFLYDDARLQERFRLFETVALPSLRAQTDQDFDLVIVIGSCLPARHEARL
FT                   RDLISGMPQARIEQHPPRRQREIMKDVLNRARRDPTAPCLQFRFDDDDAVSVDFVERLR
FT                   STIADCPGLVARHKSVAVDFNMGYVAEFGAEGIKAAEVHSPYNVAALGMYVRGGARVTI
FT                   MNFAHHKILRFMPTVTLSDAPMFVRGWHGSNDSRQKPVKSLDLAPLTPAQIAEFVARFA
FT                   IREDKVRQVFSAT"
FT   gene            259113..259484
FT                   /locus_tag="TM1040_0239"
FT   CDS_pept        259113..259484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0239"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62972"
FT                   /db_xref="GOA:Q1GK44"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK44"
FT                   /protein_id="ABF62972.1"
FT                   /translation="MPTIQQLIRKPRQPKVKRSKSMHLEQCPQKRGVCTRVYTTTPKKP
FT                   NSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
FT                   QGVKDRKQRRSKYGAKRPK"
FT   gene            259503..259973
FT                   /locus_tag="TM1040_0240"
FT   CDS_pept        259503..259973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0240"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62973"
FT                   /db_xref="GOA:Q1GK43"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK43"
FT                   /protein_id="ABF62973.1"
FT                   /translation="MSRRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSVAERIVYN
FT                   AFDRVESKIKRAPVEVFHEALDNVKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWL
FT                   ITAARGRNENTMEERLAGELLDAVQSRGTAVKKREDTHKMAEANKAFSHYRW"
FT   gene            259995..262115
FT                   /locus_tag="TM1040_0241"
FT   CDS_pept        259995..262115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0241"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62974"
FT                   /db_xref="GOA:Q1GK42"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK42"
FT                   /protein_id="ABF62974.1"
FT                   /translation="MAREYPLELYRNFGIMAHIDAGKTTCSERILFYTGKSHNIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWERTEDGETADTPKHRLNIIDTPGHVDFTIEVE
FT                   RSLAVLDGAVCVLDANAGVEPQTETVWRQADRYKVPRMVFVNKMDKIGADFFNCVRMIE
FT                   DRTGARAVPVGIPIGAENELEGLIDLVTMKEWLWQGEDLGASWVQVDIRDSLKEMAEEW
FT                   RGKMIEAAVEMDDDAMENYLMDGAEPDVATLRSLLRKGTLSLSFVPVLGGSAFKNKGVQ
FT                   PLLNAVIDYLPSPLDVVDYMGFKPGDEEEVRNIARRADDDMAFSGLAFKIMNDPFVGSL
FT                   TFTRIYSGVLNKGDSILNSTKGKKERIGRMMMMHSNNREEIEEAFAGDIIALAGLKDTT
FT                   TGDTLCDAKEPVVLETMTFPDPVIEIAVEPKTKGDQEKMSQGLARLAAEDPSFRVETDL
FT                   ESGQTIMKGMGELHLDILVDRLKREFKVEANIGAPQVAYRETIGHEVEHTYTHKKQSGG
FT                   SGQFAEVKMIISPTEAGEGYSFESRIVGGSVPKEYIPGVEKGINSVMDSGPLAGFPVID
FT                   FKVALIDGKFHDVDSSVLAFEIAARMCMREGMRKAGAKLLEPIMKVEVITPEEYTGGII
FT                   GDLTSRRGQVSGQEPRGNAIAIDANVPLANMFGYINTLRSMSSGRAQFTMQFSHYDPVP
FT                   QNISEEIQAKYA"
FT   gene            262178..263353
FT                   /locus_tag="TM1040_0242"
FT   CDS_pept        262178..263353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0242"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62975"
FT                   /db_xref="GOA:Q1GDV0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GDV0"
FT                   /protein_id="ABF62975.1"
FT                   /translation="MAKEKFERNKPHVNIGTVGHVDHGKTTLTAAITKYFGDFKAYDQI
FT                   DGAPEEKARGITISTAHVEYETEGRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLARQVGVPALVVFMNKVDQVDDEELLELVEMEIRELLSSYDFPGDDI
FT                   PIIAGSALAAMEGRDPEIGENKIKELMAAVDEYIPTPERAVDQPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVINVGDNIEIVGIKDTTTTTCTGVEMFRKLLDRGEAGDNIGALLRGIDR
FT                   EAVERGQVLCKPGSVTPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVT
FT                   LPEGTEMVMPGDNLKFEVELIAPIAMEDGLRFAIREGGRTVGAGVVSKILA"
FT   gene            263547..264038
FT                   /locus_tag="TM1040_0243"
FT   CDS_pept        263547..264038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62976"
FT                   /db_xref="InterPro:IPR021869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK40"
FT                   /protein_id="ABF62976.1"
FT                   /translation="MVEFLFIVFLIGLLALLLRRDRRRRAIKIAVIDGSNLLYWKGEAL
FT                   SLQPVHDAIEALVAAGYRPCVIFDANAGYLVAGQYLDGARFAKLLGLRAAQAYVVPKGE
FT                   PADPHILQLARKSGGIVISRDRFRDWADKFAPETASDRVVRGGYRRDKLWLDLPKDKVA
FT                   "
FT   gene            264476..264727
FT                   /locus_tag="TM1040_0244"
FT   CDS_pept        264476..264727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK39"
FT                   /protein_id="ABF62977.1"
FT                   /translation="MRAVLMFGASIIVLAACSSGTSEGQVSVSYDNGAFSGKAGSNWSD
FT                   EELRSNSFGVLCGEDGKVADLAISRDSKGVATISGKCV"
FT   gene            264947..265261
FT                   /locus_tag="TM1040_0245"
FT   CDS_pept        264947..265261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0245"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62978"
FT                   /db_xref="GOA:Q1GK38"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK38"
FT                   /protein_id="ABF62978.1"
FT                   /translation="MQSQNIRIRLKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNK
FT                   IEKFTVLRGPHVDKKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKLQS
FT                   "
FT   gene            265280..265999
FT                   /locus_tag="TM1040_0246"
FT   CDS_pept        265280..265999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0246"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62979"
FT                   /db_xref="GOA:Q1GK37"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK37"
FT                   /protein_id="ABF62979.1"
FT                   /translation="MRSGIIAKKVGMTRLFMEDGKQIPVTVLSLDGLQVVAQRTEDKDG
FT                   YTAVQLGAGSAKVKRVSKAMRGHFAASKVEPKRKLVEFRVPADGLIEVGAEISAEHFLE
FT                   GQKVDVTGTSIGKGFAGAMKRWNFGGLRASHGVSISHRSHGSTGQCQDPGKVFKGKKMA
FT                   GHMGAARVTTQNLEVVKTDADRGLVFIKGAVPGPKSGWVTVKDAVKKKAPEGLPFPAAL
FT                   KTAAEAAAEAPAEGGEA"
FT   gene            265996..266613
FT                   /locus_tag="TM1040_0247"
FT   CDS_pept        265996..266613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0247"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62980"
FT                   /db_xref="GOA:Q1GK36"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK36"
FT                   /protein_id="ABF62980.1"
FT                   /translation="MKLDVIKLDGGKAGDIELSEDLFGLEPRADILHRVVRWQRNNAQA
FT                   GTHKVKTRSETSYSTKKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHDLTKKF
FT                   RKLGLRHALSAKAKAGELVVIENAEAEGKTAALAKQVANLGWKRALVIDGAAVNEGFAR
FT                   AAKNIEGLDILPSMGANVYDILKRDTLVLTKSAVEALEARLK"
FT   gene            266610..266906
FT                   /locus_tag="TM1040_0248"
FT   CDS_pept        266610..266906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0248"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62981"
FT                   /db_xref="GOA:Q1GK35"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK35"
FT                   /protein_id="ABF62981.1"
FT                   /translation="MSAKAEHYDVIRKPIITEKSTMASENGAVVFEVAIDSNKPQIKEA
FT                   VEALFGVKVKAVNTTVTKGKVKRFRGQLGKRKDVKKAYVTLEEGNTIDVSTGL"
FT   gene            267190..267591
FT                   /locus_tag="TM1040_0249"
FT   CDS_pept        267190..267591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK34"
FT                   /protein_id="ABF62982.1"
FT                   /translation="MTGIGTFILVNSKADPFKIGRRPLVRLFWNTFGTAFLAHIGFLSA
FT                   FTTPAMVSTWVSSQWEEAEYQVLNPHGSSSRLCGKRMDLGDRSSFQYELCGVPDVLRDS
FT                   LEIGSRVVISGRKNWFGMVPDTIRRAEER"
FT   gene            267658..268230
FT                   /locus_tag="TM1040_0250"
FT   CDS_pept        267658..268230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62983"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK33"
FT                   /protein_id="ABF62983.1"
FT                   /translation="MFIQPDWFDPTQPGVGTNRYSYSNNDPVNLLDPSGNQAVSAFTQS
FT                   QEERDSAYRDTADMYDRRADELVADGAPDDDLEVLEYRQKAKDQRSRIGVSGTQLVVED
FT                   VASVAVPYAAGKAAGLLSRLFGGAAKSSTSATAPELSTEIASTFRSSKYSTVVVEEPTT
FT                   LYRVYGGSARMIGGFWTRTKPQGPLQS"
FT   gene            268431..268688
FT                   /locus_tag="TM1040_0251"
FT   CDS_pept        268431..268688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62984"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK32"
FT                   /protein_id="ABF62984.1"
FT                   /translation="MSEINEILDSAGETYWQSKVEEAFARSGDRQRDLIASWFGGMGSF
FT                   SDLMLMKINGHTVEEDQEPQLNERLRMLRSELYSLIRARN"
FT   gene            268935..269777
FT                   /locus_tag="TM1040_0252"
FT   CDS_pept        268935..269777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0252"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62985"
FT                   /db_xref="GOA:Q1GK31"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK31"
FT                   /protein_id="ABF62985.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKSLTEGLTKSGGRNN
FT                   TGRITSRRRGGGAKRLYRIVDFKRNKFDVAATVERIEYDPNRTAFIALVKYEDGEQAYI
FT                   LAPQRLAVGDKVIASAKADIKPGNAMPFSGMPIGTIVHNIEMKPGKGGQIARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRLVRQECMATVGAVSNPDNSNQNYGKAGRMRHKGKRPSVRG
FT                   VVMNPIDHPHGGGEGRTSGGRHPVTPWGKPTKGKRTRNTNKASQKLIIRSRHAKKKGR"
FT   gene            269781..270059
FT                   /locus_tag="TM1040_0253"
FT   CDS_pept        269781..270059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0253"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62986"
FT                   /db_xref="GOA:Q1GK30"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK30"
FT                   /protein_id="ABF62986.1"
FT                   /translation="MTRSVWKGPFVDAYVLKKAEAARDSGRNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGQKHIPVNVTEDMIGQKFGEYSPTRTYYGHAADKKAKRK"
FT   gene            270063..270443
FT                   /locus_tag="TM1040_0254"
FT   CDS_pept        270063..270443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0254"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62987"
FT                   /db_xref="GOA:Q1GK29"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK29"
FT                   /protein_id="ABF62987.1"
FT                   /translation="MGKDKNPRRVADNEAMAKVRMLRTSPQKLNLVAQMIRGKKVDKAL
FT                   TDLTFSNKRIAQDVKKCLQSAIANAENNHNLDVDELIVAEAWVGKNLTMKRGRPRARGR
FT                   FGKILKPFAEITIKVRQVEEQA"
FT   gene            270443..271162
FT                   /locus_tag="TM1040_0255"
FT   CDS_pept        270443..271162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0255"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62988"
FT                   /db_xref="GOA:Q1GK28"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK28"
FT                   /protein_id="ABF62988.1"
FT                   /translation="MGHKVNPVGMRLQINRTWDSRWYADTKDYGDLLLEDIKIREFIKE
FT                   ECKQAGVARVIIERPHKKCRVTIHTARPGVIIGKKGADIEVLRKKIASMTDSELHLNIV
FT                   EVRKPELDAQLVGESIAQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYAHSEASTPYGIIGIKVWIFKGEIMEHDPQARDRKAQEL
FT                   QDGPAPRGAGGNRRGDR"
FT   gene            271175..271588
FT                   /locus_tag="TM1040_0256"
FT   CDS_pept        271175..271588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0256"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62989"
FT                   /db_xref="GOA:Q1GK27"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK27"
FT                   /protein_id="ABF62989.1"
FT                   /translation="MLQPKRTKFRKMHKGRIKGLAKGGSDLNFGTYGLKAVTPERVTAR
FT                   QIEAARRAMTRHMKRQGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDFWACKVKPGRVMF
FT                   EIDGVNEDIAREALRLAAMKLPVQTRIVVREDW"
FT   gene            271848..272147
FT                   /locus_tag="TM1040_0257"
FT   CDS_pept        271848..272147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK26"
FT                   /protein_id="ABF62990.1"
FT                   /translation="MTSKKCIRLCVTGLCLAALMSCSDTSIRLESADPAAVTRISQAPY
FT                   RYQHVTYWTLANGCTYSRGFSGRGGWRWFLVGNPMSPEQGVVHEGCTFVFDASD"
FT   gene            272252..272962
FT                   /locus_tag="TM1040_0258"
FT   CDS_pept        272252..272962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0258"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62991"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK25"
FT                   /protein_id="ABF62991.1"
FT                   /translation="MKFVTSVATVFALGFAGAVQAADVTLLTEDYAPLNFERDGQIVGL
FT                   GADQVFEIMSRAGIAYEAELTQWSRAIGQAERRPNTCVFSTTHTEERDPKFQWVEPLAS
FT                   DSTILVRKAGSDIAPATIEDARSYRTGTQTGDYTVGVLEEAGFESIDLAPTQSATVKKL
FT                   LQGRIDLMITSGSFLEAALADGIEIEEALVVSTTTMSLACSLKTDEALIARMQDALQSM
FT                   IDDGTQAEIIARYE"
FT   gene            273110..273730
FT                   /locus_tag="TM1040_0259"
FT   CDS_pept        273110..273730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62992"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK24"
FT                   /protein_id="ABF62992.1"
FT                   /translation="MAQIDSLFVTRLYRAALSEHGPKIDPQEMEASCIAIAEDDEAGQD
FT                   WCEENGYPGYTSYASLTDLPWRFPIFADLVKSLDAHVAAFAQDLELNLDGRDLKLEDLW
FT                   INILPEGGTHASHIHPHSVISGTTYVSMPDGASALKLEDPRHAMMMAHPPRTKDCRREL
FT                   RSFVYEAPNVGDVLLWESFIRHEVPMNMAEDERISVSFNYAWA"
FT   gene            273804..274844
FT                   /locus_tag="TM1040_0260"
FT   CDS_pept        273804..274844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0260"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62993"
FT                   /db_xref="GOA:Q1GK23"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK23"
FT                   /protein_id="ABF62993.1"
FT                   /translation="MARRSPFEIGGFHIPPGTRRTVDLPVSVLSDHTPVNMSAHVIHGS
FT                   EDGPTLFVSAAIHGDEVIGVEIARRLLRSRQFARLRGTLIVVPIVNTFGFLNHSRYLPD
FT                   RRDLNRCFPGSEGGSLASRLAHLFMTEIVARSDLGIDLHSAAIHRTNLPQIRVSPKAQD
FT                   TLAYADAFGAPVVIRSGLRDGSLRKEAQKAGVDILLYEAGEGLRFDEQSARVGVAGILR
FT                   VMHALDMIPEDGVPLAEGVPVRAADSAWERAPAGGLLRAYKTTGEMVEAGDVLGIVADP
FT                   FGEEEMELTASQTGLIIGRANMPIVNEGDALFHIASVNSATAEQQIETLNAQLDGAAMF
FT                   DEDEII"
FT   gene            complement(274857..275486)
FT                   /locus_tag="TM1040_0261"
FT   CDS_pept        complement(274857..275486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK22"
FT                   /protein_id="ABF62994.1"
FT                   /translation="MTKAIGMEASETREPRIERPKLTFAPEVCDWVEGHYKDADVILEY
FT                   GSGGSTVLGAEMPGKTLYSVESSRDWHKMMQRYFDENDVPSLPHLHYVNIGKTGKWGLP
FT                   VNTEQHHRYHKYPLSIWDIDGFQHPDLILIDGRFRVACALAAMLRCTRKVTILFDDYRD
FT                   RKRYRVLEEFLELKEMRGYMARFEVEPTALPREKMTRIIGLFARAL"
FT   gene            275778..275978
FT                   /locus_tag="TM1040_0262"
FT   CDS_pept        275778..275978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0262"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62995"
FT                   /db_xref="GOA:Q1GK21"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK21"
FT                   /protein_id="ABF62995.1"
FT                   /translation="MNAKDLRDKTVDELRDELANLKKESFNLRFQQATGQLENTAGIKA
FT                   ARRNAARVKTILNEKAAAAAE"
FT   gene            275991..276221
FT                   /locus_tag="TM1040_0263"
FT   CDS_pept        275991..276221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0263"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62996"
FT                   /db_xref="GOA:Q1GK20"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK20"
FT                   /protein_id="ABF62996.1"
FT                   /translation="MPKRILQGVVTSDANAQTVTVSVERRFTHPVLKKTIRKSKKYRAH
FT                   DEKNAFKVGDTVRIIECAPKSKTKRWEVLEA"
FT   gene            276322..276690
FT                   /locus_tag="TM1040_0264"
FT   CDS_pept        276322..276690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0264"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62997"
FT                   /db_xref="GOA:Q1GK19"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK19"
FT                   /protein_id="ABF62997.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTAIRFDRNAAVILNNNNEPVGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
FT   gene            276690..276995
FT                   /locus_tag="TM1040_0265"
FT   CDS_pept        276690..276995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0265"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62998"
FT                   /db_xref="GOA:Q1GK18"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK18"
FT                   /protein_id="ABF62998.1"
FT                   /translation="MAAKLRKGDKVVVLAGRDKGKEGTIASVDPKAGKAVVDGVNMAIR
FT                   HTRQTQTSQGGRLPKALPIDLSNLALLDSNGKATRVGFREEDGKKVRFAKTTGETV"
FT   gene            276995..277558
FT                   /locus_tag="TM1040_0266"
FT   CDS_pept        276995..277558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0266"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF62999"
FT                   /db_xref="GOA:Q1GK17"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK17"
FT                   /protein_id="ABF62999.1"
FT                   /translation="MLDDATYTPRLKTLYKDTIRGALKEEFGYKNEMQIPKLDKIVLNI
FT                   GCGRAAVKDSKKAKSAQEDLTKIAGQKALTTVAKNSIAGFRVREGMPMGAKVTLRGERM
FT                   YEFLDRLITIAMPRIRDFRGVSGTSFDGRGNYALGLKEHIVFPEIDFDKIDEAWGMDIV
FT                   IATTANTDAEAKALLKAFNMPFNS"
FT   gene            277577..277882
FT                   /locus_tag="TM1040_0267"
FT   CDS_pept        277577..277882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0267"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63000"
FT                   /db_xref="GOA:Q1GK16"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK16"
FT                   /protein_id="ABF63000.1"
FT                   /translation="MAKKAMIEREKKRERLVAKYAAKRAELKEIANDESRPMEERFKAR
FT                   LKLAKLPRNSSATRLHNRCQLTGRPHAYYRKLKVSRIALRELGSNGQIPGMVKSSW"
FT   gene            277895..278287
FT                   /locus_tag="TM1040_0268"
FT   CDS_pept        277895..278287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0268"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63001"
FT                   /db_xref="GOA:Q1GK15"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK15"
FT                   /protein_id="ABF63001.1"
FT                   /translation="MNDPIGDMLTRIRNSQMRGKSTVMTPASKLRAWVLDVLQSEGYIR
FT                   GYESATDERGHPALEISLKYYEGEPVIRELKRVSKPGRRVYMGVNDIPSVRQGLGVSIV
FT                   STPKGVMSDANARAANVGGEVLCTVF"
FT   gene            278303..278836
FT                   /locus_tag="TM1040_0269"
FT   CDS_pept        278303..278836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0269"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63002"
FT                   /db_xref="GOA:Q1GK14"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK14"
FT                   /protein_id="ABF63002.1"
FT                   /translation="MSRIGKKPVELPSGVSASLSGQTIEVKGPKGAQTFTATDDVTLTV
FT                   EDNVVKVEPRGKSKRARQQWGMSRTMVANMVQGVTQGFKKELEIQGVGYRAQMQGNTLK
FT                   LNLGYSHDVDFTAPEGVTITAPKQTEIVVEGADAQAVGEVAAKIRDWRRPEPYKGKGIR
FT                   YKGEFIFRKEGKKK"
FT   gene            278848..279207
FT                   /locus_tag="TM1040_0270"
FT   CDS_pept        278848..279207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0270"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63003"
FT                   /db_xref="GOA:Q1GK13"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK13"
FT                   /protein_id="ABF63003.1"
FT                   /translation="MANSKRTLFLKRRLRVRNKLRKVNAGRLRLSVHRSNKNISVQLID
FT                   DVKGVTLAAASTLEKDLGFVGKNNIEAATKVGSVIAERAKAAGVTEAYFDRGGFLYHGK
FT                   VKALADAAREGGLKI"
FT   gene            279375..279938
FT                   /locus_tag="TM1040_0271"
FT   CDS_pept        279375..279938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0271"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63004"
FT                   /db_xref="GOA:Q1GK12"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK12"
FT                   /protein_id="ABF63004.1"
FT                   /translation="MAERENRRGNRRDREETPEFADRLVAINRVSKTVKGGKRFGFAAL
FT                   VVVGDQKGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVPLKEGRTLHHDMYGRHGAGKV
FT                   VMRTAPEGTGIIAGGPMRAVFEMLGIKDVVSKSVGSQNPYNMIRATIDGLKKEQSPRSV
FT                   AQRRGKKVADILPKRDEAPAEAEA"
FT   gene            279951..280139
FT                   /locus_tag="TM1040_0272"
FT   CDS_pept        279951..280139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0272"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63005"
FT                   /db_xref="GOA:Q1GK11"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK11"
FT                   /protein_id="ABF63005.1"
FT                   /translation="MAKTIVVKQIGSPIRRPAEQRATLIGLGLNKMHKTRELEDTPSVR
FT                   GMVNKIPHLVEIVEERD"
FT   gene            280364..280579
FT                   /locus_tag="TM1040_0273"
FT   CDS_pept        280364..280579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0273"
FT                   /product="protein of unknown function DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63006"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK10"
FT                   /protein_id="ABF63006.1"
FT                   /translation="MAHVLNTNIASSSFVARLRDAIEQTRSSWALYKEYKNTYNELASL
FT                   TDRDLADIGVRRCDIADLARSHVYGA"
FT   gene            281136..281606
FT                   /locus_tag="TM1040_0274"
FT   CDS_pept        281136..281606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0274"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63007"
FT                   /db_xref="GOA:Q1GK09"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK09"
FT                   /protein_id="ABF63007.1"
FT                   /translation="MKLNELRDNPGASPKRTRVGRGPGSGKGKMGGRGIKGQKSRSGVA
FT                   INGYEGGQMPLYQRLPKRGFNKPNAKKYAVVNLGLIQKFIDAGKLDAASITEDSLVASG
FT                   LVRRKLDGIRVLAKGEFTAKATIAVTGASKSAVEAVSKAGGALTVASEAAAE"
FT   gene            281717..283081
FT                   /locus_tag="TM1040_0275"
FT   CDS_pept        281717..283081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0275"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63008"
FT                   /db_xref="GOA:Q1GK08"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK08"
FT                   /protein_id="ABF63008.1"
FT                   /translation="MVSAAEQMAANTSWAALGKATDLRNRILFTIGLLIVYRLGTWIPV
FT                   PGIDADALRQFMDTAGQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVP
FT                   ALEQLKKEGEQGRKKINQYTRYGTVLLATAQAYGLAASLEAGDMAFDPGLYFRLSCMIT
FT                   LVGGTMFLMWLGEQITNRGIGNGISLIIFVGIIAEIPAAIVQFFASGRSGAISPAVIIA
FT                   VIVMVVAVIMFVVFMERALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFAS
FT                   SLLLLPTTISTFSQGSASSPVMSWLLANFGPGQPLYLLFFTAMIVFFAYFYTFNVSFKP
FT                   DDVAQNLKNQNGFVPGIRPGKKTAEYIEYVVNRVLVLGSAYLALVCLLPEILRNNFAIP
FT                   VYFGGTSVLIVVSVTMDTIQQVQSHLLAHQYEGLIEKSQLRGRNKKRTKRGPSRR"
FT   gene            283078..283659
FT                   /locus_tag="TM1040_0276"
FT   CDS_pept        283078..283659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0276"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63009"
FT                   /db_xref="GOA:Q1GK07"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK07"
FT                   /protein_id="ABF63009.1"
FT                   /translation="MTNIILLGPPGAGKGTQASHLVKTRNMTQLSTGDMLRAAQSSGSE
FT                   MGKKVAAIMAEGKLVTDQIVIGLIRERLQEGSEGGFIFDGFPRTLAQADALEKLLTEMG
FT                   LKLDAVIEMQVDDEVLVKRIVNRAEEARAAGKEARADDNEDSVRIRLMEYYKKTSPLIG
FT                   YYWAKGNLQRLDGMASIDEVQKSIAWILGD"
FT   gene            284068..284436
FT                   /locus_tag="TM1040_0277"
FT   CDS_pept        284068..284436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0277"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63010"
FT                   /db_xref="GOA:Q1GK06"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK06"
FT                   /protein_id="ABF63010.1"
FT                   /translation="MARIAGVNIPTAKRVPIALTYITGIGPASAKAICEAVNIDATRRV
FT                   NELSDAEVLAIREHIDATYTVEGDLRREVQMNIKRLMDLGCYRGLRHRRNLPVRGQRTH
FT                   TNARTRKGPAKAIAGKKK"
FT   gene            284453..284842
FT                   /locus_tag="TM1040_0278"
FT   CDS_pept        284453..284842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0278"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63011"
FT                   /db_xref="GOA:Q1GK05"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK05"
FT                   /protein_id="ABF63011.1"
FT                   /translation="MARDKTRTKRKERKNIASGVAHVNSSFNNTKILISDVQGNAISWS
FT                   SAGTMGFKGSRKSTPYAAQMAAEDAGRKAQDHGVKTLEVEVQGPGSGRESALRALAAIG
FT                   FNITNIRDVTPIAHNGCRPPKRRRV"
FT   gene            284956..285972
FT                   /locus_tag="TM1040_0279"
FT   CDS_pept        284956..285972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0279"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63012"
FT                   /db_xref="GOA:Q1GK04"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK04"
FT                   /protein_id="ABF63012.1"
FT                   /translation="MIHKNWAELIKPTQLEVKPGNDPARQATLVAEPLERGFGLTLGNA
FT                   LRRILMSSLQGAAITSVQIDNVLHEFSSVAGVREDVTDIILNLKQVSLRMEVEGPKRLS
FT                   INAKGPAVVTAGDIAETAGIEVLNREHVICHLDDGADLFMELTVNTGKGYVSAEKNKPE
FT                   DAPIGLIPIDAIYSPVKKVSYDVQPTREGQVLDYDKLTLKVDTDGSITPEDALAFAARI
FT                   LQDQLSIFVNFDEPESAGRQDEDDGLEFNPLLLKKVDELELSVRSANCLKNDNIVYIGD
FT                   LIQKTEAEMLRTPNFGRKSLNEIKEVLSGMGLHLGMDVEDWPPDNIEELAKKFEDSF"
FT   gene            286119..286544
FT                   /locus_tag="TM1040_0280"
FT   CDS_pept        286119..286544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0280"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63013"
FT                   /db_xref="GOA:Q1GK03"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GK03"
FT                   /protein_id="ABF63013.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFSNMAGSLIEHEQIKTTLPKAKELR
FT                   PIIEKMITLAKRGDLHARRQAASKLKEDKDVAKLFDVLGPRYKDRQGGYVRILKAGFRY
FT                   GDMAPMAIIEFVDRDVSAKGAADKARLAEIEAVEDEE"
FT   gene            286665..287573
FT                   /locus_tag="TM1040_0281"
FT   CDS_pept        286665..287573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63014"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK02"
FT                   /protein_id="ABF63014.1"
FT                   /translation="MFNQIITKAAFILGLSLAGALPAGSETVAGQEDAAYLSAREDWLA
FT                   GNDIKALKALGVLARQGNTAAQILLSRIAASKLTHQHVTADLPRRERIALLRKEQGLSG
FT                   KDWLTEARSSSELVEALWTLNRTPDAMDAGQAVEILWDHGEAKAAINMMLEAWSRGEED
FT                   SVLKRIEASSHDLGPDGAQMLAFLKGDIDQWRVDELRGRLALEGLLEPLTSLSDASRLA
FT                   KVEEIPSLEPLSKYCAATCPESVALCLRSGLRAATVAGRFPQPFASPSQSLIPDEEYWD
FT                   SARFQGDFSALMKAGGGLTCE"
FT   gene            complement(287589..287927)
FT                   /locus_tag="TM1040_0282"
FT   CDS_pept        complement(287589..287927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0282"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63015"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK01"
FT                   /protein_id="ABF63015.1"
FT                   /translation="MTDSLPPCPECGSVYAYAMDALLVCPECGHEWSAETASDAPVVRD
FT                   SVGNVLSDGDTVTVIKDLKVKGSSSVVKVGTKVRGIRLVDGDHDIDCKVPGIGQMGLKS
FT                   QFVKKAAE"
FT   gene            complement(288006..288905)
FT                   /locus_tag="TM1040_0283"
FT   CDS_pept        complement(288006..288905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0283"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63016"
FT                   /db_xref="GOA:Q1GK00"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GK00"
FT                   /protein_id="ABF63016.1"
FT                   /translation="MRILFTGGSGKAGRHVIAYLLAQGHRVVNVDLTPLDLPGVDNRIA
FT                   DMTDAGQMHDVMHAWAGYDEMEQHRSPPPFDAVVHFAAIPRLLMRSDNECYRINTVGTY
FT                   NVIDAALKAGVRKVIFASSETTYGICFAGGERKPEYLPIDEAHPVVPEDAYAMSKVANE
FT                   QAALSFQRRSGADIYGLRINNVIEPHEYKANFPAYMADPELRRRNIFAYIDARDLGQMV
FT                   QRCLDADGLGYEIFNVANEDHSVNLSTSEIISHYYRGIPKAEMGETETFYSIEKAKRML
FT                   GFAPEHNWRMYLNDPREA"
FT   gene            289070..289723
FT                   /locus_tag="TM1040_0284"
FT   CDS_pept        289070..289723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0284"
FT                   /product="protein of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63017"
FT                   /db_xref="GOA:Q1GJZ9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ9"
FT                   /protein_id="ABF63017.1"
FT                   /translation="MRTPQTKPLLTLFDLQGLVFGVLMCSLGVVFLKAAGLVTGQTAGI
FT                   ALLLSYVLPLGFGPLFFMIGLPFLVLAWVKRGAVFALRTVLVVLGISAGAQILPLYLSF
FT                   DTLHIGIAALLGGACSGAGLIAIFRHNASAGGMTILGIIIEHRTGFKAGWFQLGVDACV
FT                   FAVSALVLSPEQLIYSFVGAMFTNLCIVWNFDVAQSGTGRPGYGRAAPKGASDD"
FT   gene            complement(289710..291107)
FT                   /locus_tag="TM1040_0285"
FT   CDS_pept        complement(289710..291107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0285"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63018"
FT                   /db_xref="GOA:Q1GJZ8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ8"
FT                   /protein_id="ABF63018.1"
FT                   /translation="MEQAKFLKGNLLRHITVMSLTSSVGLMAVFAVDFIDMVFIAMLGK
FT                   EELAAAVGYAGAILFFTTSFNIGIAIAAGALVARALGAGESVLARQQASNALIWGGIFS
FT                   AIFALVIWFNLASLVALLGAKGRALDLAVAYLQIIVPTLPLLLMGMAGGAILRAHGDAR
FT                   RAMMATIAGGVVNAALDPILIFGFDLELIGAAWASAASRVAVAVFALGPIFRHHGGLER
FT                   PPFALFVAGLAPIFAISFPAILTQLATPVGQAFVTRAMAEFGEEAVAGMAVIARMSPLA
FT                   FGTIFALSGAIGPIVGQNYGAGNFDRVRRAFWDALLFTGLFVVAVTAILFVLRAPIAAL
FT                   FDAQGTALSLIYLFCGPLALAFFFNGAIFVANASFNNLGHPFHSTWLNWGRHTIGTIPL
FT                   VWIGAHFFGAPGALIGQAVGGVIFGLFAIWLARRVIAEVEARGGAPKGPGLFQRQARQI
FT                   ILAFSRR"
FT   gene            291466..292560
FT                   /locus_tag="TM1040_0286"
FT   CDS_pept        291466..292560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0286"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63019"
FT                   /db_xref="GOA:Q1GJZ7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ7"
FT                   /protein_id="ABF63019.1"
FT                   /translation="MTTLSQTPTHDLRITDMQELICPEALAVKHPLTDAARETVLSARA
FT                   SIQKILHGADDRLVVVVGPCSIHDPEAALDYARRLAPLRAELGDALEIVMRVYFEKPRT
FT                   IAGWKGLINDPNLDGSFRINKGLSVARKLCLDLSEMGLPVGTEFLDASVPQYISDLVSW
FT                   AAIGARTTESQIHREMASGLSCPVGFKNGTRGNVQIAIDAVRSAATPHHFMALAPSGLA
FT                   AIAATAGNPDCHIILRGGGGTNFDAESVDSACKKAEADGIRPQVMIDASHANSAKDPAK
FT                   QPEVLSDVAGQMAQGETRITGIMIESHLEQGRQDLPKDGDLSKLTYGQSITDGCIGWEQ
FT                   TEAELRKLAQAVKTRRTQGARLAG"
FT   gene            292758..294155
FT                   /locus_tag="TM1040_0287"
FT   CDS_pept        292758..294155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0287"
FT                   /product="Peptidase S1C Do"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63020"
FT                   /db_xref="GOA:Q1GJZ6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ6"
FT                   /protein_id="ABF63020.1"
FT                   /translation="MIRSLALPLTIALATALPLASPAETKIPQSQTEISLGFAPLVKEA
FT                   APAVVNIYAKIIRQDRARSPFADDPFFDDFFRQFAQPRPRVQNSLGSGVILSEDGIVVS
FT                   NYHVVGEASDIRVVTNDRREYQAEVILADQASDLAILQLQDAEGLPHLGLRNSDEVEVG
FT                   ELTLAIGNPFGVGQTVSSGIISGLARTGTGGGQGFGYYIQTDAPINPGNSGGALIDVNG
FT                   DLIGINTRILSRSGGSNGIGFAIPANLVREFVRQARAGAEEFQRPWAGMTGQPVDSDLA
FT                   EALGLGQVDGMLISELHPQSPFVEAGFEVGDVVLAVDGEPVNSPSEMAFRLSVAELGGT
FT                   SAVTRVRQGKTDTVEVALIEAPDTPAADPITLSERTPMPGLVVGRVNPQVITKMQLPLS
FT                   TEGVVVMDPGPYAGRGGVRAGDLIFAINGEAVEAPEDVANLLMSSDRWMRMDLMRQGQR
FT                   VSLRFRL"
FT   gene            294157..295488
FT                   /locus_tag="TM1040_0288"
FT   CDS_pept        294157..295488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0288"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63021"
FT                   /db_xref="GOA:Q1GJZ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ5"
FT                   /protein_id="ABF63021.1"
FT                   /translation="MADLFDSEEAGARAAQNGASDAPRPLADRLRPRTLAEVIGQDQVL
FT                   GAEAPLGVMLSSGSLSSLIFWGPPGVGKTTIARLLAQETDLHFVQISAIFTGVPDLKKV
FT                   FEAAKIRRQNGQGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAAV
FT                   LSRAQVLVLERLSLADLERLTQRAEQALERRLPLSPEARDALHQMADGDGRALLNLIEQ
FT                   VSAWKVDQPLGREALATRLMRRAAKYDKSGDEHYNLISALHKSVRGSDPDAALYWFARM
FT                   LEGGEDPKYLARRLTRMAVEDIALADPQAQAICLQAWEAYERLGSPEGELALAQAVIYL
FT                   ALAPKTNAGYMAYKAARRLAKETGSMSPPKHILNAPTKLMAEQGYGKGYDYDHDAEDGF
FT                   SGQNYFPDGVKRPVLYQPVERGFERELRKRTEFFAKKRIQRQGE"
FT   gene            complement(295557..296987)
FT                   /locus_tag="TM1040_0289"
FT   CDS_pept        complement(295557..296987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0289"
FT                   /product="multicopper oxidase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63022"
FT                   /db_xref="GOA:Q1GJZ4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ4"
FT                   /protein_id="ABF63022.1"
FT                   /translation="MTSKSKRCVMNPSRRHVLAGLTACASLPALPRFAQASTETNVESA
FT                   AHRLTLAPARQQIAPTDYPATDLWCVNGTMPGETLRRTQGARLVVEVDNQLPQATSLHW
FT                   HGIRIDNAMDGVPGVTQDPIQPGTRFTYDFALPDAGTYWYHSHAQSVEQVERGLQGALI
FT                   IEEPDAPDVDQDLPLVIDDLRVTAEAAIDANFAVPHDLSHAGRMGNILLCNGKMVADHP
FT                   VKTGDRLRLRLINSANARIFTLGLQGLEGWVMAYDGMPLATPEALPDRLLLAPAQRVDL
FT                   FVDVTAAAGEDAFLVQFERDGGYELARFPVASGTRARRPAPSALPPNPDFPIDLPSARS
FT                   VDLITEGGAMAWLSGARFKGEDLSGQDLAQLGQFWAFNGSAGRPPEPFVTARLGETIRI
FT                   RMVNDTRFPHAMHLHGMHFSEVRADGSLGPLRDTLLMLQGETREIAFQAHNAGDWLFHC
FT                   HMLSHHAAGMGTWVRVTA"
FT   gene            297078..297542
FT                   /locus_tag="TM1040_0290"
FT   CDS_pept        297078..297542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0290"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63023"
FT                   /db_xref="GOA:Q1GJZ3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJZ3"
FT                   /protein_id="ABF63023.1"
FT                   /translation="MRLVQSGHGGRDEPQNLTSCAPRAKGAGMLITVLNVALGGAIGAS
FT                   CRYLIGVGVLRALGPTGFPVGVLGVNILGSALMGAFVVLAAHKGLTHLSPFVMTGVLGG
FT                   FTTFSAFSLEAVTLFERGAYGQAALYIGLSAGLSIAALALGMMAARGVLT"
FT   gene            297539..298585
FT                   /locus_tag="TM1040_0291"
FT   CDS_pept        297539..298585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0291"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63024"
FT                   /db_xref="GOA:Q1GJZ2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ2"
FT                   /protein_id="ABF63024.1"
FT                   /translation="MSGVQMITVTEDDGGQRIDRWLRRLFPHVNQGRIEKMCRKGELRL
FT                   DGGRVKANTRVEAGQVVRVPPLAESDMKPAEARPVKISDADAKMIRDCVIYKDDDVLVI
FT                   NKPAGLAVQGGSGTTKHVDGLSEALRFDAEDKPRLVHRLDKDTSGLLVLARNRKAAQGL
FT                   TAAFRHKNTRKIYWALVAGVPTPYLGEIKTGLVKAPGHGKSGEGEKMIPVDPRDVDATP
FT                   GAKRAHTYYATLYRVASRASWVAMEPVTGRTHQLRAHMAGMGHPIIGDGKYGGSGQENL
FT                   GDGWGAQIGGLISKKLHLHARRLQFEHPVTGKVVTVTAALPDHMKESWDTFGWTEDLAA
FT                   DDPFETLF"
FT   gene            298582..299250
FT                   /locus_tag="TM1040_0292"
FT   CDS_pept        298582..299250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0292"
FT                   /product="HAD-superfamily hydrolase subfamily IA variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63025"
FT                   /db_xref="GOA:Q1GJZ1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ1"
FT                   /protein_id="ABF63025.1"
FT                   /translation="MTSALKLILFDVDGTLVDSQGTIVACMNEAFEREGLVPPSHAAIL
FT                   SIVGLSLPQALAQLAPEQSAQAQGALVEGYKQAYMAARQREGAAHSPLYPGAREVLDTL
FT                   HAVPEYILGVATGKSQRGLDALIEGHDLGMFVTRQVADHHPSKPHPSMILTAMSETGIP
FT                   PADTVMIGDTTFDMEMGRAAGVKTIGVDWGYHPAAHLRADHMLSDYRALPDLLRRIWSD
FT                   "
FT   gene            299318..300022
FT                   /locus_tag="TM1040_0293"
FT   CDS_pept        299318..300022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0293"
FT                   /product="ATP12 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63026"
FT                   /db_xref="GOA:Q1GJZ0"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJZ0"
FT                   /protein_id="ABF63026.1"
FT                   /translation="MSEWKQKRFWKAVSVEEDDSGFAVALDGRRVKTPAKTALLVPTRA
FT                   LADAIAAEWDAQEEQIDPLSMPYTRSANAAIDKVAVQFAEVADMLAEYGDSDLLCYRAE
FT                   SPEGLVARQSESWDAALDWAEGALGARLLPRAGILHAPQDSAALETLRTRVHQMTPFQL
FT                   AAFHDLVGLTGSLILGFATAEGWRALDEIWEISRIDERWQEELWGPDDEAQAIEAQKKQ
FT                   AFEHAAAFYARA"
FT   gene            300335..301351
FT                   /locus_tag="TM1040_0294"
FT   CDS_pept        300335..301351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0294"
FT                   /product="Lysine-arginine-ornithine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63027"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY9"
FT                   /protein_id="ABF63027.1"
FT                   /translation="MNNSVFFGALTVAGLAAGAAAAGTLDDVKARDKLNCGVSTGLVGF
FT                   SAPNANGEWEGFDIAVCRAVAAAVLGDPSKVEYVPTTGKTRFTALASGEIDMLARNTTW
FT                   TFSRDVDLKFEFVGVNYYDGQGFMVPKELGVSSAKELDGATVCIQTGTTTELNLADFFR
FT                   ANNISYEPVPIETNAEARQQYLAGACDVYTTDASGLAATRATFDDAANHVILPEIISKE
FT                   PLGPLVRHGDNEWGDVVRWTLNAMIAAEELGITSANLAEKAAGTDNPEINRLLGTEGTL
FT                   GEMLGLEADFAQKALAAGGNYGEIFAKTIGEDTPVGLARGLNAQWTDGGLLYAPPFR"
FT   gene            301493..302761
FT                   /locus_tag="TM1040_0295"
FT   CDS_pept        301493..302761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0295"
FT                   /product="Amino acid ABC transporter permease protein 3-TM
FT                   region His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63028"
FT                   /db_xref="GOA:Q1GJY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY8"
FT                   /protein_id="ABF63028.1"
FT                   /translation="MSTLTDPPKETFRLSMLIYDTRYRSATIQVVALIGFLILVGSIIS
FT                   NTAQNLADLGKEPSFRFLSEPAGYDINQRLLDYDNQDSHMRASLMGLLNTLVVAVLGCI
FT                   TATILGVIIGVLRLSSNWLVARLMAVYVEMFRNVPLLLWIVFIMAILIETLPAPRAFRG
FT                   ENPEATMSVFDSVAVTNRGVYVPEPLFHNSLGNIGVFGDSAVRFDVSLDLIALLVVLGA
FT                   SLYVSKRIRLWADQTQESTGLRPTTWHMRSAVVVLPSALLLFVLGFHLGYPALKGFNFA
FT                   GGTHLRNSLIALWLALSLYTAAFIAEIVRSGILAISKGQTEAAAALGLRPKRIMNLVIL
FT                   PQALRVIIPPLISNYLNLTKNSSLAIAVGYMDLTGTLMGITMNQTGRELETVLLGMLVY
FT                   LTISLLISSVMNWYNNRVKLVER"
FT   gene            302763..304091
FT                   /locus_tag="TM1040_0296"
FT   CDS_pept        302763..304091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0296"
FT                   /product="Amino acid ABC transporter permease protein 3-TM
FT                   region His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63029"
FT                   /db_xref="GOA:Q1GJY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY7"
FT                   /protein_id="ABF63029.1"
FT                   /translation="MSDISFVRTEMLPPKEPPASEVGVLGWMRANLFSNWFNSVLTLVS
FT                   LYFVIQILIGLITWAWVPTWSAGSLPECRVIFEELGRTGHNAGACWGVIAERWPQLLFG
FT                   FYPNGSEPGTADLRWRPVLAFLLLFVALAPVLFADKVPAKLIYFSAAYPFLMPWLLWGG
FT                   TVWTPVMIAAGFVVGYFVYKAVSQATSELIGLISGVVGAVVWWLFVASFIASVLAGIVP
FT                   LALESVESRQFGGFMLSILIGVVAIGLSLPIGIVLALGRQSDLLIVKTLCVGFIEFIRG
FT                   VPLITLLFVASTLLNIFMPPGTNFDIIMRVFIMVTLFASAYMAEVIRGGLAALPKGQYE
FT                   GADSLGLNYWQAQRLIIMPQALKISIPGIVSTFIGVFKDTTLVSVIGLFDPLNLTNAIR
FT                   ADANWNGLVWELYGFIALLFFVFCFGMSRYSMYLERKLQTGHR"
FT   gene            304104..304895
FT                   /locus_tag="TM1040_0297"
FT   CDS_pept        304104..304895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0297"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63030"
FT                   /db_xref="GOA:Q1GJY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY6"
FT                   /protein_id="ABF63030.1"
FT                   /translation="MSELALDREIDRSKMKVSDEVAIQITDMNKWYGAFHVLRDINLTV
FT                   NQGERIVIAGPSGSGKSTLIRCLNALEEHQAGKIVVDGTELSNDLKNIDKIRSEVGMVF
FT                   QHFNLFPHLTILENCTLAPIWVRKTPKKEAEERAMHFLEKVKIPEQADKYPGQLSGGQQ
FT                   QRVAIARSLCMMPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFARQ
FT                   VANRVIFMDAGQIVEQNEPEEFFNNPQSERTKLFLSQILGH"
FT   gene            complement(305059..305484)
FT                   /locus_tag="TM1040_0298"
FT   CDS_pept        complement(305059..305484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0298"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63031"
FT                   /db_xref="GOA:Q1GJY5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY5"
FT                   /protein_id="ABF63031.1"
FT                   /translation="MIRPYSPSDKSTVLDIWRAASAIAHPFLSQRLVAEAEAMIRDQFL
FT                   DLAETWMIAPGATPVGFIALLGNEVGGLFVLPDHQGKGYGRALLDHVQARREALTLSVF
FT                   AANHTARRFYEAYGFTPLEERLNPFFKHKEIVMRLPS"
FT   gene            complement(305689..306186)
FT                   /locus_tag="TM1040_0299"
FT   CDS_pept        complement(305689..306186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0299"
FT                   /product="putative phosphohistidine phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63032"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY4"
FT                   /protein_id="ABF63032.1"
FT                   /translation="MTCTLFLTRHAKSAWNTDAPSDHARPLNTRGRRSAAALGAWVREQ
FT                   SSPPLQVLSSSAQRTRETYDLMALTAPATFTERLYHATPEILYDVLREATQPNVLLLGH
FT                   NPGLLAFAHDIVKHPPPHSRFDDYPTGATLLVEFDIAHWAEMQPHSGRVIDFVVSRELL
FT                   GE"
FT   gene            complement(306183..306878)
FT                   /locus_tag="TM1040_0300"
FT   CDS_pept        complement(306183..306878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63033"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY3"
FT                   /protein_id="ABF63033.1"
FT                   /translation="MAAPQFSPDLQNRYDQLSAALPPLGLMVYGSVHPKRVPVPGYDSG
FT                   TLILIGAASTFWQVLSTAPEGRDNRPDPVDRYSRRVIERLAHDHGAQKAEFPFGGPPYA
FT                   PFVAWALASGRAFTSPSQLLVHDEVGMLISYRGALFFDETFATPPPRLSRSPCASCAAR
FT                   PCLSACPVHALVDEGPYKLAACHNHLDTPQGAECMASGCIARRACPLSDGAGRQPAQSA
FT                   HHMRYFHRP"
FT   gene            complement(307007..307867)
FT                   /locus_tag="TM1040_0301"
FT   CDS_pept        complement(307007..307867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0301"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63034"
FT                   /db_xref="GOA:Q1GJY2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJY2"
FT                   /protein_id="ABF63034.1"
FT                   /translation="MKTRDMNRDWIATAETLSSALPYLQRYDDAIVVIKLGGHAMGSDE
FT                   GMESFARDVVLLRQVGVNPVIVHGGGPMINALLDKLQIKSEFVNGKRVTDAATMEVVEM
FT                   VLSGMVNKRIVQAINAQGGKGIGLSGKDANLITCEATDPALGFVGTPSEVNADMLKNLF
FT                   EKEFIPVIAPIGSGTAGETFNINGDTAAGAVAAALKADRLLLLTDVAGVKNAEGVVVTE
FT                   LKAADVEEMTAAGVIAGGMIPKTETALAAVRGGVRACTIVDGRVPNAVLLELFTDHGAG
FT                   SMIRS"
FT   gene            308089..308820
FT                   /locus_tag="TM1040_0302"
FT   CDS_pept        308089..308820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0302"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63035"
FT                   /db_xref="GOA:Q1GJY1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY1"
FT                   /protein_id="ABF63035.1"
FT                   /translation="MRRKTLLLTGASRGIGHATVRRFNAEGWRVITCSRQPFPKECPWG
FT                   GGEENHVQLDLSDPSDTINAVGVIQERLEDGRLDALVNNAGISPKGPDGERLSTLNTDL
FT                   MDWAKVFHVNFFASVVLARGLREELAAAKGAVVNVTSIAGSRVHPFAGAAYATSKAALA
FT                   ALTREMAHDFGPMGVRVNAIAPGEVETSILSPGTDKIVEKLPMRRLGQPSEVADAIYFL
FT                   CSEKSSYISGTEIEVNGAQHV"
FT   gene            complement(308867..310279)
FT                   /locus_tag="TM1040_0303"
FT   CDS_pept        complement(308867..310279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0303"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63036"
FT                   /db_xref="GOA:Q1GJY0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJY0"
FT                   /protein_id="ABF63036.1"
FT                   /translation="MALSQTTGVDSRPAAPNLSQKFYFAAWRWHFYAGLYVIPFLIMLA
FT                   VTGLMMMFITQVDGRDGETLRVSVTGVEMPIEAQMQAVLAAQPGAIVEWIAPKSADLAT
FT                   VYRIAPPQGGNRMVALNQYTGEVLEIWDRRAGWYDWADNMHGTLLIGETGDRLIEIAAG
FT                   LGIVLVVTGLYLWWPRGNWRAALLPDLRARRRALWKNLHGVLGFWMSGLLVVFLISGLA
FT                   WTGIWGEKFVQAWSSFPAQKWDAVPTSDSTHAAHLNHGSTNDVPWALEQTPMPMSGSTA
FT                   GTQGLAPGEAVSLGSVIALGRALGMEGRFRVALPRDANGVWTLNRDSMSGDSTDPFVDR
FT                   TVHVDQYTGKILADVRFDDYSLAGKAMAVGIPFHMGLMGLWNLVLNTVFCLSMIFVCIS
FT                   GMVMWLKRRPTRAARLAAPPMPEDLPFWKGAVLIGLFASLAFPLVGLTLLAVLALDVLI
FT                   LSNLPRLKRVVS"
FT   gene            complement(310348..310680)
FT                   /locus_tag="TM1040_0304"
FT   CDS_pept        complement(310348..310680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJX9"
FT                   /protein_id="ABF63037.1"
FT                   /translation="MAILIAGLIPAGWMPVTAQDGKVLLVLCTPEGVEERWVDLGAPVP
FT                   AHDEDQSTSRDCPFAAQPTLAAHDAVLLPLPLSGPERDLWARAPFTHHSAGFHWRYDAR
FT                   GPPALS"
FT   gene            complement(310715..311365)
FT                   /locus_tag="TM1040_0305"
FT   CDS_pept        complement(310715..311365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0305"
FT                   /product="GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63038"
FT                   /db_xref="GOA:Q1GJX8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJX8"
FT                   /protein_id="ABF63038.1"
FT                   /translation="MQLPFPLAEEPDAAAMETGRKLFAGQSEFLKGVVAMSGLPPADRI
FT                   EVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFFTQGPELYLVDLPGYGYAN
FT                   APLAVVEKWQRLLKQYLSGRQTLRRAFVLIDTRHGVKKVDEEIMKLLDTSAVTFQVVMT
FT                   KADKVKEKDRAKILDQVRDALSKHPAAYPEIVLTSSEKGDGIATLRSIIAHLD"
FT   gene            complement(311365..312102)
FT                   /locus_tag="TM1040_0306"
FT   CDS_pept        complement(311365..312102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0306"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63039"
FT                   /db_xref="GOA:Q1GJX7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJX7"
FT                   /protein_id="ABF63039.1"
FT                   /translation="MTATVRQMWRHPIKGIGAEPLTEVRLETGGPMPLDRAWAVLTGTS
FT                   EDTGAWQPCRNFARGCFGPELMAITAETQGNQITLRHPKQGEITLDPATDGARLLEWLL
FT                   PLYPAERPQPHTLIKAPAGGMADADFSAVAILSLTSLKALGDALGQELDPRRFRGNLWI
FT                   DGTAPFEEFDWVGRELKIGTARLEVVDRITRCRATETNPETGARDANTLKALREHWGHT
FT                   DFGIRARVLSDGDIALSDSLEVL"
FT   gene            complement(312099..313925)
FT                   /locus_tag="TM1040_0307"
FT   CDS_pept        complement(312099..313925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0307"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63040"
FT                   /db_xref="GOA:Q1GJX6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJX6"
FT                   /protein_id="ABF63040.1"
FT                   /translation="MDDQNKNLLLATALSFLVILGWYFFFPPPEEAPQPATEVTETAPQ
FT                   GDTTAPAAAPSAGAATAEVDAAAAETEITEDVPRLTIDTPRVEGSISLKGGRIDDLRLK
FT                   DYRETLDDDSPIVTLLSPAGQPHAYYALYGWAPGAGLGIEDVPTANTLWQAEAGATLTP
FT                   DTPVTLTWDNGKGLTFSREVSIDEDYMFSITQSVTNSSGASVALAPYGTLARHGEPANL
FT                   ENFFVLHEGVVGMADGELSEIDYDDMTDFDPDPRDGSRAQVNTVTENGWIGFTGHYWMS
FT                   TLIPAPGEAFRAIAKYDERRDIYQTDVVLPTVTLAAGESTSANTQLFAGAKEWATIREY
FT                   ERAGIEGFLDSIDWGWFFFFTKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYK
FT                   SYASMARMKELQPEMEKLRERAGDDRQKMQKEMMELYKREKVNPAAGCLPILIQIPIFF
FT                   SLYKVIFVTLELRHAAFFGPFQDLSVPDPTSLFNLFGLLPWAAPAPDSLLSLVFIGILP
FT                   ILLGVSMWVQQKLNPAPTDETQRMIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQ
FT                   YLIMRSHGYTPDVFGNIKSGFKKDKAEKAEKK"
FT   gene            complement(314351..315850)
FT                   /locus_tag="TM1040_0308"
FT   CDS_pept        complement(314351..315850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0308"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63041"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJX5"
FT                   /protein_id="ABF63041.1"
FT                   /translation="MSRVVFGPPMLAFLPAISLSAFWFGGESALLAVALGLPLTYAVLG
FT                   GFSKSRETTPGRDELTGFLLAPGFETHVRDVFDRTEGTGLKSALVVVEIDEFDALVAAH
FT                   GQDAGDIVMQRVGERMRSILRHRDTIARLGRNRFAICLTPIMQLDLELCIQLAGRLQFR
FT                   IEEPIKFGGTSLFVSCSIGICQRHRVPKDAGSSWLDCAVAALDEALVVGPSSIRAYSSD
FT                   THVHLDRTVNLMEDAASALQNGMIQAWFQPQICTDTGRVSGFEALARWCHPVKGMIPPS
FT                   AFLPALEHAGLLQKLSQVMVEQALTALKSWDAAGLKVPTVGVNFATDELRDPGLVNRIR
FT                   WELDRFGLTPDRLTIEVLETVMTDQPDEVVARNITALGEMGCHIDLDDFGTGHASIASV
FT                   RRFRVSRIKIDRSFVTKADHDPEQQKMITAILTMAERLDLKTLAEGVETAGEHALLAQL
FT                   GCDHVQGFGIGRPMPFDQTIDWVINHEAKLQDAPAIGRQRP"
FT   gene            complement(315963..316850)
FT                   /locus_tag="TM1040_0309"
FT   CDS_pept        complement(315963..316850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0309"
FT                   /product="PP-loop"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63042"
FT                   /db_xref="GOA:Q1GJX4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJX4"
FT                   /protein_id="ABF63042.1"
FT                   /translation="MLDQDLDDIHPLFQGAPQTTEFKKLRKRIVRYTREAVEQYGMVER
FT                   REDGSLPKWLVCLSGGKDSYTLLAVLYELKWRGLLPVDLLACNLDQGQPGFPATVLPEF
FT                   LEKMQVPHRIEYQDTYSIVMDKVPQGRTYCALCSRLRRGNLYRIAREEGCSAVVLGHHR
FT                   DDILETFFMNLFHGGRLATMPPKLVNEEGDLFVFRPLAHVAEADCEKFARAMNYPIIPC
FT                   DLCGSQDGLQRQQVKQILDTWESNSPGRRQVMFRALMNARPSHLLDPKLFDFTGLALKN
FT                   IDNSTETEEIPELR"
FT   gene            316985..317530
FT                   /locus_tag="TM1040_0310"
FT   CDS_pept        316985..317530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63043"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJX3"
FT                   /protein_id="ABF63043.1"
FT                   /translation="MRYLWRAALMMGALVAMLGLANCGRPSLEDEKLSDQKLNLEEYFD
FT                   GKTVAYGQFKDRFGTVRRRFKVEIDGTWDGEQLRLNERFAYADGSSETRNWVLTKTGPD
FT                   DWVGTAEGVQGEARGREVGDTFNWAYTIDLPLPDGDSMRVDFDDWMWLLEDGRLLNIAY
FT                   MERFGVTLGEVTIFFEQR"
FT   gene            complement(317527..317787)
FT                   /locus_tag="TM1040_0311"
FT   CDS_pept        complement(317527..317787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0311"
FT                   /product="protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63044"
FT                   /db_xref="GOA:Q1GJX2"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJX2"
FT                   /protein_id="ABF63044.1"
FT                   /translation="MRLLARLIALPVRGYRLLFSPWVGFNCRYQPTCSAYALDALERHG
FT                   PFKGTYLMLRRIGRCHPFGGSGYDPVPGADPKHDRCCGRTP"
FT   gene            complement(317986..318423)
FT                   /locus_tag="TM1040_0312"
FT   CDS_pept        complement(317986..318423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0312"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63045"
FT                   /db_xref="GOA:Q1GJX1"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJX1"
FT                   /protein_id="ABF63045.1"
FT                   /translation="MASTADQGIQPPAVSVCASSPQEAQAAAKPVKTRAGMVLLTKRGE
FT                   FLAAARARKQGTRSMMVQGRKRGDEGSLRVGFTCSKKVGNAVTRNRAKRRLREIARLLL
FT                   KEHGKPGWDYVLIGRAGETTTCPFEQMQKDFLYALRKLHGS"
FT   gene            complement(318476..318610)
FT                   /locus_tag="TM1040_0313"
FT   CDS_pept        complement(318476..318610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0313"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63046"
FT                   /db_xref="GOA:Q1GJX0"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJX0"
FT                   /protein_id="ABF63046.1"
FT                   /translation="MKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA"
FT   gene            319077..319814
FT                   /locus_tag="TM1040_0314"
FT   CDS_pept        319077..319814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63047"
FT                   /db_xref="GOA:Q1GJW9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW9"
FT                   /protein_id="ABF63047.1"
FT                   /translation="MMSDTPSSPKRKNWLRHLPLALVAVGALVGAVTLGDVLSFETLRD
FT                   NREALLAFRDQNYLGLVLVFLVAYVAIVAFSLPGAAVASVTGGFLFGLVAGTGLNVLAA
FT                   TIGAMAIFLAARWGLGAALSAKIESSEGRIRRLKSALHDTEIEVLLLLRLVPVVPFFVA
FT                   NLLPALVGVRVWNFFWTTALGIIPGAIVFTWIGVGLGEVFDRGESPNLSLLWEPHIIGP
FT                   ILGLCALAALPILIKALRGTSEV"
FT   gene            319818..321233
FT                   /locus_tag="TM1040_0315"
FT   CDS_pept        319818..321233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0315"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63048"
FT                   /db_xref="GOA:Q1GJW8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW8"
FT                   /protein_id="ABF63048.1"
FT                   /translation="MASIKCDLLIIGAGSGGLSLAAGASQMGADVVLLEGHKMGGDCLN
FT                   YGCVPSKALLASGHIAHTQAHAQAFGIADQAAEVDYAAAKGHVQQVIDTIAPVDSQERF
FT                   EGFGVRVIREMGRFISANEVAAGDTTITARRIVVATGSSPFVPPIPGLQDVPYLTNETL
FT                   WALNERPEHLIVIGGGPIGMEMAQAHRRLGSKVTVLEAQAALGRDDPEAAAFVLERLRN
FT                   EGIEIREHTAAQAVRQEAGRIVVQTSAGTVSGSHLLVAVGRKPNLDGLNLEAAGVEVGR
FT                   AGIKVGPDLRSSNPKVYAIGDVAGQGQFTHLAGYHASVVIRSLLFGLPAKTKTNHIPRA
FT                   TYTDPEIAQVGLTEAEAQETYAAKLEIARFDYSHNDRAIATRQAEGFIKVMVVKGRPVG
FT                   ATIAGPQAGELISTWSLAIANGMKMSQIAAMVAPYPTISELNKRVAGAYFSPRLFENSA
FT                   VKRVVRLVQRWLP"
FT   gene            321251..322636
FT                   /locus_tag="TM1040_0316"
FT   CDS_pept        321251..322636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0316"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63049"
FT                   /db_xref="GOA:Q1GJW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW7"
FT                   /protein_id="ABF63049.1"
FT                   /translation="MLNTLSGRFLILTTVFVMLAEVLIFVPSISRFRQDYLEDRLERAQ
FT                   IASLALLADDMIESDLERELLENAGVYNVVLRRDEMRQLVLSSPIPSPITETFDLRDAS
FT                   APTLIGDALTRLWSPGNEIIRVIGAPVRDAGLLIEITMETGPLRAAMIDYGLRILLLSA
FT                   VISVLTAVLLFIAVRMVLVTPIKGVIGYMQRYAAAPEDARGIITPKAGVIELREAEEAL
FT                   QKLQTELTHALKQRERLAQLGGAVAKISHDLRNILTSAQLFTDRIEMSEDPLVRRLAPK
FT                   LVNSITRAVSLCEGTLAFGRAEEPAPTFGRVCLSEIIDDVAESETLVASDVDVEICNTV
FT                   PLPTMIRCDKEQIFRVIMNLVRNARQAIIATGRNGRITVSMREEENAWWVEVADDGPGL
FT                   PKKALDNLFTPFQGGARKGGTGLGLAIAAELIKGHGGHLALARTGPEGTVFEICLPKGD
FT                   GAV"
FT   gene            322763..322839
FT                   /locus_tag="TM1040_R0009"
FT                   /note="tRNA-Arg3"
FT   tRNA            322763..322839
FT                   /locus_tag="TM1040_R0009"
FT                   /product="tRNA-Arg"
FT   gene            323531..324073
FT                   /locus_tag="TM1040_0317"
FT   CDS_pept        323531..324073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63050"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW6"
FT                   /protein_id="ABF63050.1"
FT                   /translation="MLRHLTTKFVLALLLAACSTTQGSVSRKSIQIDAMTVTWNDMLQL
FT                   SSLHEAFPTEKGTSIYMFTRLFKDPTYTPRKAQLSNGWTVTGNIGACDLILRKQPANAQ
FT                   QLYDECRTKLAALAAPKPQPELGLKEFINLAERAVQQEGSCQWLGYDRGLDLTVRAHGS
FT                   LASFSDERLFFAKLKCS"
FT   gene            324245..324664
FT                   /locus_tag="TM1040_0318"
FT   CDS_pept        324245..324664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW5"
FT                   /protein_id="ABF63051.1"
FT                   /translation="MVVGCTCGSGFHDLRFRFGQARRTAASPSPRASCGRCFTDQNHDF
FT                   AKVTNCAFQSFDQGAAFGKVGLCTRRCFDLHVRPLSILGQKYLTFGSKSRGAAVPFSQA
FT                   LVADWGNGVRRSTPRLQIADAWRRARMWLCPSISS"
FT   gene            324863..325447
FT                   /locus_tag="TM1040_0319"
FT   CDS_pept        324863..325447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0319"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63052"
FT                   /db_xref="GOA:Q1GJW4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW4"
FT                   /protein_id="ABF63052.1"
FT                   /translation="MTRTGRPRSFDEDTALQAAMTAFWEGGYTGTTYRDLEQATGLRRQ
FT                   SLTYAFGEKPDLFRRALALYIDQRVRKACALLAQDAPFRDNLSALLNAWEADASSGNGR
FT                   GCLLVRATAEVGLDPHMTSEIRRGDTLLLQALTQAFDRAQLAGEIPSAAPPEALARLVI
FT                   SVGNGAMTQAVARQDPEVSRAAHDALLSLLT"
FT   gene            325584..326150
FT                   /locus_tag="TM1040_0320"
FT   CDS_pept        325584..326150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0320"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63053"
FT                   /db_xref="GOA:Q1GJW3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW3"
FT                   /protein_id="ABF63053.1"
FT                   /translation="MTVFTHHSIETAPEAAKPLMEQAVKDYGMLPGLYQVMSASPELLE
FT                   SYFKLHELFERTALSVTERNIVWLTINVEHDCHYCVPAHTAIAKMQGVDDEIVAALREE
FT                   RPLADPRLEALRQFTLILVRERGNAPKAEVERFLQAGFEPRAILDILVGLAQKVLSNYT
FT                   NHLAETPVDAPFQAFAWEKTAVAAE"
FT   gene            326224..326781
FT                   /locus_tag="TM1040_0321"
FT   CDS_pept        326224..326781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0321"
FT                   /product="Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63054"
FT                   /db_xref="GOA:Q1GJW2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW2"
FT                   /protein_id="ABF63054.1"
FT                   /translation="MLRDTPLCSFGWKAPDFTLRDPEGRPYTMSDHLGEKGLLVAFLCN
FT                   HCPYVQAVADRLAEDTGTLLDEGIGVLAVMSNDYHAVPMDHPAYMQRFAREVGWRFPYL
FT                   VDEDQSVGQAWGAVCTPDFFGLNAAGALQYRGRLDNARFDAPAGRNRELVAAMRQIAMT
FT                   GEGPQEQLSSMGCSIKWRSARG"
FT   gene            complement(326868..327740)
FT                   /locus_tag="TM1040_0322"
FT   CDS_pept        complement(326868..327740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0322"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63055"
FT                   /db_xref="GOA:Q1GJW1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW1"
FT                   /protein_id="ABF63055.1"
FT                   /translation="MRKLPPLNAIRAFEAVARRLSFADAGDELGVTATAISHQIRHLEA
FT                   YLGFQLIERRPRQIALTPAGQELFPKLQMAFDTLGEAFAMLDKDVEQSLVRVTATYAFA
FT                   ERWLVPRLTGFFEQHPDIRVEVETDDAILDLRADRLDLAIRYGPQTAATEHAEVLFSDR
FT                   FIPLRLASQPEADLQESRLLGFRWRNADMGGPVWEDWFKAAGEPFPAERMTRFSDESSA
FT                   FNALDRGLGLLLSSSALADEGLQSGRYQQVPGPELHGFAFYLVRNPLSRNKQGVRVFTD
FT                   WIREAAKES"
FT   gene            327846..328961
FT                   /locus_tag="TM1040_0323"
FT   CDS_pept        327846..328961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0323"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63056"
FT                   /db_xref="GOA:Q1GJW0"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJW0"
FT                   /protein_id="ABF63056.1"
FT                   /translation="MTLNIITTRRRLIKGGIAAAATLAAPSVLRAQGRRDLSMLTWAGH
FT                   ADPDVIGAFEEAHNVRIRAKEYVGGDQMLAQIAQSPAGTYDVILSDAEYVVQLQQAGFI
FT                   DPLSPEDYPFDDFFPEFQNFRGHWFDGQPYAVFLRFGFLGLSHHRGAMSEAEARSYRSM
FT                   WETRHEGRIGHFDWHLPNLGALSLMNGNAAPFDLGAGDWAVLTETMMSLRPQVRGFYDY
FT                   GGMLSALRSGEVTAIPGIGDWITGVLARDGADVTTTIPEEGGLQWTESLSIGTRSRNPD
FT                   LARQFIQYMLSPDGQVKTATLKAYPAMIPTRSGWARLNAEQPGEAKRQNMVLNGPNALD
FT                   EIRAGRIRLRELPVQQSLETWNDAWTRYKNA"
FT   gene            329049..329936
FT                   /locus_tag="TM1040_0324"
FT   CDS_pept        329049..329936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0324"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63057"
FT                   /db_xref="GOA:Q1GJV9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV9"
FT                   /protein_id="ABF63057.1"
FT                   /translation="MTSYFSPAPASVRRTPFLFGRFWRALWVLPLPVWLLLFFAVPLGL
FT                   LVAISFWSVVNYRLTPDATLSAWRYVLGLEFLWASFWRSYGLAMASAVAISLLAFPASY
FT                   AMAFVVAPRQRLILLGLAIAPFFTSYLVRVYSWQVFLTEGGVIPSIVQALGGSGESLLN
FT                   TYFALFLGHATLALPVVLILQTIALVNVDRTGISAAANLGARPGAILLQVILPAARPGL
FT                   TLGLLFAFLLSYAEFVSASYLGGGSFQTLPILVTDLVRAGQQWPRAAVVALMMIASLLI
FT                   TAFVTVLWAYREKG"
FT   gene            329940..330761
FT                   /locus_tag="TM1040_0325"
FT   CDS_pept        329940..330761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0325"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63058"
FT                   /db_xref="GOA:Q1GJV8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV8"
FT                   /protein_id="ABF63058.1"
FT                   /translation="MPVHLKHALPKAFWIGGLVLVFVLLYAPILSAVMFSFSADRFPSL
FT                   SLSGFSSKWYAQVLSDRAMLDALWNSLRVAMLTALIATALGFAAAYADYRFRFTGQRAV
FT                   LALALLPPTVPLVILGLAMLAFFSRIGIAGTLMAVVAAHVVIAAPFAMAVCRLRLAQLD
FT                   DSLEIAAQNLGALPHSALTRIVLPHTLPAIFAAFLITFAVSFDEYVISWFTGGLNQTIP
FT                   VAVLTTLQGQVDPTIHVIGTLSFSVTLTLVLIALGVVLTQSSGAMSKEETT"
FT   gene            330758..331876
FT                   /locus_tag="TM1040_0326"
FT   CDS_pept        330758..331876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0326"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63059"
FT                   /db_xref="GOA:Q1GJV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV7"
FT                   /protein_id="ABF63059.1"
FT                   /translation="MTHSHLKLDGLAKSYGSFVAVEEVSLDIAEGEFIAIMGPSGCGKT
FT                   TSLRMLAGLETADRGEITLAGTRIDQLPVWERETPMVWQSLALFPFMTVRENVEFGLKM
FT                   RGVSRTERRHRADDWLERLGISGYADRNVARLSGGQRQRVALARSLVLEPKVLLLDEPL
FT                   SALDAHMAIKMQGELKKLQRELGITFVYVTHSHSEAFSLADRVVIMNGGRVEQIGSPQD
FT                   IFLRPRSKFVAQFVGGISLLEGKIAGTPGGKRYLETRDGKVQLAGSFTHAEGARADLAV
FT                   RADRISVTANPGWGENEIACTLVSEEFAGAVVNLHLTTASGHSLVAQVQQRELEQLDAS
FT                   IGAQVYASWHPSDGFLLEPPQAEGGDARGRAA"
FT   gene            331873..333141
FT                   /locus_tag="TM1040_0327"
FT   CDS_pept        331873..333141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0327"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63060"
FT                   /db_xref="GOA:Q1GJV6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV6"
FT                   /protein_id="ABF63060.1"
FT                   /translation="MSAVLEATQEALSRAEQAPEVFLSRLPERARAEARESAARRSKLG
FT                   PLDGATISWKDMIALKGVAARAGAAHDPKLAPAVSDADVVTRARRAGLVSIGITNQSEL
FT                   AFSGIGYNPHHGTPLLEGRVPGGSSSGAAASVARGITRLAVGTDTAGSCRVPAAFQGVV
FT                   GFRPTRGRYPMAGVMPLAPSYDTVGGFARSVSDMIALDAVLSGDETCADAASSLGVLHE
FT                   VLGAGDVATGVAASFKAAVVRLAEAGLKMERARQSPLLDALALIAAGGWPGAREAVDTY
FT                   GHLLAPETALRLDPFVAERLRVSARLDREPLEKVKRQACSLRARMQTEDTLYVLPTVAI
FT                   EAPLLAPLLADPEAFAATNAAALRLTMPASLLDLPAISLPIGQTEAGCWVGLQLVGPPH
FT                   SDRRLLATSQTVEKLLMRKDKLR"
FT   gene            333138..334046
FT                   /locus_tag="TM1040_0328"
FT   CDS_pept        333138..334046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0328"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63061"
FT                   /db_xref="GOA:Q1GJV5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV5"
FT                   /protein_id="ABF63061.1"
FT                   /translation="MIRNPIKWPNGARCACAITFDVDADSLIHIARPEDAHRRLYPISM
FT                   GRYGPNSGVPRILDTYRRLGLKQSFFMPGWVMERYPETVEAILAGGHEIGHHGYLHEDP
FT                   AEQNAEDQTYWFERALEVHRRLTGRTPRGYRAPVYNVTPEVLSLAVQHGLTYESSMMAD
FT                   DLPYRIDTPTGALYELPVHWGSDDWPPFAHFDEIGYKMPVMSPRRGLEASFEEFEAQYE
FT                   AGGLWIGIWHPFLTGRLARWRVVERWLEAVLARGDVWFAPLEEIAAYAASQEAEGLWQP
FT                   HREPAAPYANPVLMEKTHDQF"
FT   gene            334033..334734
FT                   /locus_tag="TM1040_0329"
FT   CDS_pept        334033..334734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63062"
FT                   /db_xref="GOA:Q1GJV4"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="PDB:3ORU"
FT                   /db_xref="PDB:3SIY"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV4"
FT                   /protein_id="ABF63062.1"
FT                   /translation="MTSFDRPFEAARPDGENPSAHETLAEGGRLRPEATYTIPARQGRA
FT                   IRMAQGEALMVINRDGSQIGDFWAFVEGDCGEYLSMEHLRPTLRRVSPRPGDVLVSNRR
FT                   RPILTLLEDSSPGVHDTLVASCDVHRYAQLGHEGYHDNCTDNLRMALGALGLRPTTVPC
FT                   PLNLWMNTPVVEGGAMEWRPPVSRRGDHVLFRAELDVVVVISCCPMDLLPINGEEAQPR
FT                   ALDVRLRPRPA"
FT   gene            complement(334809..335477)
FT                   /locus_tag="TM1040_0330"
FT   CDS_pept        complement(334809..335477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0330"
FT                   /product="(Acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63063"
FT                   /db_xref="GOA:Q1GJV3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV3"
FT                   /protein_id="ABF63063.1"
FT                   /translation="MPTLLRIDASAQLEERSLTRHLTDVFTKEFLAKAPDTKVITRDVG
FT                   REPIPAIDHKFIHAAFTPPEDREPWMAERLALSDELVDEVIAADILVLGAPMYNYGMPT
FT                   ALKGWIDHVARIGRTFSFDLARGDTPIEPILSGKRLVVLSSRGEFGFAPGGARAHLNAL
FT                   DPALAACAHYFGVAQADIETIAIEYQEFKDARHEASVASAETRTRARAADLAGAAVKAA
FT                   "
FT   gene            335647..336549
FT                   /locus_tag="TM1040_0331"
FT   CDS_pept        335647..336549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0331"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63064"
FT                   /db_xref="GOA:Q1GJV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV2"
FT                   /protein_id="ABF63064.1"
FT                   /translation="MRRLPPLHALRAFEAAARHLHFARAAAELHLTPTAISHQIRLLEE
FT                   ILGVKLFHRYPRPIRLSAEGAALYPVLREGFDRMADVIAALSAPDARRPLTVSVTVAFA
FT                   SLWLMRRLPALRNEAGLNLKVEADNQPVDLSGGDVDFAVRYARQPGPEGHWRALFEDRL
FT                   VPLCAPDLLCRHPVVRDADVLGLPLIAYRWSGGAEAAPSWHGWSRAAGLSQDVPEVSQH
FT                   FSEEIHAIDSAIAGQGVVLASSVLAAASVAAGQLKPLSTTSLPGRSFWAVARNDHPRLE
FT                   EVERFAAWARDSAEAPVAP"
FT   gene            complement(336588..337442)
FT                   /locus_tag="TM1040_0332"
FT   CDS_pept        complement(336588..337442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0332"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63065"
FT                   /db_xref="GOA:Q1GJV1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV1"
FT                   /protein_id="ABF63065.1"
FT                   /translation="MNKDRLPPLEWIRAFEAAARLGSFTAAAEELGLTQAAVSQRIGQL
FT                   EQLLGTPLFHRRARAISLTVEGEAWVPHVRLALEGLRDSTEAVFGTSRQRLTLSASQTV
FT                   IELWLLPRLARLQTLTNAEISVQSMVVGAHDAPQDDVIRIRYGSGNWPHAYRASLYKEE
FT                   IAPVAAPALVAGAPHWTGLPRIACAGPRPGWHAWAARFGIPTTPLPSLRFDTHLSALGA
FT                   AKAGLGVFLASLPLCAEALDSGALVRLSTASLPHHETYWMLTSPEGVSRDQWQALTQAI
FT                   TEI"
FT   gene            337542..338690
FT                   /locus_tag="TM1040_0333"
FT   CDS_pept        337542..338690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0333"
FT                   /product="Gamma-butyrobetaine2-oxoglutarate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63066"
FT                   /db_xref="GOA:Q1GJV0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJV0"
FT                   /protein_id="ABF63066.1"
FT                   /translation="MPTLSVDPSGTYLSLETATGTQRFHAIWLRDNAQDAETRAPGNGQ
FT                   RLIALRDIPADTRIATAQINPDGVVQVRFAPEDKTVDYDLAWLEAHSYDRAAPSTQGWL
FT                   AQEIEPWDAGLMGNVPCGDFAALAEGGQALRDWLGQIVRYGFAKLKNAPVEPGGLFKVV
FT                   DLFGFVRETNYGRHFEVRTEVNPTNLAFTGLGLQAHTDNPYRDPVPTLQVLYCLESSAA
FT                   GGENMVVDGFAAALRLREEDPEGFALLATHCAKFEYAGEASVCLTSRRPMIELAPDGEL
FT                   IGIRFNNRSCATITDVPFDKMEAYYAAYRRLGEIIDDTAMEVTFRLEPGEAFVVDNTRV
FT                   LHARKGYSGEGTRWLQGCYADKDGLRSAYHAMMRDARVEAAE"
FT   gene            338687..339277
FT                   /locus_tag="TM1040_0334"
FT   CDS_pept        338687..339277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63067"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU9"
FT                   /protein_id="ABF63067.1"
FT                   /translation="MKPDIDSLNRETIVAFIGSIFDRRGDEEYLGEPVTMGEHMLQGAT
FT                   IAERNGQPEEIIVGALLHDIGHFTSEFGTFTMDDTEDRHHEDAGAEVLERFFPSVVTDC
FT                   CRYHVAAKRYLCATRPEYFKRLSDASVHSLNLQGGPMSPEEVSAFEQNPNLKQIIAVRY
FT                   LDEAGKVAGMETPDFWHFAPMVQRMVDRHLSAV"
FT   gene            complement(339509..339937)
FT                   /locus_tag="TM1040_0335"
FT   CDS_pept        complement(339509..339937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63068"
FT                   /db_xref="GOA:Q1GJU8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU8"
FT                   /protein_id="ABF63068.1"
FT                   /translation="MIALLGLFFAAFLAATLIPAQSEAVLVGLLLSGGHSALLLVMTAT
FT                   LGNVLGSVVNWVLGRFLTAYADRRWFPVSEQQLSRAAGWYRRWGYWSLLGSWLPIVGDP
FT                   LTLAAGVMKEPLWRFLLIVTLSKGGRYVVLAMATQGFL"
FT   gene            complement(339939..341264)
FT                   /locus_tag="TM1040_0336"
FT   CDS_pept        complement(339939..341264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0336"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63069"
FT                   /db_xref="GOA:Q1GJU7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU7"
FT                   /protein_id="ABF63069.1"
FT                   /translation="MLSILADRTYRHLFLAQVVALLGTGLSTVALGLLAYDLAGNSAAM
FT                   VLGTVFTLKMVAYVGIAPVAGAFADSVNRRQLLVILDLVRAGVAIALPFVTEIWQVYVL
FT                   IFLLQSASAAFTPTFQATLPDVLPEEERYTRALSLSRLAYDLENIISPTLAALLLTVMA
FT                   YNTLFLGTAIGFLGSALLVVSVLLPSPKPSTRRGIYARTTRGIRIYLATPRLRGLLCLN
FT                   LAVASAGAMVLVNSVVLIRGELGLSESALAWTLFAFGAGSMLASLALPRVLDTLKDRPV
FT                   MIAGATLMVGALLGLAAVIALADLSWAGVLVAWFLVGIGYSSTQTPSGRLLRRSAHAED
FT                   RPAIFAAQFALSHACWLLTYPLSGWLMTGLGPLPALVVLAALSGLGILACLRLWPKNAP
FT                   DVILHDHEDLPADHPHMRQFGTTPHQHAIIIDDLHRHWPTQG"
FT   gene            341517..341957
FT                   /gene="aroQ"
FT                   /locus_tag="TM1040_0337"
FT   CDS_pept        341517..341957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="TM1040_0337"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63070"
FT                   /db_xref="GOA:Q1GJU6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJU6"
FT                   /protein_id="ABF63070.1"
FT                   /translation="MTQTVYILNGPNLNLLGTREPEIYGRETLADIEARCRTLCEGHGF
FT                   ELMFLQSNHEGQLVDWIQEARTSACGIIINPAAYTHTSVAIRDALSACEMPIFEVHLSN
FT                   VHAREAFRHHSYVSAIATGVIAGFGSFGYVAALEKLAQDVGA"
FT   gene            342242..343732
FT                   /locus_tag="TM1040_0338"
FT   CDS_pept        342242..343732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0338"
FT                   /product="NCS1 nucleoside transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63071"
FT                   /db_xref="GOA:Q1GJU5"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU5"
FT                   /protein_id="ABF63071.1"
FT                   /translation="MTDITSGYAASEGAAHAQLDRARLDPELYNEDQLPTTAAERTWNW
FT                   LSISALWVGMVVCIPTYLLASYLIGAGMSWDQAVLTILAANAIVLIPMVLVGHAGTKYG
FT                   IPFPVLLRASFGPVGAKIPAVARGIVACGWFGIQTWVGGSAIFVIVNKLTGGALAAEAL
FT                   PLLGISLGEFVCFLAFWGLHLYFIKNGTESIRWLETYAAPFLLAMGLALLAWAYSAAGG
FT                   FGEMLSTPSAFDVGQPKEGQFWAVFWPSLTGMIGYWATLALNIPDFTRHARSQKDQLVG
FT                   QMVGLPIPMALFAFIASAVTSATVVIFGEAIWDPVQLSERMGGSAVIIALFALIVATLT
FT                   TNLAANVVAPAHGFANLAPSKINLKRGGYITAAIGIAMFPWILVNHIVGWLIAYSALLG
FT                   PIAGVMLADYYLLRKTRLEVADLFKSNGIYAGHNGTNWAGVLALVIGILPNLPGFLAGV
FT                   GLTDGTSPFFAMIYTYAWFVGLFVAGAAYLLLSKMVNK"
FT   gene            343924..344769
FT                   /locus_tag="TM1040_0339"
FT   CDS_pept        343924..344769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63072"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU4"
FT                   /protein_id="ABF63072.1"
FT                   /translation="MQQLKQRQDFTARSAHTSRTETSRSPTQIKTISTSGNIKLALKSR
FT                   PDAEGPADAANLPPKAQPKALSAGPRQDAPTASEHAFGSGGDFGGQPRGAGFLSDERFA
FT                   KPALAAAALAGLLILGATTFALLPETEVPVEVSQTAAGTATPGPSDNLARLMQVAAVNP
FT                   SPASAEVAPAADTPAMAAAATGAGDDIMSKMTASTLAALRSPAPTAAAQTDTGGRAPQA
FT                   GGGALYQLVMTAHAQGQSPAYIDQMLNAAYQRGQISVPEGLVRADGRVDTTTILSLFIH
FT                   "
FT   gene            344893..345972
FT                   /locus_tag="TM1040_0340"
FT   CDS_pept        344893..345972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0340"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63073"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU3"
FT                   /protein_id="ABF63073.1"
FT                   /translation="MRRLIAAAVLGVSALWAQASAAQTCGGMYTVQPGDSLSVIADRLY
FT                   KNAGMWTAIHNRNIAAIGPKPGSIRVGMRLEITCLNGLPVGLEGGRALSASAPTEATPV
FT                   QIVAGNATVRQKINLLTGDDFEPFTGKSLHNGGLLTDLVNAAMTEANPAQGFAIHWVDH
FT                   WAAHFDPLLSNALLDIGFPWYKPNCAELPDNYRCQNLLFSDPLFETLTLMFADAARPVS
FT                   FGSDEDLYGKSICRPKGYDTSIFNENGRNWLREDKITLVVGATPGDCFDMVLEGKADGV
FT                   VLNEFTGRDKMKEMGIVERIQVVPQPISIQSHHVVVHKSHPQAQELLAIVNTGLRGIRE
FT                   DGSYQAIVEDHLARVWAGF"
FT   gene            345984..347057
FT                   /locus_tag="TM1040_0341"
FT   CDS_pept        345984..347057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63074"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU2"
FT                   /protein_id="ABF63074.1"
FT                   /translation="MQRDLAFWIGRLLLVVGLLSGVAPSAARAICDVDYVAQPGDNLFT
FT                   IAEAHYGDRDRWTVIYYRNQGELAGPSVIPGRTLFIPCPPNMPIESAPADAVVTQETTP
FT                   APTVQPAAELNLLTGGQYAPFTDPDLPEQGLITELVRAALEVAPSPVPYAIGWDNDWSQ
FT                   HLSPKLESKQFDMGFPWAKPDCAADPSAVRCMRYHYSDPLMEVPVMLFVRSGGGMVYGS
FT                   DADVIGKTLCRPLREDVFDLDTAARRWISDDKVTLVQPAAAGDCLRMVADGRVDAAALN
FT                   LFVGASALVAEGLRGRVEPLEKPLSQVSLHVIISKTHWRGTSHLYRMNAGLRHLRESGR
FT                   YDEIVSRHMELFWSGLQ"
FT   gene            347255..349738
FT                   /gene="arcB"
FT                   /locus_tag="TM1040_0342"
FT   CDS_pept        347255..349738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="TM1040_0342"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63075"
FT                   /db_xref="GOA:Q1GJU1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJU1"
FT                   /protein_id="ABF63075.1"
FT                   /translation="MRDWLQSFFVALGNRTYLPTWIALFVVGIAFAYAERQNQIINDQE
FT                   LRAEVQAEVGLIRSHLEGKLTADVQLIKGLVGALMAEQLMTQETFNEVASYAAGDRHEI
FT                   LNIAIAPDLVVTMVYPYERNKAVLGLDYNKNEAQREAVMRMRDSGEIVLAGPVNLVQGG
FT                   TGFIIRYPVFAGEGADRRFWGMVAAVIDADALYAEAGLAAEDLPIEIALSGRDGTGHQG
FT                   GVFYGDQNIHDHDPIVTDVFLPTGTWELAAIPRGGWPKQPGNLLELRLVLLAAGILIIV
FT                   PTFMACRLSAVRRATINTLRKRETELERNQAELEQLSTVAQNASDSIVLSGPDQRIFWV
FT                   NEAFSRMTGYTVDEAVGKRPGELLNGPETDPATIREISEYISRGERLHREILNYTKSGK
FT                   TIWVDTNLVPVLDEDGEINMVIGIERDVTSQKQNAAELAVAKVAAEQADRTKTEFLANM
FT                   SHEIRTPMNGIIGMADLLSETELHEDQEQYVQIIRTSSKALLKIINDILDLTRMESGKL
FT                   SLEPVDFDLESCIENAVDILRPVASEKGLDLTVNYASGLPRTVRADDGRLRQILVNLVG
FT                   NAVKFTASGRVDVRVLCASTNPYRLTIDVQDTGIGMTSAQLHNIFDRFSQADAATTRSF
FT                   GGTGLGLTISRLLAKQMDGDITVYSDPGRGSCFSLHIQCQAPLGLPGHIDADEAPDLDL
FT                   IYGCKVLLAEDNRTNRLLIRKYLSDLSVDLIEASNGQEAVELCAHHRPDLILMDMSMPE
FT                   MDGLTATRLIRMPQNPHQPPIVALTANAFASDREACLAAGMNGFLSKPINKRELLHGMA
FT                   GVLDDPDNLRRVASG"
FT   gene            complement(349883..350665)
FT                   /locus_tag="TM1040_0343"
FT   CDS_pept        complement(349883..350665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0343"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63076"
FT                   /db_xref="GOA:Q1GJU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJU0"
FT                   /protein_id="ABF63076.1"
FT                   /translation="MTLHAQQISLSIGKKQILKDVTFAARAGALSAIVGPNGSGKSTLL
FT                   KALVAELPSEGQISLNGRLLQDYAAWELASLRGVLPQAAHLAFPFTVLEVVRLGLMAGP
FT                   EAQNTRLPFEALARVDLEGYAGRSYQELSGGEQQRVQLARVLAQVGAPMREGQPCWLFL
FT                   DEPVSSLDIAHQLTVMDIARQFADGGGGVVAVMHDLNLTAMYADHVHVMTGGETAGAGT
FT                   VADVLTDQRLSEVYGCDLRIGKVPADAAVFVLPQTARA"
FT   gene            complement(350662..351750)
FT                   /locus_tag="TM1040_0344"
FT   CDS_pept        complement(350662..351750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0344"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63077"
FT                   /db_xref="GOA:Q1GJT9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT9"
FT                   /protein_id="ABF63077.1"
FT                   /translation="MVALSDPSPGPYARDIRQLDRRILARRLSVVLVVLLALAIVVNLA
FT                   LGASGTSLWGALGKLLSGQDLSTMERVVLWDIRLPRVLLCVLVGAALAVSGAVMQGLFR
FT                   NPLADPGLVGVGAGAGLGAILSIVLGGLLPVGVQGLFGHYVTPAAAFVGGWGSTLILYR
FT                   VSTRAGRTSVATMLLAGIALGALAGAVSGILVYMADDNQLRDLTFWQMGSLAGATWEKS
FT                   MIAGPVIVIAIAGATWLAHGLNCLALGEAAAAHMGISVQRMKNAAIFSVAAATGVAVAA
FT                   TGGIGFVGIVVPHVLRLATGPDHGTLLPNAALLGATLLLGADLISRTIIAPAELPIGIV
FT                   TAVLGAPVFLWILLKRRGMVDQ"
FT   gene            complement(351754..352602)
FT                   /locus_tag="TM1040_0345"
FT   CDS_pept        complement(351754..352602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0345"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63078"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT8"
FT                   /protein_id="ABF63078.1"
FT                   /translation="MRHLLLVATATASLMTAPVAQAADRILSIGGSVTEIIYALGAEDK
FT                   IVARDTTSSYPAEAEALPDVGYMRALAPEGVLSVNPNLIVSEAGAGPAETLAVLKQADI
FT                   TFVEVPDDFSAQGIVDKINAVGAAIGEPDAAATLADKVEGELVAVAERVARLPDSERKR
FT                   VLFVLSTRGGRIMASGTNTAADGIIALAGGVNALSEFEGYKLMTDEAVTRAQPDVILMM
FT                   DRGGDHGMPDETLLALPAIVTTPAAETGSVVRMNGLYLLGFGPRTADAALTLARALYGE
FT                   I"
FT   gene            complement(352602..353681)
FT                   /locus_tag="TM1040_0346"
FT   CDS_pept        complement(352602..353681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0346"
FT                   /product="Haemin-degrading"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63079"
FT                   /db_xref="GOA:Q1GJT7"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT7"
FT                   /protein_id="ABF63079.1"
FT                   /translation="MDQAHSPSANAQSALSPQVIRDLRAEHNALRARDFCDRFQIREAQ
FT                   LLAAYTGRGVTRLHAHPDAVMPQIERLGEVMALTRNASCVHERVGVYGNYKSGPHAAMI
FT                   LQPEIDLRLFPSHWIHAFALNEDTDTGPKRSIQIFDAAGDAVHKIHLRETSDHAAWDEV
FT                   VAALASGDTSDVLEVAARKPVEAPKSNPAKCEVLRDEWRKMTDTHQFLRLTSKLKMNRL
FT                   GAYRIVGAPFVERVPPEAVDAALQALAKSKTEIMLFVGNRGCIQIHSGPIETLRAMGPW
FT                   QNVMDPRFNLHLRLDHIKEVYVVNKPTQRGPALSLEAFDGEGNIILQIFGRNAEARDSR
FT                   PAWADILSTLPRLHTEETV"
FT   gene            353932..355944
FT                   /locus_tag="TM1040_0347"
FT   CDS_pept        353932..355944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0347"
FT                   /product="TonB-dependent receptor plug"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63080"
FT                   /db_xref="GOA:Q1GJT6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT6"
FT                   /protein_id="ABF63080.1"
FT                   /translation="MQIKDMRGVLLCSASAMALALSAPVAKAQDVSEEDGFLGLLVLGN
FT                   NKREVQTDTAAPETVINAEEIQDRQASSIAELIDSVPGVALVNSGTPTGAGINIRGHGA
FT                   DGTYGANQKVQIQIDGASVGSEELYRIGTQLTTDPELYREVSVIRGTVGSFEYGSGVIG
FT                   GVVRLDTINASDLTDGQVGLSGRQTLGYHGNSNARISSTILGWQPTENLEFLFNYTRRE
FT                   QDDYTDGNGDVVSDTASEVSSLLLKGKYSFGDNAAQSLTLSFNESTSDEKDVPYDAFAG
FT                   NAAFGNVDRLTETKSAVLEYAYNPLGNDLVDLTATLSYADQYIEQEQVSGTPFGIQDAD
FT                   HRYETTKLTVKNSALFQAFGAKHTLRAGAEILRKERLNAASAPGGTDQRLALFAIDELD
FT                   FDNGLTVTPALRYERQEIEASTDGNNIRAGETFNNSALMGGVSARYAFQNGFAVFGSVA
FT                   YTAGFPIIDDVDYADYPTLMTQTEKAVTHEIGASFDRVGVFASDDVVMAKVNLWQTRLW
FT                   DYTSSGSSFAEFDRQDTKGVEIEASYSHMSGFYVDMNANISSGHWTKFQSGTNERYRER
FT                   YDGMPPTNLALTLGKKFNEQLDVSWEGAFFKRFEDTPGFAVHNLRASYDIDTGFLKEAK
FT                   LRVGVDNLFDKQYQTHLATRPAPGRNIKVSLTAAF"
FT   gene            355964..356425
FT                   /locus_tag="TM1040_0348"
FT   CDS_pept        355964..356425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63081"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT5"
FT                   /protein_id="ABF63081.1"
FT                   /translation="MMIQSQVYKAVCALAVLTSLGGAAMAQDTATPPTAVPSPVGVAIE
FT                   LNALQDQAGACRLSFMAQNKAQIAIETAVYEAVLFDRAGEVMLLTLFDFRELPAGRPRV
FT                   RQFDVAGVACADLGRVLINGASQCQSSGDGDLCEAGLGLSSRTEVELLG"
FT   gene            356422..357102
FT                   /locus_tag="TM1040_0349"
FT   CDS_pept        356422..357102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0349"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63082"
FT                   /db_xref="GOA:Q1GJT4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT4"
FT                   /protein_id="ABF63082.1"
FT                   /translation="MSEIREFWTAIKASLLEVVEIGGPVVVVLIGLSIVSAATVLYKLW
FT                   QFRRSGVGRHRSISMALEAYERGDAKTARALLAQSSSYLVAPLQRAMQGGAGPDHARQS
FT                   DRCDAEAEALFSRLETGLGFLDLVAQLAPLIGLFGTVLGMIEAFQGLQAAGTSVDPTVL
FT                   AGGIWVALLTTAAGLAVAMPVAAVHGWLSAAVERDRVFANHALRRVFAPDALTPVQLSP
FT                   KEAA"
FT   gene            357102..357494
FT                   /locus_tag="TM1040_0350"
FT   CDS_pept        357102..357494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0350"
FT                   /product="biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63083"
FT                   /db_xref="GOA:Q1GJT3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT3"
FT                   /protein_id="ABF63083.1"
FT                   /translation="MALRLGCKKRRRLSMTSLIDVIFLLLLFFMLSSTFSRFGSVDLMA
FT                   ANAGSGRSDETRPVFLKLAPTQMSLNGEALALEGLGMRLDALRAQRQGTPHQLLLSLSG
FT                   AVTSQRLVDVLAVLRRQPDLAVTVVE"
FT   gene            357498..357893
FT                   /locus_tag="TM1040_0351"
FT   CDS_pept        357498..357893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63084"
FT                   /db_xref="GOA:Q1GJT2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT2"
FT                   /protein_id="ABF63084.1"
FT                   /translation="MPIERRTKKSHREPTIALINVVFLMLVFFMVAGSLAPSLDPTVRL
FT                   VQASELEAAPPPDALVIRADGSLHFRGAELTSPEAYVRIIWEEEDAFTARLVPDRALPA
FT                   STLLTIAKELRRLGAERVTLLSEQSLT"
FT   gene            357890..358804
FT                   /locus_tag="TM1040_0352"
FT   CDS_pept        357890..358804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0352"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63085"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT1"
FT                   /protein_id="ABF63085.1"
FT                   /translation="MIARSPLIACVSLFCALAAHAALLVDLEETAVEIEGGDTQAPAAL
FT                   GSSFADLVQGTATTVEADATRHTTPVDPVPPAPTTQVSATPIAPVSTPASAPRSAAVSA
FT                   PVMPAVPPVTEASPSPIAAAVAPVEAPAREVQPDQAEALDTASELAPQESPRPLRRPEA
FT                   APQARDKAETQAPAAPAPRGNSTVNARAGSETGAEQQRASQAASTRPAAGSGAGNAAAS
FT                   NYPGQVMRKISRVRKPRTSVRGVAHVSFVIGSGGQLASVRIRKSSGSTELDQLALQQIR
FT                   RAAPFPPPPVGARTQYSIAIKGR"
FT   gene            complement(358801..359538)
FT                   /locus_tag="TM1040_0353"
FT   CDS_pept        complement(358801..359538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63086"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJT0"
FT                   /protein_id="ABF63086.1"
FT                   /translation="MQRGGKTVYGASIGVLMLETRFPRIPGDIGHAESFDFPMQYRVVR
FT                   GATPDRAVRQDPRALVEDFIAAGRDLVDMGCDGITTTCGYLSLIQDQIKDALGVPVAAS
FT                   SLMQVPMVQALLPAGQRVGILTVSRPALTEAHLAAAGVAADTPVVGTEEGRAFCDGFLN
FT                   DRLEIDIEACRADLLGAAQQLCTTHPEVGAIVLECTNMVPFAYDIRRATGLPVYSIESF
FT                   LKWFQAGLMPRRFQSELADPRWR"
FT   gene            complement(359541..360473)
FT                   /locus_tag="TM1040_0354"
FT   CDS_pept        complement(359541..360473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0354"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63087"
FT                   /db_xref="GOA:Q1GJS9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS9"
FT                   /protein_id="ABF63087.1"
FT                   /translation="MKLRFRQLQAFHAIVETGTVTGAAGLLGISQPGVSNLLSQLEDQA
FT                   GMALFERLHGRLLPTPEAELLFAEVDTVMRGMSKVTQTMVDLKTRKLGQLQIASQHAMS
FT                   FGFMPRLIARFASDRPELNISFQSQYSSKVQEWVWNGLFEIGVCEMPLLYDTLTVYPLY
FT                   VETMLALHKDNPLARHEVLTPELLAGEPFIVMGQDHMTHRRLREAFQDAGVPLRTRVHS
FT                   HLFKNLLSFVQEGMGVALLDRFMFDYDMQGDVITRPFRPTIRMDMCVITSKSRPMSQLG
FT                   KEFLDLLLGELQHYSVEGRPLVPAERKRR"
FT   gene            360576..361823
FT                   /locus_tag="TM1040_0355"
FT   CDS_pept        360576..361823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0355"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63088"
FT                   /db_xref="GOA:Q1GJS8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS8"
FT                   /protein_id="ABF63088.1"
FT                   /translation="MATQHIVVVGAGIMGAASAIWLRRAGLEVTLVDKGRPGMGASYGN
FT                   ACILARCAMVPVTTPGLIAKGPKYLLDPNFPLYLRWSYLPRLLPWLGRYLKHANDQDTR
FT                   RISQGLAGIVGDSVEQHKALTEGMPAAKWIQDSDYNFVYRDRAAFEAESYVWSLRREAG
FT                   FEPEIIEGDDVHAREPILSRDMRLLAVNKDHGYILNPGNYVQDLVRQLEEMGGRFVQAE
FT                   VKDFDLMGGQITAVDTDQGRIACDRAVLSAGVWSAALMKRLGLDVPLEAERGYHIVFKD
FT                   PSQLPTAPMMLTEGKFVATPMDQGLRCAGIVEFGGLSDVKSKKPLEMLRRTVARTFPNL
FT                   SHSAEEEWLGFRPAPSDSLPLIGEVRGSGVFTAFGHHHIGLTGGPKTGRLVADMITGNW
FT                   PNADTSAFDPMRFATQ"
FT   gene            361863..362840
FT                   /locus_tag="TM1040_0356"
FT   CDS_pept        361863..362840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0356"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63089"
FT                   /db_xref="GOA:Q1GJS7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS7"
FT                   /protein_id="ABF63089.1"
FT                   /translation="MTKMTLKTTVAGAALVLAAGVAQAEKWDMPMAYAASNYHSEMGVV
FT                   FADKVRDYTGGEIDITVHPGGSLFKGGEIKRAVQTGQAPIGERFMSAHANEEPLLGWDN
FT                   LPFLATTYAENDKLWSVAKDKVNAALADQNLVTLYTCPWPGQGFYFNKEVTSSEDTQGV
FT                   KFRSYNTATATFAEELGMIPVQVEAAELSQALATGVAEAFISSGSTGYDRKVWEQLSHY
FT                   YKVNAWLPRNYVMVNKQVWDGLSAETQGAIQKAADETGAACAAKSEELANWYFEQLEAN
FT                   GMTVADAGPEFLAELQAIGAKMTDDWLASAGEDGQAIVDAFKAN"
FT   gene            363053..363667
FT                   /locus_tag="TM1040_0357"
FT   CDS_pept        363053..363667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63090"
FT                   /db_xref="GOA:Q1GJS6"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS6"
FT                   /protein_id="ABF63090.1"
FT                   /translation="MRRVLRPWWAFLDRIYNGAGVVAAVFMVTILLLIVGQMIARWASL
FT                   TFPGSTEYAGYAMAATSFFALAYTLTHGGHIRVSIFLNIGGRHHFWLDAGAMLISALTA
FT                   TYFARYAIKTNLLSHMLNDRTQGQDYAPEWLLTLVSMFGTWPWNWGQLWAESGSGWVYT
FT                   PVWLPQLPMSIGTVLLAIALWDYLSRMLVTGAPQIKGEALE"
FT   gene            363664..364962
FT                   /locus_tag="TM1040_0358"
FT   CDS_pept        363664..364962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0358"
FT                   /product="TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63091"
FT                   /db_xref="GOA:Q1GJS5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS5"
FT                   /protein_id="ABF63091.1"
FT                   /translation="MSEIYTTVIFLFVLFALLGGSVWIGLALMGVAWVGMELFTTRPAG
FT                   DAMITTIWSGASSWTLTALPLFIWMGEILYRTRLSEDMFRGLAPWMRFLPGGLLHTNIA
FT                   GCTIFAAVSGSSAATLNMVGKMSIPELRARGYPEYMIIGTLAGAATLGLMIPPSLTLIV
FT                   YGVTINESITKLFMAGVFPGLVLAGLFMLYIVGWHFFGPGERPKPEPRLTFGERIAESR
FT                   FLLPLFGLVFVVIGSMYMGFATATEAAAVGVLGALGLSLMQGSLSWGTFVESLMGATRT
FT                   SAMIAFILMGAAFLSLSMGFTGLPRALAGMIESYNLSPIALIAVLTVFYLILGMFMDGL
FT                   SSVVLTMAIVEPMIRQAGIDVIWFGIFLVVVIETAQVTPPIGFNLFVLQGMTRHEISYI
FT                   AKTAVPMVALMLLMVVILVVWPELATWLPNNIR"
FT   gene            365386..368169
FT                   /gene="mcpI"
FT                   /locus_tag="TM1040_0359"
FT   CDS_pept        365386..368169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpI"
FT                   /locus_tag="TM1040_0359"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63092"
FT                   /db_xref="GOA:Q1GJS4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS4"
FT                   /protein_id="ABF63092.1"
FT                   /translation="MPKLKTSSSIKRPGFGVFRSIRAKMSLILFVMGASFCVFAYMIHT
FT                   VLSGIDRDMTTLNSKDLPGLELAGEISLASEQAKNTMLSLISATEVSVIDTASREAEAA
FT                   AEHMMQLIGQLDAEMQPVFEAQATQVAGALSDLADARRDALNSEAQIEAEIEAFNIIVN
FT                   DLGELMTGLVQAASVELNRGAANTYDAIDKSLKLLVERDFHNLELLLEARAELNLLAGA
FT                   AVAFGGTKDKETIARLQALADSSDARLQEISEEIEANAPEMLDVSLIHSALFTLQSVIA
FT                   QSLFPSESLRQAAMKSRADTDRFIVMAIDAQLLKLSASAARTSKENGDTLRELMTNEVG
FT                   FLNVLMEISQHLNSFQVAALDVLTASDEQQVKDAAFSLSQASRNLANYTDFQDPLVVEL
FT                   LSRVAAFAEEEAGLAALRMNELSARAAAQEATQKTEATVLEIADRASEFAAQTLGVIRT
FT                   MSSDISGEVATASRNMVISLAMAAGVFLTALLVTQLLILRPLNRISASTERLAEGDRSP
FT                   VTGFERTSTEIYRIARSLSVFRDGIVEKEELEEMAAAERQERERVQAKAVEALGTGLER
FT                   LSSGDLTGHIHEELGEGYDRLRLDFNRTLDTLNDTVGQVIDTSASIRNGASEISQASQD
FT                   LSHRTESQAATLEETAAALDEMTASVTSAAEGARDVERTSNEARSEAEASGDIVRSAVS
FT                   AMTEIEQSSGKIAQIISVIDDIAFQTNLLALNAGVEAARAGEAGRGFAVVASEVRGLAQ
FT                   RSSDAALEIKNLISDSSKQVERGVDLVGKAGEALDNILNRVSHVSELISGIATGAQEQS
FT                   TGLLEINTGMNQLDQVTQQNAAMVEEATAASQLLNTDAETLADLVARFQTANTARTPAA
FT                   GAGDVGEDAGSEALAPTSWGDAQDIEWEATEVEEPFVPEQTDWSDFDGDDTQATGT"
FT   gene            368350..370440
FT                   /locus_tag="TM1040_0360"
FT   CDS_pept        368350..370440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0360"
FT                   /product="short chain enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63093"
FT                   /db_xref="GOA:Q1GJS3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS3"
FT                   /protein_id="ABF63093.1"
FT                   /translation="MSDPVLLEITDDIAVIAIANPPVNALSHSVRQGLDAAFDEIARRD
FT                   DVKAAVIYGTDRTFIAGADIREFGKPPQEPFLPDLINRIEACAVPVVAALHGTALGGGL
FT                   EVALGAHYRIAVPSARFGLPEVTLGILPGAGGTQRLPRLAGVEFALEAITSGRQIGAEE
FT                   ALAAGVIDRISDTADIREMGLSYARELIASGAQPRRTSDIAPEPVSPDVFEQARAKLAK
FT                   KARGQLAPQNCVKAVEGALSLPFAEGLANERALFQELMESDQRAALIHAFFAERQVAKV
FT                   PEINGVEPRAISRIGVIGGGTMGAGIAVSALLAGLQVTLIERDAEAVSRAETNVAKILQ
FT                   GSVKRGKLTQEKFDAIMREAFEASAEYATLATADVVIEAVFESMEVKKEVFTKLDAICK
FT                   PGAVLASNTSYLDVNEIAAMTTRPQDVIGLHFFSPAHVMRLLEIVVADETAPDVTATGF
FT                   ALAKRLKKVAVRAGVCDGFIGNRILSHYRKAGDGAVLAGASPFEVDRALVNFGLAMGPY
FT                   AVSDLAGLDIGWATRKRLAPTRDPREVYAEFVDRLCEAGHLGRKTGKGFYVYDDGGQTP
FT                   NAEVLDHIAEERAAKGIAAREIPEQEIVDRYMAAMINEAARVVEEGIALRPLDVDVTLL
FT                   NGYGFPRWRGGPMQYADTVGLEKVLADIERFAQEDDFLWQPAPLLKRLVAEGKTFADLN
FT                   NA"
FT   gene            370462..371640
FT                   /locus_tag="TM1040_0361"
FT   CDS_pept        370462..371640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0361"
FT                   /product="Acetyl-CoA C-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63094"
FT                   /db_xref="GOA:Q1GJS2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS2"
FT                   /protein_id="ABF63094.1"
FT                   /translation="MKQAVIVSTARTGLAKSYRGAFNDTHGAQMAGHAIEHAVARSKVD
FT                   PALIEDAFIGCGYPEGWTGGNIARQAVVRAGLPVTVAAATVNRFCSSGLQALAMASHAV
FT                   TMEGASAAIAGGVESISQMPPSRPAQRRDAWIEANKPDVYMTMIETADVVAKRYGVSRE
FT                   AQDELALQSQMRTAAAQAAGKFDDEIVPITVTQKLTDKETKEVSYKEVAFAMDDCNRPG
FT                   TTLEGLAGLKPVRGEEHFVTAGNASQLSDGAAALVVMDADLAAKQGLEPLGALKGFVTA
FT                   GCEPDEMGIGPVFAVPRLLERHGLKVSDIDLWELNEAFASQALYCRDRLEIDPEICNVN
FT                   GGSISIGHPFGMTGARMSGHLLLEGKRRGAKLGVVTMCIGGGQGAAGLFEIF"
FT   gene            371829..372626
FT                   /locus_tag="TM1040_0362"
FT   CDS_pept        371829..372626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0362"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63095"
FT                   /db_xref="GOA:Q1GJS1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS1"
FT                   /protein_id="ABF63095.1"
FT                   /translation="MMRDLEQDRRYANTLARGLKILRAFRPSDNGLGNLEISERTGIPR
FT                   STVSRLTFTLCALGYLTHGRHFDKYRLGPAALALGNIASAAFGFVTVAAPIMQELANKV
FT                   NALVGVAIQDDGTMLIVKTWRPEGSGAIWLDVGYRMPVLTSSSGVAYLGALTQEEREKL
FT                   EALLPEEGAEICEEVWQHQSAQLRRVGYACVAEDMRYSRAIHAVATPFRPSEIGEPVSI
FT                   FCGANVDDLSTEQMHVEVGPELVKAVNRLKLLTGHAVSAVASA"
FT   gene            372959..373921
FT                   /locus_tag="TM1040_0363"
FT   CDS_pept        372959..373921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0363"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63096"
FT                   /db_xref="GOA:Q1GJS0"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJS0"
FT                   /protein_id="ABF63096.1"
FT                   /translation="MWNLIADVGGTNMRLAAVNAEGEILEQARYDSKGTQNLEEACADF
FT                   AAHRGSAPGRAVIAAAGVVRGGSVQLTNANQSFSERGIAVALQTERVKVLNDFEAAAWS
FT                   LASVSAGDVTVLQGQAVFPKEPCLIIGPGTGLGVGALIWANGEPCVVPGEGGHVAIGPR
FT                   TADEVAIFEALREEWPEIGMGPGLAVEAEGILSGTGLPYFYRAVARSMELTAPLTTGAE
FT                   IFQSAQARLDTAAVRAVSLFAQYLAGVAGDLGLVFAAKGGVFVTGGVAAANPWIFDAAF
FT                   VEAFNAGGRHTAWREELPLHLYHQPNFGLIGARNYLRAR"
FT   gene            374058..374852
FT                   /locus_tag="TM1040_0364"
FT   CDS_pept        374058..374852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63097"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR9"
FT                   /protein_id="ABF63097.1"
FT                   /translation="MTDSTLPSPQIFTFRGQPVIRDGELAELFSYTTGNLNKLVNNNAD
FT                   RFGEDFAFRLTDEEFAELKFQLGISKTHGGLRHPPMMYTEHGAVMAATLMRSPRAAEAS
FT                   RFVVRSFVAARRGLMAKAQGQNLPLSLPVNDLVPIAGRERSGLVGKLDAALGRVLDAIA
FT                   DPVQETTVRDEARQIALEGLSAIKAHLKKQDIANEKTLAEVQKLLKEAEAIDAEISARH
FT                   IENNHRQMAYLAKQLRIVIEVQRYLDQGDVDTLLAVLKDLGT"
FT   gene            complement(374933..375625)
FT                   /locus_tag="TM1040_0365"
FT   CDS_pept        complement(374933..375625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0365"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63098"
FT                   /db_xref="GOA:Q1GJR8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR8"
FT                   /protein_id="ABF63098.1"
FT                   /translation="MALSHPNPPEQALREAILNAGASPDGRLPPERILAAQLSISRTQL
FT                   RGILDAMARDGLIFRRHGQGTFLQPPPVQAAERLSTLAKRVTPRDLMEVRLDLEPALAA
FT                   HAARRGSAKDKARLLQLMEHSLAADDIERYEHADDLFHYKIAEMAGNPLFLSLFEEIRT
FT                   LRRAGDWQRTRRAALTGDDIARLPALHRDIAQSICAGSAEDARAAMRQHLQQVSGALRR
FT                   GDAASGES"
FT   gene            complement(375616..376452)
FT                   /locus_tag="TM1040_0366"
FT   CDS_pept        complement(375616..376452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0366"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63099"
FT                   /db_xref="GOA:Q1GJR7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR7"
FT                   /protein_id="ABF63099.1"
FT                   /translation="MLEFQTLLPLLGVAAGAGVAGGILAGLLGVGGGIVIVPALYFALG
FT                   LTGMDPALTMQVAVGTSLATIVFTALSSGYGHYKKGAIDMALLKLWAPSILGGVVIGGV
FT                   LGGLVSGIVLLVVFATIAMAVALDLMLRKPNDSPEPRSFSKPVWAALGVFAGSVSAMMG
FT                   IGGGTVCVPTLSFLGYDIRKAVGTSAAIGFIIGLPGAVIYMATGFGAEGLPPLSLGYVN
FT                   LLLAAVIIPLSTTFARVGVKLAHSIPRRALKLSFGVFLMATSLRMFADLAEQMGWL"
FT   gene            complement(376581..377822)
FT                   /locus_tag="TM1040_0367"
FT   CDS_pept        complement(376581..377822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0367"
FT                   /product="ROK domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63100"
FT                   /db_xref="GOA:Q1GJR6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR6"
FT                   /protein_id="ABF63100.1"
FT                   /translation="MQALASNAGGAHRPVMPDPRPYSTGASQSELRAYNERLLLTLLHQ
FT                   GGALPGSEMARRTGLSSQTVSVILRKLEQDGLVLRGESQKGRVGKPSVPMGINPEGLFS
FT                   FGVKIGRRSTDLVLTDFRGGLRAERQLRYAYPQPDDVFEFIKTGIEDISADLSAEQQAR
FT                   ICGIGVATPFDLWRWHAQVGAPKSSLTAWRALDPTIEIARFSPLRVFVINDATAACRAE
FT                   HMFGASSRWRDSIYFFIAAFIGGGVVLNHSVYEGGMGNAGALGPLPSQRADGSNCRLLD
FT                   SASIRELERLLNEADIDPRALWEQPQDWSAFAPQVDQWLEETACALARAALTTCAVIDF
FT                   QAVVVDGVLPRSIRQRLVDRIREELPKLDARGLILPDVQEGQIGPHASALGAAAKPLIA
FT                   QYLLDTHAGFTATS"
FT   gene            377973..378989
FT                   /locus_tag="TM1040_0368"
FT   CDS_pept        377973..378989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0368"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63101"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR5"
FT                   /protein_id="ABF63101.1"
FT                   /translation="MKKLLLTTIAGVGLLAGAAQADEKVTACLITKTDTNPFFVKMKEG
FT                   ATAKAEELGMELKAFAGKIDGDHETQVAAIETCIADGAKGILLTASDTSSIVPAVQQAR
FT                   DAGLVVIALDTPLNPIDAADATFATDNFLAGELIGQWAAAALGDDAANAKIGMLDLAVS
FT                   QPTVGVLRDQGFLQGFGIDIGDPNKWGDETDPRIVGNDVTAGNEEGGRKAMENLLAKDP
FT                   MINVVYTINEPAAAGAYEALKSIGRENDVLIVSVDGGCPGVQNVKDGVIGATSQQYPLM
FT                   MASLGVEAIKKWAEEGVKPEPTPGKAFFDTGVALVTDQPVDGVESIDTTEGTNLCWG"
FT   gene            379177..380241
FT                   /locus_tag="TM1040_0369"
FT   CDS_pept        379177..380241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0369"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63102"
FT                   /db_xref="GOA:Q1GJR4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR4"
FT                   /protein_id="ABF63102.1"
FT                   /translation="MMSTPQSYEAAVAGSPDKVAEFDQGPQSFIQKFQHALHVTPSLVP
FT                   LIVLVLSIIIFGLLLGSKFFSPFALTLILQQVGIVGIVACAQSLVILTAGIDLSVGAIM
FT                   VLSSVVMGQFTFRYGLPPTLGVACGLLCGTLCGYINGWLVAKMKLPPFIVTLGMWQIVL
FT                   ASNFLYSANETIRSQVIAEEAPFLQFFGEKFKVGGAVFTYGVIFMIVLVLVLAYVLRHT
FT                   AWGRHVYAVGDDKDAAELSGVNTDKVLISVYMLSGLICAFAGWALIGRIGSVSPTSGQL
FT                   SNIESITAVVIGGISLFGGRGSVLGTFFGALIVGVFTLGLRLLGADAQWTYLLIGVLII
FT                   AAVAVDQWIRKVSV"
FT   gene            380238..381017
FT                   /locus_tag="TM1040_0370"
FT   CDS_pept        380238..381017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0370"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63103"
FT                   /db_xref="GOA:Q1GJR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR3"
FT                   /protein_id="ABF63103.1"
FT                   /translation="MMEPILKGRNLVKRYGKVTALDHCDFDLMPGEILAVIGDNGAGKS
FT                   TLIKALSGAVIPDEGTVELEGKPVNFHSPIDARESGIETVYQTLAMSPALSIADNMFMG
FT                   RELRKPGWRGQLLRQLDRSRMEEIARQKLNDLGLMTIQNINQAVETLSGGQRQGVAVAR
FT                   AAAFGSKVIILDEPTAALGVKESRRVLELIQDVKSRGIPIILISHNMPHVFEVADRIHV
FT                   HRLGRRLCVIDPKEHEMADAVAYMTGAKEPDAELSAA"
FT   gene            381014..381637
FT                   /locus_tag="TM1040_0371"
FT   CDS_pept        381014..381637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0371"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63104"
FT                   /db_xref="GOA:Q1GJR2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3C8U"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR2"
FT                   /protein_id="ABF63104.1"
FT                   /translation="MTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAAL
FT                   SAQGLPAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPL
FT                   FDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEAR
FT                   LVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWPQA"
FT   gene            381666..382331
FT                   /locus_tag="TM1040_0372"
FT   CDS_pept        381666..382331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0372"
FT                   /product="protein of unknown function DUF1498"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63105"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR1"
FT                   /protein_id="ABF63105.1"
FT                   /translation="MKRSEVNEILDRSWSFIKSHGVHLPPFAHWTPDQMRTPEAADIRS
FT                   RGLGWDITDYGQGRFDELGLFLFTARNGSHEDLSAGRGMLYAEKIMISRAEQLSPMHRH
FT                   NIKAEDIINRGGGTLVIELFAPDRDGGIDRAAPVTVPCDGIARTLPAGGKLKLAPGESV
FT                   TLMPGIWHAFWSEGGDCLIGEVSTVNDDRTDNVFEMEIGRFSQIDEDTAPTHLLVSDY"
FT   gene            complement(382535..383410)
FT                   /locus_tag="TM1040_0373"
FT   CDS_pept        complement(382535..383410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0373"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJR0"
FT                   /protein_id="ABF63106.1"
FT                   /translation="MRIFLLGATGSIGTALLPELLAAGHHVTALCRSDIAARTVDAQGA
FT                   KVCRGDMRAPQDWAPALEGQDVVIHAAITFDEEMAAADRQVVDTLINAAQTRAAALRVI
FT                   YTGGCWLYGDTRGRILHEADGFNPIPAFRPFLNQAERLMREPTLSTATLHPAMVYHQEG
FT                   GVFDRMLADIAAERPIELWGNASIRWPLIHRKDLAVAYRLLAEDPDLTGHFNAVAQCGV
FT                   EIGAIAATLARAHGHDETLNCLSRAKAQALAGHWAEGPMLDQRLSGARLRAATGWVPQY
FT                   QDLEQCFPPL"
FT   gene            complement(383481..383897)
FT                   /locus_tag="TM1040_0374"
FT   CDS_pept        complement(383481..383897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0374"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63107"
FT                   /db_xref="GOA:Q1GJQ9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ9"
FT                   /protein_id="ABF63107.1"
FT                   /translation="MTQDYTGSCLCGAIAFELTGDIAAFFLCYCSRCRKGTGSAHAANL
FT                   FAPDALIYWTRGAEHLRQYQHNNSRHCRSFCPTCASPMPQVQPDCIVIPAGCLDQVPEV
FT                   PISAGICWSDRAKWVDGIAAADKTDGLPQNHSRR"
FT   gene            complement(384038..384685)
FT                   /locus_tag="TM1040_0375"
FT   CDS_pept        complement(384038..384685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0375"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63108"
FT                   /db_xref="GOA:Q1GJQ8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ8"
FT                   /protein_id="ABF63108.1"
FT                   /translation="MTLTPQQSSAKAREICALAPIVPVLVVHDVAHARPLAEALVAGGL
FT                   PALEVTLRTPAALDVIREMSKVEGGVVGAGTLVTPADVTAAVEAGAKFGVSPGSTPLLL
FT                   DAALAADLPMLPGAATASEAMTLLERGYDMLKFFPAEASGGAPALKAIGAPLPQISFCP
FT                   TGGVSPSNAESYLGLSNVVCAGGSWVAPAKLVEAGDWKAIEDLAREASTLAR"
FT   gene            complement(384690..386501)
FT                   /locus_tag="TM1040_0376"
FT   CDS_pept        complement(384690..386501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0376"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63109"
FT                   /db_xref="GOA:Q1GJQ7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ7"
FT                   /protein_id="ABF63109.1"
FT                   /translation="MSLNATLAAVTDRIIERSRPTREAYLARMRAAASKGPARAHLSCS
FT                   GQAHAYAATGPDQETLATGTGGHLGIVTAYNDMLSAHQPFETYPMLIREAVREAGGTAQ
FT                   VAGGVPAMCDGITQGEAGMELSLFSRDSIAMSVGIALSHNVFDATVFLGVCDKIVPGLV
FT                   IGAQAFGHLPAVFLPAGPMTSGLSNDEKAQIRQKFAKGEIGRDELLKAEMAAYHGPGTC
FT                   TFYGTANTNQMLMEFMGLHLPGSSFVNPGTELRDALTREGAKRALSLSALGNHYTPTCD
FT                   ILDEKAFVNGMVGLMATGGSTNLLIHLIAMARAGGIILDWQDFSEISDVVPLLARVYPN
FT                   GLADVNHFHAAGGLGYMIGELLENGYLHPDTKTVTGEGLGAYLMEPFLDGGALTWRKGT
FT                   TESLNDKIVRPASDPFQKTGGLARLTGNLGTGVMKISAVAEEHRVVEAPVRVFHDQDEA
FT                   KAAFKAGELDEGDVVIVVRFQGPKANGMPELHSMTPFLSIMQGRGQKVALVTDGRMSGA
FT                   SGKVPSAIHVVPEALDGGAIAKLQDGDIVRVDAISGNLEVLTEGVLDRPAATADLTSYQ
FT                   HGTGRELFALFRSSVTSADTGATVFGV"
FT   gene            complement(386534..387985)
FT                   /locus_tag="TM1040_0377"
FT   CDS_pept        complement(386534..387985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0377"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63110"
FT                   /db_xref="GOA:Q1GJQ6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ6"
FT                   /protein_id="ABF63110.1"
FT                   /translation="MVSRVIPVDSFDFVLFGATGDLARRKILPSLFHRFQIGQFDDNSR
FT                   IIGASRSKMDQGEFQTLVGDALKEFGDIPADAEPDVERFLSLLDYASVDAKGDGGWSDL
FT                   GSKLRDGVVRAFYLSVAPSLFGDIAGRLKSTGIADDQSRIVVEKPFGHDLASAQALNAA
FT                   LREHFEESQIYRIDHYLGKETVQNLMALRFANSLFEPQWNSHHIDHVQITVSESISVAG
FT                   RGEYYDKSGAMRDMVQNHLMQLLCLTAMEPPSTFEPNAVRNEKLKVIESLVPVAADDIV
FT                   RGQYRAKSGNDSYLDHAGDPQSRTESFVAMKVEVANWRWAGTPFYLRTGKCLRERVSEI
FT                   AVYFRKPPHNIFGEDNAIDGNMLVIRLQPDEGITLKTTIKDPGPGGMRLTSADLDMTFA
FT                   DSLPEAGRPQDAYERLIMDVIRGNQTLFMRGDEVEAAWTWADPIINAWDTSTRAPQPYD
FT                   QGGSGPEDALLLLHRDGRRWRSIGA"
FT   gene            complement(388010..389620)
FT                   /locus_tag="TM1040_0378"
FT   CDS_pept        complement(388010..389620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0378"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63111"
FT                   /db_xref="GOA:Q1GJQ5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJQ5"
FT                   /protein_id="ABF63111.1"
FT                   /translation="MSDIWQQLSAHRAATEATPLTDYFAQDADRFARYSASAGEMLLDY
FT                   SKTALDDTARDLLVQLAESVDLKSRIAAMMSGAKINSTENRAVLHTALRAPKDAVIEVD
FT                   GENVVPGIQKVLAQMGAFATALREGSYQTKTGTAFTDVVNIGIGGSDLGPVMATLALAP
FT                   YHDGPACHFVSNVDGAHIHDVLAGLNPETTLVVIASKTFTTIETMTNAETAIQWLKGAL
FT                   GEDVSTHLAAVSTALDKTAAMGIPDARVFGFADWVGGRYSMWGPIGLPIMIAVGPESFG
FT                   EFLAGAAAMDQHFRDAPLMENLPALLGLIGVWHNNICGYGSRAVLPYDQRLSRLPAYLQ
FT                   QLDMESNGKSVALDGSPLPRASGPVVWGEPGTNGQHAFYQLLHQGTQVIPTEFLIAATG
FT                   HEPELAHQHNLLKANCLAQSEALMLGRSWDEAREIAIARGFDGVDADRMAGHLSFPGNR
FT                   PSVTLAYPKLTPFVFGQIVALYEHRVFTEGVIWGINSFDQWGVELGKELATRLLPMVEG
FT                   ADASQKDASTRGLLAKLST"
FT   gene            complement(389724..390131)
FT                   /locus_tag="TM1040_0379"
FT   CDS_pept        complement(389724..390131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63112"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ4"
FT                   /protein_id="ABF63112.1"
FT                   /translation="MGLDILCLVCLRLGNLPRRRHISAIFVLCIGFGQAHADDQNHQCT
FT                   CFNMLDHIGILWRQGQHSPLTPAGLTCSLHAKYEAVHIRRKKLRPSLGPDHRACDKLGL
FT                   ELASPAPLGLAQDLQASKTNPSVASLRKFGI"
FT   gene            complement(390218..390859)
FT                   /locus_tag="TM1040_0380"
FT   CDS_pept        complement(390218..390859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0380"
FT                   /product="urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63113"
FT                   /db_xref="GOA:Q1GJQ3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ3"
FT                   /protein_id="ABF63113.1"
FT                   /translation="MTSQTTAPHGPLRVGIGGPVGAGKTTLMAELARALKDHHSIGVIT
FT                   NDIYTQEDAEALMRQQILPQDRVIGVETGGCPHTAIREDASINLAAVAEMQNRHPEVEI
FT                   VLIESGGDNLSATFSPELADVTLYVIDVAAGEEIPRKGGPAITRSDLLIINKTDLAPHV
FT                   GASLEVMERDAKRMRNGLPFAFTALRHGEGVDTVLRHLFDIGGIDSGAVT"
FT   gene            complement(390856..391500)
FT                   /locus_tag="TM1040_0381"
FT   CDS_pept        complement(390856..391500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0381"
FT                   /product="Urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63114"
FT                   /db_xref="GOA:Q1GJQ2"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJQ2"
FT                   /protein_id="ABF63114.1"
FT                   /translation="MTSEATLKLMQWLSPAYPVGAFAYSHGLEGAVSEGHVRDGDTLSD
FT                   WLSDLLTHGGARSDALLLACAYRTETAESLAEIDDTARAFCPSAERLQETDLQGAAFCR
FT                   TTAAIWDTALPSLTYPVAVGHAARLNDVALDLTLNMYLHAFLSNLVAAGQRLLSLGQTE
FT                   AQQRLNACGPQLRRTVDAALSGTIDDLFGASFAADIASMRHETQYSRIFRS"
FT   gene            complement(391490..392020)
FT                   /locus_tag="TM1040_0382"
FT   CDS_pept        complement(391490..392020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0382"
FT                   /product="UreE urease accessory-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63115"
FT                   /db_xref="GOA:Q1GJQ1"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJQ1"
FT                   /protein_id="ABF63115.1"
FT                   /translation="MSAPRLIARHYHGHPHDESPRDCVVLDYDARFLRRKVLTCESGER
FT                   LLVDLSHTTSLDHDGVLLLEGGGEIRVVAAPEPLLEVTADHLPRMAWHIGNRHTPCQIE
FT                   ASRLLIQRDHVIRAMLEQLGAQLREVEEPFTPEGGAYGHGRTHAHEHGHTNHHGQHHDH
FT                   ADHGHSHDHSHDQ"
FT   gene            complement(392070..392297)
FT                   /locus_tag="TM1040_0383"
FT   CDS_pept        complement(392070..392297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63116"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJQ0"
FT                   /protein_id="ABF63116.1"
FT                   /translation="MAYASNAQTSTPFNPFGLIAGFFRAIGNGLVHLAESNHRVNRART
FT                   LMELSDEELAQRGLKREDVVKHVFSDIMYV"
FT   gene            complement(392436..393050)
FT                   /locus_tag="TM1040_0384"
FT   CDS_pept        complement(392436..393050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJP9"
FT                   /protein_id="ABF63117.1"
FT                   /translation="MSRLSAVLLAAILPLPLWAQACPTASDLTEGGIIFEFEEGDSETF
FT                   RELRPGLIESVYAHDAEASGATRVLLAKGLYVLEIIELERGELRPNTRLTYAFPVAADA
FT                   LLLPETETNGLAEWSYKVAYNDVGYIDQETQTFTPQPKFEKSYGDCTYDVLPVHVHYSE
FT                   TPLTDRDVLHYLPALGISYLAGNITAEGEETYEYQSIRSVK"
FT   gene            complement(393082..394794)
FT                   /locus_tag="TM1040_0385"
FT   CDS_pept        complement(393082..394794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0385"
FT                   /product="urease. Metallo peptidase. MEROPS family M38"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63118"
FT                   /db_xref="GOA:Q1GJP8"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJP8"
FT                   /protein_id="ABF63118.1"
FT                   /translation="MPANIPRSDYAAMYGPTTGDRVRLADTDLIIEVERDLTGPYGEEV
FT                   KFGGGKVIRDGMGQAQTTRAGGAVDTVITNALILDWTGIYKADVGLKDGRIHAIGKAGN
FT                   PDTQPNVTIIVGPGTEVIAGEGRILTAGGFDSHIHYICPQQIEDALHSGLTTMLGGGTG
FT                   PAHGTLATTCTPGAWHLGRMMQAADAFPMNLAFAGKGNASLPAAIEEQVNAGACALKLH
FT                   EDWGTTPAAIDCCLGVADAMDVQVMIHTDTLNESGFVEHTVKAMKGRTIHAFHTEGAGG
FT                   GHAPDIIKICGEEFVLPSSTNPTRPFTVNTIEEHLDMLMVCHHLDKSIPEDVAFAESRI
FT                   RRETIAAEDILHDMGAFSIIASDSQAMGRVGEVIIRTWQTADKMKKQRGRLSEETGEND
FT                   NFRVRRYVAKYTINPAIAHGIAHEIGSIEVGKRADLVLWNPAFFGVKPEMVLMGGTIAC
FT                   AQMGDPNASIPTPQPVYSRPMWGAYGRSVEHSAVTFVSEAAQAAGIGKTLGLAKQTLAV
FT                   KGTRGIGKSALKLNTATPEIEVHPETYEVRANGELLTCQPAEELPLAQRYFLF"
FT   gene            complement(394907..395212)
FT                   /locus_tag="TM1040_0386"
FT   CDS_pept        complement(394907..395212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0386"
FT                   /product="urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63119"
FT                   /db_xref="GOA:Q1GJP7"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJP7"
FT                   /protein_id="ABF63119.1"
FT                   /translation="MIPGELMPAAGDLTLNEGAEALTLMVANTGDRPVQVGSHYHFAEA
FT                   NPALDFDREAARGLRLDIAAGTAVRFEPGQRREVPLIPIGGARRIFGFNAEIMGDL"
FT   gene            complement(395402..395704)
FT                   /locus_tag="TM1040_0387"
FT   CDS_pept        complement(395402..395704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0387"
FT                   /product="urease gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63120"
FT                   /db_xref="GOA:Q1GJP6"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJP6"
FT                   /protein_id="ABF63120.1"
FT                   /translation="MNLTPREKDKLLVAMAAEVARKRLARGVKLNHPEAIALITDAVVE
FT                   GARDGRSVAEMMQAGAEVITRDQCMSGVAEMIHEVQVEATFPDGTKLVTVHNPIR"
FT   gene            complement(395726..396619)
FT                   /locus_tag="TM1040_0388"
FT   CDS_pept        complement(395726..396619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0388"
FT                   /product="Urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63121"
FT                   /db_xref="GOA:Q1GJP5"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJP5"
FT                   /protein_id="ABF63121.1"
FT                   /translation="MPQAADIATAPQRPSAPGDVVAAGQPPRARGRAHVSSKRRDDGAV
FT                   ALDTLHQSGALKLLFPTGRPDLEAVTVNTAGGITGGDDFALTAKAGAQSQLTLTTQAAE
FT                   RVYRAQPHQTGQMTTRLSVEPQARLRWVPQETILFQHSAFRRSLHVELADDAELLLVEP
FT                   LVFGRVAMGEHLSALRFHDQIQIRRAGRILFRDAIRLDGDAMAQLKRPGIAGVLSGPCT
FT                   AMVTLVLASPGAEAALAWLRTQLPAGKEAYGGASLLAPNLLHMRLLARDSFVLRQSLLP
FT                   ILDKLTEGSLPRCWRL"
FT   gene            396997..398121
FT                   /locus_tag="TM1040_0389"
FT   CDS_pept        396997..398121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0389"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63122"
FT                   /db_xref="GOA:Q1GJP4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJP4"
FT                   /protein_id="ABF63122.1"
FT                   /translation="MTPLHGLKVVELARILAGPWIGQALADLGAEVVKVESPEGDDTRR
FT                   WGPPFVEREGDKTAAYYYAANRGKTCVTADFRTSEGQAQVRDLVRDADILIENFKVGGL
FT                   KKYGLDFESLSALNPRLIYCSVTGFGQDGPYATRAGYDFLLQGMSGLMSITGAADGEPQ
FT                   KVGVAITDVVTGLYGSIGILAAVEQRHRTGRGQHIDMSLLDCATAMLANQNMNYLVTGE
FT                   SPTRMGNEHPNIAPYQVMAVRDGHVILAVGNDGQFTRLCDVLNLAGLKDDPRFSTNQLR
FT                   VAHRADLTPLLAAALAQWSQSDLLAALEAATVPAGPINTIGQAFEDAQIKHRQMQIAPE
FT                   GVPGVRGPWVFSDADLALDRSAPVLPRDTKPEKD"
FT   gene            complement(398118..398918)
FT                   /locus_tag="TM1040_0390"
FT   CDS_pept        complement(398118..398918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63123"
FT                   /db_xref="GOA:Q1GJP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJP3"
FT                   /protein_id="ABF63123.1"
FT                   /translation="MRTAFSQNLRFLCAETPSIAQTCRDIGLNRQQFNRYLSGAGLPSA
FT                   HNLRRIARHFDVPEADLFTNPDQFAAARRPKRSPQLPAPLFHLGTGFADQARILRRFLG
FT                   SYHGYFTTPTWPGQVLRTLIHLRDVDGYVTSHTFERARSLDGSIHQRSSYRGLVAERGG
FT                   RLCLLERPRNAVGALSETILMPEHPHQISYLQGLVLGVSAGANRRPFSTRTVWVRIEEK
FT                   TSARAALAATGTLAKDSPRLDPKVRRLLGDDSPLSIVSDLLAPS"
FT   gene            399046..401052
FT                   /locus_tag="TM1040_0391"
FT   CDS_pept        399046..401052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0391"
FT                   /product="peptidase S15"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63124"
FT                   /db_xref="GOA:Q1GJP2"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJP2"
FT                   /protein_id="ABF63124.1"
FT                   /translation="MTQPSAITVTEHLWIPLPDGRRLAARMWMPEGKGPFPVILEYLPY
FT                   RKRDGTAPRDATTHPVFAAEGYACLRVDIAGSGDSDGRFDDEYSEQELSDGEAVLEWIA
FT                   AQPWSSGNVGMIGISWGGFNGLQMAYRRPEALKAVVSVASTVDRYADDIHYMGGCLLSD
FT                   NKNWASQMFAYMTRPLDPKLRPDWREEWLGRINDLPFMAADWLKHPTRDTFWKHGSVSE
FT                   DWSAIKAPVLAITGWADAYVNAPSALAAKMTGAPAKALMGPWEHRYAHISQIEAADFHG
FT                   EVLRWFDHYLKGEDAGADALPDYRVFLQEFTEPSPKNLPQNGRWVAEAHWPSPNVSDVT
FT                   WPLARAGFAAAPQAGTVVVKSAATVGQAGGYFCPGIRIDNERPGDQSVDDAASTCFDST
FT                   PLLAPMEILGRPRVRLAFSVDKPVAQVVARLCDVAPSGQSQRITYRPRNLCHDDSHEVA
FT                   TKLEPGKRYEVEFELNECAHRVLAGHRLRLALSTSYWPIVWPAPEAAEIMLHLEDCALV
FT                   LPERRVEVEIDAQAPGAARDYPRYQAQVLEKPWGEATTRIEADGTHVLESYDSYGAARD
FT                   LSHGQQVSSNVRMRYAIHPDDPASARFDCAWVFAFGRETDGDAPDWNLRIETDSAMWCD
FT                   TETFTLWREIKAFEGEDLILTRDWKEVIPRGCH"
FT   gene            complement(401118..401666)
FT                   /locus_tag="TM1040_0392"
FT   CDS_pept        complement(401118..401666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63125"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJP1"
FT                   /protein_id="ABF63125.1"
FT                   /translation="MRNSIFAALALSLVGSLAQASSLFLEAGNWAAVYKGDTCHVYTLS
FT                   SARDTSGYLEFTFQNNGFNATFDYIYTPYTPDEIDAPWDESMDSVSLYIGDQPVWYGEE
FT                   MFFYTGPGFTYGASLTPGFISELTAEMIANGERFDFAVDRAVDGETWLYGGFSLEGFDQ
FT                   ALAKAGKMCQFDPRALPQS"
FT   gene            complement(401790..402266)
FT                   /locus_tag="TM1040_0393"
FT   CDS_pept        complement(401790..402266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63126"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJP0"
FT                   /protein_id="ABF63126.1"
FT                   /translation="MKLARAIHFDESDMNVFASPARTGEWCISGGFEFSNWSEGDLVGK
FT                   QRQAFANGWMGLETAGRVTFVAVTQIEPEEVTKLVEQLAQHFMEIYGAPDLASARPVAE
FT                   AEIDHMAELCEDHDPNTLLTVARELTEAGVRESFRVIEAQSAGLEQFAIHVTED"
FT   gene            complement(402282..402986)
FT                   /locus_tag="TM1040_0394"
FT   CDS_pept        complement(402282..402986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63127"
FT                   /db_xref="GOA:Q1GJN9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR028044"
FT                   /db_xref="PDB:3BFM"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN9"
FT                   /protein_id="ABF63127.1"
FT                   /translation="MSETITFPPLMTGEAAGPGQDPFDLACQKAELGVDAGLVVYELGT
FT                   DVLRAALVLAPEVPLAKAMAMLPVCGVGFQNALGALAPPEVAVHLDWNGALRINGARCG
FT                   RLRIAASTDDPDTQPDWLVVGLDLPLWPEGDGGETPDETALYAEGCADVAAPRLLESWA
FT                   RHCLHWINRWDEGELETIHGEWRGLAHGMGEARTEAGRSGTFLGVDEDFGMLLRDETTT
FT                   HLIPLTTVLVQD"
FT   gene            complement(402983..404047)
FT                   /locus_tag="TM1040_0395"
FT   CDS_pept        complement(402983..404047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0395"
FT                   /product="Mrp/NBP35 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63128"
FT                   /db_xref="GOA:Q1GJN8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN8"
FT                   /protein_id="ABF63128.1"
FT                   /translation="MSITRDAVLDALKTLNDPVSGSDIVAAGIVRALTLEGSTVRFVLE
FT                   IDPAKSDAYAPVRDQAEAVVSALAGVEKVSALMTAHSTKAPPDLKPNKPAEPQGPQKIP
FT                   GIAKIIAVASGKGGVGKSTVSANLACALAQAGRRVGLLDADVYGPSQPRMLGVSGRPAS
FT                   PDGKTILPLRNHGVTMMSIGLMTNDDQAVVWRGPMLMGALQQMMMQVQWGALDVLIVDL
FT                   PPGTGDVQMTLAQKAQVDGAIVVSTPQDVALIDARKGIDMFHKLNVPILGLIENMSTHI
FT                   CSNCGHEEHIFGHGGVAAEAEKLNVPLLAEVPLHLDVRLAADGGAPIVVSKPDSAQARA
FT                   FQDIAAALLERGAA"
FT   gene            complement(404143..406101)
FT                   /locus_tag="TM1040_0396"
FT   CDS_pept        complement(404143..406101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0396"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63129"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN7"
FT                   /protein_id="ABF63129.1"
FT                   /translation="MPKHPILCDCSGSQPLDSEALSAATGLPCSKVHSHLCTTESEAAA
FT                   AALQDPDAIFCCGQESRFFTALAEELGQDAPAFLDLRDRAGWSRDALKAADVLPKMSAL
FT                   VSEAQLDLRPAKSVDVVSEGLCLIVGTADAALPAAEKLQDSLGVTVLLTDAAEPPLSRG
FT                   FDTIRGQLRSAQGALGGFEITVDALQSLDVTGREWSWSAPRDGGRSECDIILDLRGGTP
FT                   LFPAPEKREGYLRADPKSPVAVADAVFAASQLVGTFEKPLYVKAEPLLCAHSRARQTGC
FT                   TRCLDACPTGAITPNGDSVAIDPMICAGCGACASLCPSGAITYDAPPTESLFLRIQTLA
FT                   KAYLDAGGEAPRLLVVDAHGAEMIRLAARFDRGLPAAVIPLEVEAFNTFGHAEILAARA
FT                   AGFREVCLLPGPRADLDVQTRERELANAISADAARLLHAAEPEALCDALYEARTLPAAP
FT                   ETPQRPMGTRRQITRQAALALTAADTELPLPEGAPYGAVVVDTDACTLCLSCVSLCPSG
FT                   ALGDNEDLPQLRFQEDACLQCGLCANACPEDAITFAPRLNLAPSALDQIVLNEEEPFAC
FT                   IECGSLFGVKSTVERIMEKLAGNHAMFASSEAAKMIQMCDDCRVNAQFHQKDSPFASKE
FT                   RPRVRTTEDYLSTRRDH"
FT   gene            406357..407001
FT                   /locus_tag="TM1040_0397"
FT   CDS_pept        406357..407001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63130"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN6"
FT                   /protein_id="ABF63130.1"
FT                   /translation="MLNLGALCAFACRPFCGKLGETSQGTSVNQANAKTVVMPLGVVIR
FT                   RTPGVTPWAKWSWRAVAVLPGAAEADWSLLREEGEASEFHAATLPLELHRADAEAYMQG
FT                   LTANPPSIYVVMRPGADARPEVALVTASPFEAQDYADTGEDQVEKVDMPVGLVAWVRDF
FT                   TLAHFKEEEFKKRRRDRQRVDLEEEGVGDARIPQLSDVYRAPVKARKERLQ"
FT   gene            406998..407654
FT                   /locus_tag="TM1040_0398"
FT   CDS_pept        406998..407654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63131"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN5"
FT                   /protein_id="ABF63131.1"
FT                   /translation="MSAQDFWSRRRAAVEAEAAQGERALKEAEAAERDAEAAERSDEEL
FT                   LAELDLPDPDTLGPGDDFKAFLSEAVPARLKTRALRRLWMTNPVLANLDGLLDYGEDFT
FT                   DAAMAVENIQTAYQVGKGMTAHVEELARQAELEAAAARATEEQPVEDAPDVDQDEADFD
FT                   APAETNEPPATAPKDATPSVTAHASAAGGDHEEEAVAPVTSRRMRFVFEDGAAST"
FT   gene            407651..408277
FT                   /locus_tag="TM1040_0399"
FT   CDS_pept        407651..408277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0399"
FT                   /product="cytoplasmic chaperone TorD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63132"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN4"
FT                   /protein_id="ABF63132.1"
FT                   /translation="MTQESPMTEAAVTAETVTEEDRLRADLYNYLGLMLAAPPAEMLLE
FT                   QTAGLSGDDTPLGEAITQLARVAKRTKPAAAEREFNALFIGLGRGELLPYASYYLTGFL
FT                   NEKPLAALRNDMSARGLSRAPNVFEPEDNIASLMEMMGAMIVGRFNTPVSLAEQKTFFN
FT                   KHIGPWAAHFFADLEGAKNSVLYASVGAVGRAFMEIEAEGFRMGG"
FT   gene            408384..408572
FT                   /locus_tag="TM1040_0400"
FT   CDS_pept        408384..408572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0400"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63133"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN3"
FT                   /protein_id="ABF63133.1"
FT                   /translation="MSRKEDGASRRDFLKLAATTTPAAVVALATTGGEAEAATPDLSSS
FT                   KMQDTAHTRAYYDSTRF"
FT   gene            408686..411580
FT                   /locus_tag="TM1040_0401"
FT   CDS_pept        408686..411580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0401"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63134"
FT                   /db_xref="GOA:Q1GJN2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN2"
FT                   /protein_id="ABF63134.1"
FT                   /translation="MLRKKTNGVARRPQRTSILSKVGESAVDRRAFLRGSGLAIGGLAA
FT                   ISATGGTVTQANAAASATGAMETIKSVCTHCSVGCTVVAEVQNGVWVGQEPGWDSPFNL
FT                   GAHCAKGASVREHAHGERRLKYPMKKEGGEWKRISWEQAIDEIGDGMMQIREESGPDSV
FT                   YWLGSAKHNNEQAYLFRKFAAYWGTNNVDHQARICHSTTVAGVANTWGYGAMTNSYNDI
FT                   HKSKAIFIIGGNPAEAHPVSLLHVLKAKEENNAPLIVCDPRFTRTAAHADEYVRFRPGT
FT                   DVALVWGILWHIFENGWEDTEFIRTRVWGMDQIRTEVAKWTPEEVERVTGTPGSQLKRV
FT                   ARTLVNNRPGTVIWCMGGTQHTNGNNNTRAYCILQLALGNMGVSGGGTNIFRGHDNVQG
FT                   ATDLGVLSHTLPGYYGLSAGAWGHWGRVWGEDMDWLKGQFETVKGADGKDKNLMNLTGI
FT                   PVSRWIDGILEDKENMDQPNNVRAMVLWGHAPNSQTRMTEMKTAMEKLDMLVVVDPYPT
FT                   VSAVLHDRTDGVYLLPACTQFETRGSVTASNRSLQWRDQVVEPLFESLPDHVIMAKFAN
FT                   KFGWADRLFRNIEMEDAETPNIESITREFNAGMWTVGYTGQSPERIKLHMANQHTFDRT
FT                   TLQAVGGPADGDYYGMPWPCWGTPEMKHPGTPNLYDMSKPVAEGGLCFRARFGVERDGE
FT                   NLLAEGVSNPGAEIQDGYPEFTMQMLMDLGWDGDLTAEERAAIDAVAGPKTNWKTDLSG
FT                   GIQRVAIKHGCAPFGNAKARAVVWTFPDPVPLHREPLYTNRRDLVADYPTYEDRKFYRL
FT                   PTMYASIQKNDVSKEYPIILTSGRLVEYEGGGDETRSNPWLAELQQDMFVEINPRDAND
FT                   IGIRDGSQVWVEGPEGGKVKVMAMVTERVGAGVAFMPFHFGGHFQGKDLRDKYPDGADP
FT                   YVLGESTNTAQTYGYDSVTQMQETKATLCKISAA"
FT   gene            411594..412187
FT                   /locus_tag="TM1040_0402"
FT   CDS_pept        411594..412187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0402"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63135"
FT                   /db_xref="GOA:Q1GJN1"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN1"
FT                   /protein_id="ABF63135.1"
FT                   /translation="MSRAKFLCDAERCIECNACVTACKNEHEVPWGINRRRVVTINDGK
FT                   PGERSISVACMHCSDAPCMAVCPVDCFYQTEDGVVLHSKDLCIGCGYCFYACPFGAPQF
FT                   PQAGNFGSRGKMDKCTFCAGGPEENNSQAEFQKYGRNRIAEGKLPICAEMCSTKALLAG
FT                   DGDTVSSIYRERVVARGFGSGAWGWGTAYDQKGG"
FT   gene            412303..413517
FT                   /locus_tag="TM1040_0403"
FT   CDS_pept        412303..413517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0403"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63136"
FT                   /db_xref="GOA:Q1GJN0"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJN0"
FT                   /protein_id="ABF63136.1"
FT                   /translation="MPRLIFVFVLKLALLCGLSVNAQEASPAAPDRSATGGAQTLEDIL
FT                   ARQRGEDLDDSFRSEATGNPELAAGIEQQLGTLGGQSDPELWRALRYNSADISVSAGGD
FT                   VATVLVQDGGMSWLSFREGPLRQYGGWLLLGTIAALAVFFVLRGRIGIDADKTGRTVTR
FT                   FAFVERMAHWTLAGSFILLGITGLLTLFGRVAILPYLGKDVNSVLLIGSKWIHNSVSWA
FT                   FMLALIVVFFMWVAHNIPNKLDLVWLKQFGGIIGSKHPPAKKFNAGQKVIFWSVILLGA
FT                   SISVSGLSLLFPFEMPLFAKTFAALNSTGIPELLGFGVLPTELTPHGEMQLAQLWHAIV
FT                   GFVLMAIIIAHIYIGSVGMEGAYDAMGSGEVDEAWAHQHHSIWLEEVKEKERAKGSDAS
FT                   ATPAE"
FT   gene            413522..414805
FT                   /locus_tag="TM1040_0404"
FT   CDS_pept        413522..414805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0404"
FT                   /product="cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63137"
FT                   /db_xref="GOA:Q1GJM9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM9"
FT                   /protein_id="ABF63137.1"
FT                   /translation="MLRRLALGLLLCAASGVSAEEFQTLKGHGGPIMALAVNDRGHVAS
FT                   ASFDNSVSLWQEGAPSWLEAHEAAATVVAFGPDDTLFSAGDDFVIYRWQQGHPQEIGRH
FT                   TAKIRALDLSRDGEWLASASWDGGIGLWPMSAGTPRRIAVGTGVNDLAFDGAGRLFVAT
FT                   MTGQIQVFDSPEAAPRILAEQGFGINRLVLSAAGWLAYGAVDGGTRVINAETGAEIADF
FT                   TLDRRPILALAHHAESQQIAVGDGHGYIMMIDTHDWSIARDFRAMREGPVWALAFSKDG
FT                   QRVWAGGIHDVIYGWPIALMASSPAAGTETRTFLQAPETMPNGERQFMRKCSVCHDLVA
FT                   TEQRRAGPHLAGLFGRPAGSLPGYRYSDTLAQSDIIWGAETIDALFDLGPDHYIPGSKM
FT                   PMQRITAPTDRQDLIDYLKTATQLSEDN"
FT   gene            414942..416294
FT                   /locus_tag="TM1040_0405"
FT   CDS_pept        414942..416294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0405"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63138"
FT                   /db_xref="GOA:Q1GJM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM8"
FT                   /protein_id="ABF63138.1"
FT                   /translation="MNVSSVIRDEYSESLSSASILVIDDEPGMRHFMTKILEPRCKRVE
FT                   QAASAAEASDILDKAHFDLIVLDNIMPGKTGLDWVAEQRRVGLFADTILVTAYADLDTA
FT                   IQALRIGIADFVLKPFRANQILNAVARALDRKYLRRENYLLKHELSAEKSSARGRLLGK
FT                   SAAIEKVRKMLQRLAPLPTPVLFTGASGTGKEIAARTLHSLSDRAEQPFVAINCASLSP
FT                   DRLAEELFGVVDAQDRRRDGLFLHADGGTLFLDEVAQMPEQVQAALLRVLEDQKVRPVG
FT                   AERDIPLNLRFLLATNADLLQAVEEGKFRADLYHRINVVNIEMPALKERIEDIVELAAL
FT                   FMDQFALSLGMPALELDEETLLKFSRYAWPGNVRELRNLIERSVILGAFPEEFSGTGSV
FT                   IGAAAVENLDMVMQRHIMHVLDACDGNRAEAARRLGVSRKTVDRKCASWGL"
FT   gene            complement(416325..418301)
FT                   /locus_tag="TM1040_0406"
FT   CDS_pept        complement(416325..418301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0406"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63139"
FT                   /db_xref="GOA:Q1GJM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM7"
FT                   /protein_id="ABF63139.1"
FT                   /translation="MLKSVRLRLLILALLPLIVLMPLLMVVAMARWNADYDKILIEKVE
FT                   SDLRIAEQYLGHLQSNSARALQGLAQSAEIADVLTRDPGLTPAFLEQSQDRLGLDFLYL
FT                   LQGDELTDAKEKWPVIFQAAAGRMVSEIDILSASDLAALSPALAAEARIELIETEAAAP
FT                   ADHTVEDRGMVVHTAAPVRVNGEIRVLVGGILLNRNLDFIDTLNELVYLQGQYSDGRQG
FT                   TATLFLSDTRVSTNVRLFEDVRALGTRVSAAVRDAVLGKGRTWLDSAFVVNDWYISGYL
FT                   PISDSFGKRVGMLYVGFLEAPYETAKRAAYWTVVGAFVLVIALTAPLFLWLAKGIFAPL
FT                   EQMTRTMARVERGDLTARNQTSARGDEIGQVANHLNTLLDQVQERDRRLRNWAGELNLR
FT                   VEERTRELQVANAKLEETFRQLVMSEKLASIGEITAGVAHEINNPVAVIQGNVDVMRMT
FT                   LGDAAEPVRTELDLIDNQVMRIGAIVGKLLQFARPSEFGTFAEHVDVAAVVRDCLVLVD
FT                   HVISKQEVRVLTQFDAAPHVRIDPGELQQVVINIIINASQAMEGKGTLAISVAGEVRDA
FT                   QTGVALRIADTGPGIPMERIDHIFDPFFTTKQGEGTGLGLSISQTLIQRAGGRITVRNR
FT                   RARGAEFLIWLPEPTDADDPDQR"
FT   gene            complement(418401..419141)
FT                   /locus_tag="TM1040_0407"
FT   CDS_pept        complement(418401..419141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0407"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63140"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM6"
FT                   /protein_id="ABF63140.1"
FT                   /translation="MTDPRTVVIFGASGGIGRALVETYAGMSAVETVHAVSRGGDISFE
FT                   GSPAGQEKIAQHQADITSDSDLEALATRIGAAEMVIVATGILTDQETGLSPEKSYRHQD
FT                   KAAFEQVFGINTIGPALVAKHFLGRMPRKGRTVFAALAARVGSISDNGLGGWHAYRASK
FT                   AALCMLMRNYAIEVARKNEDAICVCLHPGTVDTGLSAPFQGNVPEGKLFTPEYSAKCLA
FT                   SVLSQLTPKDSGKQFDWAGAEVPA"
FT   gene            complement(419138..419860)
FT                   /locus_tag="TM1040_0408"
FT   CDS_pept        complement(419138..419860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0408"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63141"
FT                   /db_xref="GOA:Q1GJM5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM5"
FT                   /protein_id="ABF63141.1"
FT                   /translation="MSFKNQTWWIIGASEGLGRALAEALDQEGASLILSARNADRLQAL
FT                   SDGLGDAQALPMDVTDSRSVASAAEAASDADGVIYCAGLYDPMTVQEWEPETAEAICEV
FT                   NFMGAMRAMGRVAPRFARRGHGHIVLIGSLAGFTGLPGAIGYGASKAAVMHLGENLHRD
FT                   LRDSGVKVQVVNPGFIKTRLTAKNDFKMPMIQTPEDAAACCIKAMRSNRFQTSFPAPFS
FT                   WVFRIAALLPRKLVTRLI"
FT   gene            complement(419857..420426)
FT                   /locus_tag="TM1040_0409"
FT   CDS_pept        complement(419857..420426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63142"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM4"
FT                   /protein_id="ABF63142.1"
FT                   /translation="MKLLLGITVLVLLLLLWRPGFGFRAQRPSDYTGTGPAFDIRTHLN
FT                   GRFISEGMIYGPTGRVVSRFVAEMNGTWDGTRGTLSEDFSYAGGGTQARQWNLEIHENG
FT                   SFTATAEDIIGTGTGQHEGATVRLQYRIRLPKDAGGHVLDVTDWMYLMENGTIMNRSEM
FT                   RKFGIKVAELVATIRPAPDTDAPEQS"
FT   gene            complement(420423..421640)
FT                   /locus_tag="TM1040_0410"
FT   CDS_pept        complement(420423..421640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0410"
FT                   /product="sodium:galactoside symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63143"
FT                   /db_xref="GOA:Q1GJM3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM3"
FT                   /protein_id="ABF63143.1"
FT                   /translation="MNWRVSTYALMLAAAGLPLYIHLPRYATGELGMSLATLGVILAGI
FT                   RVMDFAQDPAIGWLVDRYPRQKPAFATLAALGMALGFVMLYTLRPETGSTVWFTAALAV
FT                   VFTAYSLGTILFYGQSAALAAQGNGLISLAGYREAGTLAGIIIAASAPAALVALGASGS
FT                   GYGAFGILLAAICLVALWSSRPLWRVPSASDAPLTLSDLRSSGALGLLALAFVNALPVA
FT                   ITSTLFLFFVEDRLLLPEFAGPFLILFFLAAGLSVPVWTRTAARYGATRSLIFAMCLAI
FT                   LAFVGAALLPAGAAFGFALICIGSGAALGADMVILPALFAGALDRAGLQAGRAFGLWSF
FT                   AAKLALASAAALLLPLLEVSGYRPGETNSAAALTALTLAYAVLPCVIKCAAIVLALQLP
FT                   REEVHA"
FT   gene            complement(421643..422185)
FT                   /locus_tag="TM1040_0411"
FT   CDS_pept        complement(421643..422185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM2"
FT                   /protein_id="ABF63144.1"
FT                   /translation="MRPKTGLTALCCWFAGVALFTAVTLATPLAANPVSTGLRAPVELG
FT                   KATLRFLGFEIYTATLHIEGARRFDWNQPLSLRIDYARGFSDAELLEGTEKELQRIEGA
FT                   RSDQPQMLQKLASCFRDVNSGDSYVAVSPAANVIDMRLNGQRTCRISHPDLRKRFLGIW
FT                   LSPNSRSARLSAQLRGE"
FT   gene            complement(422175..423335)
FT                   /locus_tag="TM1040_0412"
FT   CDS_pept        complement(422175..423335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0412"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63145"
FT                   /db_xref="GOA:Q1GJM1"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM1"
FT                   /protein_id="ABF63145.1"
FT                   /translation="MLFITNRVKRDFLDSCASIRRGSLRLITPEGEVYEFGQGEPAAEM
FT                   QINDWSVVTALASRGDIGLGETYVAGLWDTPSIEAVTQVALLNLDYLEGFAYPSRLATL
FT                   KFRIVDRILRANSRSGASRNIKAHYDVGNEFYQLWLDESMTYSSALFAPGDATLEDAQH
FT                   RKYDRILNRTGEAERILEVGCGWGGFAERAADHGRHVTGITISPSQHGFADARLDGRAD
FT                   IQLCDYRDTSGKFDGIVSIEMIEAVGERYWPQYFAMLKDRLAEGGRAVVQAITVPDAYF
FT                   DIYRKGSDYIRQYTFPGGMLLSDAMIAHHARNAGLQVTDNFGFGQDYARTCRMWSERLS
FT                   AASDKVLGLGYDQSFLRNWQFYLQICAASFETRQTDVVQVELAHAT"
FT   gene            complement(423335..424114)
FT                   /locus_tag="TM1040_0413"
FT   CDS_pept        complement(423335..424114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0413"
FT                   /product="protein of unknown function DUF1365"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63146"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJM0"
FT                   /protein_id="ABF63146.1"
FT                   /translation="MSASAPISPLVKGPLHLAGTTTHARRGAIQNAFRYGVDYVLIDPQ
FT                   STRGPLLFSRNRWNLASVMDRNHGGAPKKGRGLDWAKEVFEHAGLAPQNLRILLLTQPS
FT                   FLGYIFNPVSFWLAYDGATLRGVIAEVSNTFGDRHSYLCAEPEFAPITAKSCLSAQKIF
FT                   HVSPFQEVAGDYRFTFDITGTRIAIRIAHKNGSEGVIATLMGELHDLNNARLIKASLRR
FT                   PFGAMRTVALIYWQALKLKLKGARYRRRPLPPEQEVS"
FT   gene            complement(424111..425442)
FT                   /locus_tag="TM1040_0414"
FT   CDS_pept        complement(424111..425442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0414"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63147"
FT                   /db_xref="GOA:Q1GJL9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL9"
FT                   /protein_id="ABF63147.1"
FT                   /translation="MKTDGEFMSFDALPPQRRRIAIIGGGISGLAAAWLLGPRHDVTLF
FT                   EAAARFGGHARTVEAGLHGTQPVDTGFIVFNYVNYPHLTRMFNELDVPVVRSDMSFGAT
FT                   IENGAMEYGLRSLDALFGQRRNLARPAFFGMVRDILRFNARAEEFARDDSTTIGELVKE
FT                   LSLGDWFQRYYLMPICGAIWSTPPEEISAFPARSLVRFFRNHALLSATGQHQWWTVKGG
FT                   SREYVRRLTRHLQNTGVDLRAASPVQTVERHDAGVTLRLGDGRSEQFDEVIFACHSDDA
FT                   LRLLAAPTPQEQATLGVMRYQDNHMILHRDASQMPKRRACWSSWVYKADLRDDRPAIGV
FT                   TYWMNRLQNLPENDPLFVSLNPVQDVNPQLIYDDKTFRHPVFDRAAIRAQGAVQAMQGE
FT                   NHTWFAGAYLRHGFHEDGFASAVRVARAIDARTMGSRSAQDLVA"
FT   gene            425629..426225
FT                   /locus_tag="TM1040_0415"
FT   CDS_pept        425629..426225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0415"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63148"
FT                   /db_xref="GOA:Q1GJL8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL8"
FT                   /protein_id="ABF63148.1"
FT                   /translation="MGEGTSGCRESDRVTGEAYSETTVWMLAVRDDRDKAAFGRLFDHF
FT                   APRLKGVICRSGVSPAQAEDIVQDVMLTVWRKSHMFDPGRAQVSAWIYQIARNRQIDIL
FT                   RKEKRPVPEELKPVEDTEDDASQVVALEQETQALRAALQTLKPAQREMVERAYLGELTH
FT                   AEIKAETGLPLGTIKSRIRLGLEKLRHELKGTQRS"
FT   gene            426222..426857
FT                   /locus_tag="TM1040_0416"
FT   CDS_pept        426222..426857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0416"
FT                   /product="anti-ECFsigma factor, ChrR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63149"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL7"
FT                   /protein_id="ABF63149.1"
FT                   /translation="MTGITHHIPDELLIAYAAGSLTKAFSLVVAAHVSMCDECRARLGA
FT                   HEALGGALLDDMPVAEVSADMKGRLFDALDDPVAREKRYDRAGIFPAPVMEALGGLPPK
FT                   WKPLGLGVRQMILDHDRSGSVRLLYIPAGQGVPDHGHNGLELTLVLQGAFYDETGHFGV
FT                   GDLEVADGDLEHEPVAADGPACICLAATDASLRFRSFVPRLLQPIFRI"
FT   gene            complement(427011..428015)
FT                   /locus_tag="TM1040_0417"
FT   CDS_pept        complement(427011..428015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0417"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63150"
FT                   /db_xref="GOA:Q1GJL6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL6"
FT                   /protein_id="ABF63150.1"
FT                   /translation="MTLKIAINGFGRIGRNVLRALLENDTTDVEVVAINDLAPPATQVH
FT                   LLKFDSVHGRLDAEVTVEGDTMKVGRHEIRLTAIRNPEELPWSDVDIAYECTGLFTTRD
FT                   KAAAHLKNGSKRVLISAPGTEVDRTVVFGVNDRDLTAEDIVVSNASCTTNCLAPVAKVL
FT                   DDAFGIKTGYMTTIHAYTGDQPTHDTTHKDLYRARAAALSMIPTSTGAARAISLVLPHL
FT                   KGRLEGSAIRVPTPNVSVVDLTFQPERVASVEEINAAIAAAAKEGPLQGILGYEEAPLV
FT                   SIDFNHDKRSSIFAAPQTAVTSEGLVRVVSWYDNEWGFSNRMIDTGRAMGKFL"
FT   gene            428354..430087
FT                   /locus_tag="TM1040_0418"
FT   CDS_pept        428354..430087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0418"
FT                   /product="alpha amylase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63151"
FT                   /db_xref="GOA:Q1GJL5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033746"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL5"
FT                   /protein_id="ABF63151.1"
FT                   /translation="MATSFAARLSQLLTQIYPDLDTEILGSKVVEAFWPEGSHRRKRPR
FT                   RPGNSLWSERDALLITYGNTMRDGAHKPLDLLHDFLLTYMKGVVNGVHILPFFPFTSDD
FT                   GFAVTDYRKVNPELGDWADIRRIGGAFHLMSDMVLNHVSSQSAWFNAYRQGQPPYDRFF
FT                   YEASPSDDLSAVVRPRTTPLLQEVETATGAKHVWCTFSHDQVDLNFENPEVLLEILRII
FT                   RLHIDQGVRIIRLDAVAFIWKEVGTSSIHLPQTHAIVQLLRLLADYATETVVLLTETNV
FT                   PRAENLSYFGNRNEAHVVYNFPLPPLILHAMMAGSARYLLNWARAMPPAPLGCAYLNFT
FT                   ASHDGIGMRPAEGVLPQEEIDQMIACVRAVGGLVSMRALPGGGEAPYEVNCTYFDALGR
FT                   TFDRGEARKVDRFICAQTIPMSLEGIPAFYIHAMLATANDHDAVARRGMNRAINRHRWD
FT                   YGELKARLNDADSAQAQVMSALSERLRVRAEQPAFHPNATQFTLQLDDRVFALWRQSLD
FT                   RAQSIFALHNVSGDGVILHPGALNLIEGETWRDLLSGDMFESDAEITLAPYQCRWITNQ
FT                   A"
FT   gene            430269..430526
FT                   /locus_tag="TM1040_0419"
FT   CDS_pept        430269..430526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63152"
FT                   /db_xref="InterPro:IPR018654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJL4"
FT                   /protein_id="ABF63152.1"
FT                   /translation="MNISKNEQRVLHVLAQGGRILYERAPNGRVTEVTCYTREGLILAN
FT                   CKLDVFNKLRRKRLVESKSSRPYQISEKGRRSVRAQLDNR"
FT   gene            complement(430753..431982)
FT                   /locus_tag="TM1040_0420"
FT   CDS_pept        complement(430753..431982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0420"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63153"
FT                   /db_xref="GOA:Q1GJL3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL3"
FT                   /protein_id="ABF63153.1"
FT                   /translation="MADFHQNGNIAQFHNLRSRPVEELEYELTTFAQTRKISLILPCLY
FT                   SELEGPALRPILDELARVPYLHHIVIGLDRASEAEYRHARTYFASLPQSHRVLWNDSPR
FT                   MKQLGARLAAQGLAPPEPGKGKNVWSCIGYLLAQAESSVVAIHDCDISTYSKEMLARLV
FT                   YPVAHPAFSYQLSKGFYARVGGGKLNGRVSRLLVSPLLIALKRTIGDRDYIDYLRSFRY
FT                   PLSGEMALRAPLLPDLRIPSDWGLEIGVLSEAWRNLGRKAVCQVEIADNYDHKHQSLSP
FT                   EDASAGLNRMSTDICKAIFRKLAADGTVFTPNVFRTLKATYYRSALDLLEAYAHDAMMN
FT                   GLALDRHGEEKMVEMFANNIMAAGQVFLENPHETPFIPNWNRIHSANPTFLQDLKAAAL
FT                   ADEAEYSPSP"
FT   gene            complement(431975..432754)
FT                   /locus_tag="TM1040_0421"
FT   CDS_pept        complement(431975..432754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0421"
FT                   /product="HAD-superfamily hydrolase YedP"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63154"
FT                   /db_xref="GOA:Q1GJL2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL2"
FT                   /protein_id="ABF63154.1"
FT                   /translation="MPRLLVFSDLDGTLLDHTTYSHAAAQPALSALRSRDAVLILASSK
FT                   TAVEMLPLHQELGLGDAPMIVENGSACQRPTEIDSDPATYNKLRRLLTRLEMPFEGFGD
FT                   MSTQKVAALTGLSDEGAVRAKTRQFSEPGIWHGTPAQKDAFLAALAREGVTARQGGRFL
FT                   TLSYGATKAQQMQKIRQQHAPCFTVALGDAPNDAEMIATADIGVIVRNDHGPDMPAIPP
FT                   EHRIMHTQQEGPKGWNAAMLQILSEWDHDHKGAAAHG"
FT   gene            432884..434839
FT                   /locus_tag="TM1040_0422"
FT   CDS_pept        432884..434839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0422"
FT                   /product="BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63155"
FT                   /db_xref="GOA:Q1GJL1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL1"
FT                   /protein_id="ABF63155.1"
FT                   /translation="MPVFCAKFAYGRDAAARRDWICGFATWLSASRHPPEFQSQRMPHR
FT                   RVFLSDRSWRRWRQIETIAQSTCRLLLRWQPRLRPAHSPEVAFPQQRGPTTMPLKPPLT
FT                   ELEIKTADSGFYKGFTKDVTITAKILVAALILWAVAFPNQAASVLSHLNGVILASFNYW
FT                   YIYVVAFFVVVSLGLAIWPASGRLRLGAEHEKPEFSAFSWFSMMFGAGMGIGVLTYATG
FT                   EPIYHFQNNPDVIQGFVEGASAETVRSAYKWSFLHWGLSPWGAYALTGLALAFFAYRRG
FT                   LPLTIRSALTPLFGDRLSGFAGHAVDVVAVIATVLGVAQTLGFGVEQFVAGLSRIGFGD
FT                   WLLVTTDEGTQKASVVAIVLSLVIIMGASTLSALSGVGKGIKWLSNINMGLSVFLLSFF
FT                   LIFGSTVFGLTALVTGIYDYLLAFPAMLFTVWSDKGTETSSALESWQGGWTIFYWAWWI
FT                   AFAPFVGLFLARISRGRTIREYVFGAMLVPSVMCFVWFALIGGTAIDLELSGIAEGAIL
FT                   GTGLSDQLYATLAVLLSDGLAWVFSVVVAVLLMTYLVTSADSAVLIINTINAAGDEGPK
FT                   ARPHIIFWGVALALVVGALLIIGGLGAIQTAMIIGALPFSVVMALMGVALIKAIILDGL
FT                   RGRAGLPVTADQLAGE"
FT   gene            434944..435714
FT                   /locus_tag="TM1040_0423"
FT   CDS_pept        434944..435714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0423"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63156"
FT                   /db_xref="GOA:Q1GJL0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJL0"
FT                   /protein_id="ABF63156.1"
FT                   /translation="MHSNAWPSGAKPLSLLVTKRKGPPMPAAQPDYVIAPPPQPALPIA
FT                   ESTALFPVRRVYCIGRNYAAHAVEMGHDPDREPPFFFQKTPDSLDASGRFPYPVMSEDV
FT                   HHEAELLVALGKGGENISEDAALDHVWGYGLALDMTRRDLQGIAKKAGRPWEIGKSFEH
FT                   AAPVAPLTPATTIGHPDAGVMTLTVNGTPRQQGDLNQMIWKIPEMIAHLSQYYRLAAGD
FT                   VILTGTPAGVGPVLRGDQLELTFDGLTPLRVLVE"
FT   gene            435852..437273
FT                   /locus_tag="TM1040_0424"
FT   CDS_pept        435852..437273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63157"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK9"
FT                   /protein_id="ABF63157.1"
FT                   /translation="MTVEFDAARLGPILYYRGLEGDALQLAAMVMLPIGERPETLRTDA
FT                   GDHAPTLLREIGRSAVWRYDFGLTPSCGSYRLGDQSYDVQTDLHGDMRIAFASCNGEEK
FT                   GDLDRDQEERNRMWAHMCAEHRRAPFALLLQGGDQIYADEATEGHPLSEDWPDKAGRPR
FT                   NAEELKDLADHLRLRFAERYVQALFGEAPSWIMARVPTLAIWDDHDICDGWGSLYRSKT
FT                   HSEVGQCLYAVAREMYLLFQHAAVEGDIPDLFMDETGTSLSWQRALPGVKLLAPDLRAE
FT                   RGRRQVLGAYGWSAVEAMKPGSEHTFVISSVPLLGPRLSLVEGLMLMIPTMQKYEDDLR
FT                   DQWQSRAHRKEWIRMLKQVIAWREEAPVTILSGEIHLATRAEMGPDETRVHQLVASGIA
FT                   HRAPPQSYARSLGTLAGLGDAPVSGHPIRIHPLPGQSQRYTAERNYLELRRTHGKWHAV
FT                   WHLEESGDTVPMVLE"
FT   gene            437482..437877
FT                   /locus_tag="TM1040_0425"
FT   CDS_pept        437482..437877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63158"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK8"
FT                   /protein_id="ABF63158.1"
FT                   /translation="MSEKDQRRPSGLRGAEFLGVATALILAVLAGQGQARLPHDTGFAA
FT                   LQGPGATPLSRDRRVVKAPMPQMSPLSWRCQLVCDETGHVRQSCLMLADPRLSSIGQRL
FT                   DYLSKNKSALKSLGDLGLSDLTETPTC"
FT   gene            complement(437908..439386)
FT                   /locus_tag="TM1040_0426"
FT   CDS_pept        complement(437908..439386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0426"
FT                   /product="Mannitol dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63159"
FT                   /db_xref="GOA:Q1GJK7"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK7"
FT                   /protein_id="ABF63159.1"
FT                   /translation="MTSLRLSNDTLSDLPKHITRPTYDRAALTAGILHIGLGNFHRAHQ
FT                   SWYLHRLMQQGEAQDWAIIGAGVRDYDAAMRARLKAQDCLTTLIALSPDTTSAEVVGSM
FT                   IDYLPIEADNGALIAAMARPEIRIVSMTVTEGGYYRDPVSGAFDDTHPDILHDIANPST
FT                   PRTVFGAIIAALALRRTAGVGPFSVQSCDNLQGNGDVTRQTVLGLARRSDPELASWIAA
FT                   QCTFPNSMVDCIVPATGPAEIALAAEMGVADQAPVTHEPYRQWVIEDNFCAGRPDWDKV
FT                   GATFTNQVHAYETMKIRILNAGHQVIANAGELLSCETIADCMQDPDIRSMFEKVETQEI
FT                   APYVSPVPGITADAYVALIADRFSNPAIHDTTRRVAFDGSSRHAGFILPILRDALAARG
FT                   PVDGLALVEALWARMCAGLREDGTEIEANDPNWPQLQQAAQAARTAPEVWLAQSEYYGD
FT                   LAQETHFADRFCHWHALIWSKGTREALRSYTTQI"
FT   gene            complement(439386..440156)
FT                   /locus_tag="TM1040_0427"
FT   CDS_pept        complement(439386..440156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0427"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63160"
FT                   /db_xref="GOA:Q1GJK6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK6"
FT                   /protein_id="ABF63160.1"
FT                   /translation="MRLEGKTALITGAARGIGRSFAEAYIREGARVAVADIDTERARQT
FT                   ALELGDQAVAIELDVTCQESIERAVEQTVEALGCIDILVNNAAIFTAAPITEIHRDDFE
FT                   RVFDINVAGTLFTMQAVAKHMISRGAGGKIINMASQAGRRGEALVAVYCASKAAIISLT
FT                   QSAGLNLIQHGINVNAIAPGVVDGEHWDGVDAFFAKYENKAPGEKKREVGDAVPFGRMG
FT                   TADDLTGMAIFLASAEADYVVSQTYNVDGGNWMS"
FT   gene            complement(440156..441160)
FT                   /locus_tag="TM1040_0428"
FT   CDS_pept        complement(440156..441160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0428"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63161"
FT                   /db_xref="GOA:Q1GJK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK5"
FT                   /protein_id="ABF63161.1"
FT                   /translation="MGRITLDKVTKSFGATEVIPPLDLTIEDGEFTVFVGPSGCGKSTL
FT                   LRLIAGLEDVTSGQIRIDGQDATMTPPAKRGLAMVFQSYALYPHMSVRKNIAFPMKMAG
FT                   IDDAEQTRRIDAAAKALNLTDYLDRKPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSN
FT                   LDAALRVGMRMEISELHKKLATTMIYVTHDQVEAMTMADKIVVLRAGHIEQVGSPLELY
FT                   HSPRNLFVAGFIGSPKMNFIEGDEAAKYDAHTIGVRPEHIDIGESGGMWSGVVGVSEHL
FT                   GSDTFFHIHDTGLAETITVRADGEVGFRHGDRVSLTPRTDVMHRFDAQGLRIP"
FT   gene            complement(441173..442003)
FT                   /locus_tag="TM1040_0429"
FT   CDS_pept        complement(441173..442003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0429"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63162"
FT                   /db_xref="GOA:Q1GJK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK4"
FT                   /protein_id="ABF63162.1"
FT                   /translation="MARSVTQHRKAINTIAAWSVGLLIFFPILWTILTSFKTEAQAIND
FT                   PPLFLAFDWTLENYAVVQERSNYLRFLWNSIAIAGGSTLLGILIAVPAAWSMAFVPSKR
FT                   TKDILLWMLSTKMLPAVGVLYPIYLIFIRLGLLDSRTGLIVVLMLCNLPIIIWMLYTYF
FT                   KEIPGEILEAARMDGATLKEEILYVLTPMAIPGIASTVLLNIILAWNEAFWTLNLTAAK
FT                   AAPLTAFIASYSSPEGLFYAKLSAASTMAIAPILILGWFSQKQLVRGLTFGAVK"
FT   gene            complement(442019..442885)
FT                   /locus_tag="TM1040_0430"
FT   CDS_pept        complement(442019..442885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0430"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63163"
FT                   /db_xref="GOA:Q1GJK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK3"
FT                   /protein_id="ABF63163.1"
FT                   /translation="MATQHSRSAARFMMAPAVILLLGWMLVPLTMTLLFSFKKYLPLRG
FT                   GDLGWVGFDNYVRFVSSSAFWPSVQATLLIVGGVLVITVIFGVLLALLLDQPMWGQGIV
FT                   RILVIAPFFVMPTVSALVWKNMFMDPVNGLFAHLWKFFGAEPIAWLSEASMQSVIIIVS
FT                   WQWLPFATLILLTAIQSLDREQLEAAEMDGASPLARFGYIILPHLGRAITVVVLIQTIF
FT                   LLSIFAEIFVTTQGSFGTRTLTYLIFQRVLESQNVGLGSAGGVYAIILANIVAAFLMRI
FT                   VGKNLDA"
FT   gene            complement(442988..444295)
FT                   /locus_tag="TM1040_0431"
FT   CDS_pept        complement(442988..444295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0431"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63164"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK2"
FT                   /protein_id="ABF63164.1"
FT                   /translation="MYLRNALCAASALAVMATGAVQAETTLTIATVNNGDMIRMQGLTD
FT                   DFTAKHPDIQLEWVTLEENVLRQRVTQDIATNGGQFDVMTIGMYETPIWAAQNWLVPLT
FT                   DMGADYDADDILPAMRAGLSHNGTLYAAPFYGESSMVMYRTDLMEAAGLTMPEAPTWEF
FT                   IKEAAAAMTDKDAEIYGACLRGKAGWGENMAFITTVANSFGARWFDEDWTPQLDSPEWK
FT                   EAVTFYNDLLQSYGPPGASTNGFNENLALFQQGKCGMWIDATVAASFVTNPDDSTVADK
FT                   VGFALAPDTGKGKRANWLWAWALAVPAGSDAKDEAKAFIEWATSKEYLALVAENEGWAN
FT                   VPPGSRTSLYENPEYAKVPFAQMTLDSINAADPNSPTVDPVPYVGIQYVAIPEWAGIGT
FT                   SAGQEFSAMVAGQQTPDEALAKAQALVADEMEAAGY"
FT   gene            complement(444427..445458)
FT                   /locus_tag="TM1040_0432"
FT   CDS_pept        complement(444427..445458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0432"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63165"
FT                   /db_xref="GOA:Q1GJK1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK1"
FT                   /protein_id="ABF63165.1"
FT                   /translation="MSESKIRNMEELASVSGISRPTLSKYFNNPDSVRASTRKKVEAAL
FT                   QEHHYQPNIYAMNQNRRLTKNIGIVVPYLADPFFAEIARVIENLVIQGGFRPILLSSHG
FT                   ETRQEVENLDSLRSIRPAGVLLAPLGRRSDTAAVDRFCTDVPTVLFDNNLDDLGQAFFG
FT                   LDNPQSVGLMVKHLCKTGEPPVFFEMKTPTNPNAYKRRRAYIDTMEALGLDPKLVQVEG
FT                   ETWDFEEIGYKGGLAAIRNRELCTNTVLCSNDRLAIGFLAAAYECGLRVGCGTGCALRV
FT                   AGHDDHPYARFTCPPLTTIAQDYSAIATRSVEAILNLIESGEHPDLRNSTLFEGTLIKR
FT                   ASA"
FT   gene            complement(445657..447987)
FT                   /gene="mcpJ"
FT                   /locus_tag="TM1040_0433"
FT   CDS_pept        complement(445657..447987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpJ"
FT                   /locus_tag="TM1040_0433"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63166"
FT                   /db_xref="GOA:Q1GJK0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJK0"
FT                   /protein_id="ABF63166.1"
FT                   /translation="MRTLPKCACMTLKETTPVLLKPSSVSLKLKLPVLMVALTVAFVVT
FT                   VSLLIYTMAERSIHEKVASAKESKAHAGAQALRFSIDAAQRDVSNLAALPTTFRAINNF
FT                   ERVIGMIEVDDKIGFLKTHYIVENPNTEEERAALVDPGDGSYYSQSHVTYHPTFVQTAE
FT                   LSGYSDIYLITPAGLVAYSVHKKGDFAENINDSVLADTALSRVAQAALAAEPGSVVVED
FT                   FSAYGPSGAVDAFLASPILNKRGDPVGVIAVRIGTDFVQSALNANLADDGYENIFLVDP
FT                   DGRTKSPGMIAGAFSLLSVLPDAPHIAAARAGEAGNFTATVTALGTPATAVVVPLDLNG
FT                   FDWSVVMETDSAQAFAVIYRIRWMVLSLIGASIVVSIGVSWAAANRVTRPIHQLRDATN
FT                   ALAQEDYDIAISGLSRGDEFGDLARSLDTFRDKLKSADEAAEREEEAKRETDFVVDEMS
FT                   RALAQLQDGNLVSEIEHPFSEDYETLRENYNHSLQNLRNSLREVVEASQHVDRFSQEQR
FT                   AAANEMAERTESQGSTLEKTATAMQDLSQRLRETAEKATEVDSTMRGTRREAEQSNEVV
FT                   RSAVAAMDQIQQASSEIAKFINMIDDIAFQTNLLALNAGVEAARAGEAGAGFAVVASEV
FT                   RNLARRASEAAGEIKTLTSASEEHVANGVSMVDKAGNALTSIIAQVSSVGDLVSEIAGG
FT                   VQHQSQGLEDINTAMRELDAVTQQNTAMAEEASASSQLLQSEARTLSSVTGRFQIDPPM
FT                   STDAPASWDDGSDTPAASHEAAG"
FT   gene            complement(448712..451171)
FT                   /locus_tag="TM1040_0434"
FT   CDS_pept        complement(448712..451171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0434"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63167"
FT                   /db_xref="GOA:Q1GJJ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ9"
FT                   /protein_id="ABF63167.1"
FT                   /translation="MPSSLPTQAQVVIIGGGSIGCNIAYHLTQLGMTDVVILERDKLTA
FT                   GTTWHAAGEIVPAVLGAEWECELYLHGRELIAGLEAETGLATGWREVGYIQPADTAERL
FT                   EEMRRGAAFMNLHGFEIHEISPREAQERFPIGDFSNTLAAFWYPKEGRTNPVDTTMALA
FT                   RGARTRGAQILEDVAVTDILTRQGRAVGVRTDHGDIAAEHVVIAAGMWSRQIGAKAGLN
FT                   LPLQAAEHYYLITEEIEGIHRDLPLLEDPHNWSYYREEVGGLLVGMFEPDAAPWMIDAI
FT                   PDNFAFGEIEPDWDRMAPHLEAAFSRVPLVAEAGVRKLFCGPESFTPDLAPLIGEAPSL
FT                   RNCWVAAGMNSLGILYGPGVGKTLAHWIVEGRCPVDHTAFNVSRFADGTHNTPAYRRAR
FT                   TPELLAKSFGAHFPNDSFKTARGLKRSPLYDRLRAAGAYFTESHGWELPDWFAPTPEAA
FT                   KIDRYSWGRQNWFDWHAEEHRAAREDAIVMDMSSMAKFLVQGRDACTLLNRISCNDIDV
FT                   PIGKVVYTAWTNQAGGFEADLTVTRMDVDRFMVVVGENSHGHTETWMRRHIGADEFVTI
FT                   TDMTDGITQINLHGPKARDILAKVSAADLSQEAFPFMTAQHIDVGLFRIHALRVTYVGE
FT                   LGWELHVPSLHAVQVYDLLMQAGADHGLRNAGMQTLSSLRLEKAYRDFGVDLDNTDTPI
FT                   EAGLGFAVKLDKPGGFIGRDALAKIKAAGAPKRRMLQFLLRDPEPLLHGNEIIYLDDKP
FT                   VGYIQVGAYGHTLQGAVGIGFAEIETPLTSEIATSGAWSIDIAGTKIAATASLKPLFDP
FT                   AMERVRK"
FT   gene            451273..451926
FT                   /locus_tag="TM1040_0435"
FT   CDS_pept        451273..451926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0435"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63168"
FT                   /db_xref="GOA:Q1GJJ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ8"
FT                   /protein_id="ABF63168.1"
FT                   /translation="MSDNLPKKQPRTAPPEARREQLIDATITAISTYGLSGTTLAKVTA
FT                   EAGLSLGLVNFHFKSKEALLTATLTHLADEHRALWFTRSSQPDVSAADKLKLIVDAQFH
FT                   AKICNRRKLSVWFAFFGESRPRKAYRELTGPLDEERQIATSRLCADIIAEGGYSGIDSD
FT                   TVSAMLESLFDGFWLNILMYPDRFTRQSAKAQVLSYLRLCFPQHFTCLDAETFA"
FT   gene            complement(452000..452076)
FT                   /locus_tag="TM1040_R0010"
FT                   /note="tRNA-Met7"
FT   tRNA            complement(452000..452076)
FT                   /locus_tag="TM1040_R0010"
FT                   /product="tRNA-Met"
FT   gene            complement(452191..453096)
FT                   /locus_tag="TM1040_0436"
FT   CDS_pept        complement(452191..453096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0436"
FT                   /product="PaaX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63169"
FT                   /db_xref="GOA:Q1GJJ7"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ7"
FT                   /protein_id="ABF63169.1"
FT                   /translation="MAVGLALTRASPYRICMTQHTDDWFTTAITALTEPDGLRVWSIIV
FT                   SFLGDMAQDKGAGVSSAALTRVITPLGIKPEAIRVALHRLRKDGWTESQRRGRGSFHFL
FT                   TPFGRQQSALVTPRIYARSTCETDAWTLLVAGTPDGLETLDALCDQTPLTSIRVNRHAA
FT                   ITPGPAMQHAAETSHMLVANLDVAHVPGWLQDDLFPEPLRQSCAALDQALAPLGSPPDL
FT                   SPLQRACLRTLLVHRWRRITLRHPDVPRIFHPADWSGESCRTRVFALLDKLPQPELAEI
FT                   EDAAPVAVQAAPQGTIAVTG"
FT   gene            complement(453126..455156)
FT                   /locus_tag="TM1040_0437"
FT   CDS_pept        complement(453126..455156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0437"
FT                   /product="Phenylacetic acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63170"
FT                   /db_xref="GOA:Q1GJJ6"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ6"
FT                   /protein_id="ABF63170.1"
FT                   /translation="MCPKDVASFAAGEWIAPDHSAREIASAITGEVIARAGNATLDVQA
FT                   MLDHARDTGGPALRAMTFHDRARMLKALAQHLDAHKQELYDQSFDTGATQKDHLIDVDG
FT                   GIGTVFVFASKGRREMPDSTVYTDGAVEQLSRHGSFMGQHICTSLPGVAVHINAFNFPV
FT                   WGMLEKLAPTLLAGVPAIVKPATATCYVTEAAVRLMLDSGLLPEGALQLVSGGLGDMLD
FT                   RLTCQDVVSFTGSAATALKLRQTPAIVENSVRFVAEQDSLNASILGPDAAPGSAEFDLF
FT                   LKEVQREMTTKAGQKCTAIRRIIVPDAQVNAVIDGLSAALAKITIGDPRADSTRMGALV
FT                   SAAQKRDVLEQADKIATEATRVFGDPDNFTVEGADKDKGAFVPPMLFHCADPDAARHVH
FT                   DTEAFGPVSTVMGYRDLSHASELANRGQGSLVASLITADPVVAREVTLNIAAFHGRVYI
FT                   NNATSMKESTGHGSPLPHMVHGGPGRAGGGEELGGVRAVKHYMQRTAVQGSPEILSAIT
FT                   GKWVPGGPETTGPAHPFTRRFGALTIGETLHTAPRVVTSDDVAHFAQFTGDTFYAHMDD
FT                   AAAERNPFFPGRVAHGYLLLSFAAGMFVEPNEGPVLANTGLDNLRFMKPVVPGDSIKVR
FT                   LTVKAKTPRNEEYGEVRWHVTLTNQDDELVAEYDLLTMVAF"
FT   gene            455317..456102
FT                   /locus_tag="TM1040_0438"
FT   CDS_pept        455317..456102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0438"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63171"
FT                   /db_xref="GOA:Q1GJJ5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ5"
FT                   /protein_id="ABF63171.1"
FT                   /translation="MEQSILTQDHDTWCEITLNRPDRLNAFTDEMHLALRAALEEARDS
FT                   GKRALLLTGAGRGFCAGQDLSARNPDAAGGPVDLGYTVRTFYAPLVNLIRSLEFPVVCA
FT                   VNGVAAGAGANLSLAADIVLAAQSAKFIQSFAKVGLIPDTAGSYHLPRLLGEARAKALA
FT                   LTGEPLSAEQAADWGLIWKCVADEALMDEARTLTAKLADGPTLGLGLTKSLIQTSGAYT
FT                   LAEQLEREADAMKTCGESADYAEGVRAFLEKRTPVFRGQ"
FT   gene            456106..456537
FT                   /locus_tag="TM1040_0439"
FT   CDS_pept        456106..456537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0439"
FT                   /product="Phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63172"
FT                   /db_xref="GOA:Q1GJJ4"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ4"
FT                   /protein_id="ABF63172.1"
FT                   /translation="MSLTAQQRAEKSAQAMWADDQASKWAGMGIERVDEGSAALALTVE
FT                   AHHCNGHGICHGGVIFMLADSAFAFACNSRNQATVAQHNMISFIAPGRKGDRLLAEARE
FT                   VSLTGRSGIYDVSVKNQDGQLIAEMRGCSRAIKGHLFEE"
FT   gene            456593..457903
FT                   /gene="paaF"
FT                   /locus_tag="TM1040_0440"
FT   CDS_pept        456593..457903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaF"
FT                   /locus_tag="TM1040_0440"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63173"
FT                   /db_xref="GOA:Q1GJJ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ3"
FT                   /protein_id="ABF63173.1"
FT                   /translation="MLDLTPNRDELDPIEIASIDEIRSLQLERLKWSLRHAYDNVAMYK
FT                   ARFDAAGVHPDDLQELSDLAKFPFTTKGDLRDAYPFGMFAVPREQILRLHASSGTTGKP
FT                   TVVGYTRKDIDTWADLLARSLRASGLRRGDMVHNAYGYGLFTGGLGAHYGIERLGATVV
FT                   PMSGGQTEKQVTLIEDFRPDGIMVTPSYMLNILEQYHRMGIDPRSSSLKVGVFGAEPWT
FT                   DAMRREVEAAFDMHAVDIYGLSEIMGPGVANECVETKDGPVIWEDHFLPEIIDPETGAV
FT                   LPDGELGELVFTTLTKEGLPMVRYRTRDLTRLLPGTARSMRRMAKITGRSDDMIILRGV
FT                   NVFPSQIEEQMLTVEALAPYYQIELYSKGRMDAMRIHVEVLPAATAPEQREACTKQLAK
FT                   RIKDIVGISAEISVGEPGSVERSQGKARRVVDNRNKG"
FT   gene            457910..458506
FT                   /locus_tag="TM1040_0441"
FT   CDS_pept        457910..458506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0441"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63174"
FT                   /db_xref="GOA:Q1GJJ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ2"
FT                   /protein_id="ABF63174.1"
FT                   /translation="MARTIAKDHDQKRAQILAASARLFAEEGYDRASMTQIARACGISK
FT                   ANIYHYYEGKDALLFDLLDSYLRGLRDRVCGLELSDPDPVVRLRLILTEVLLAYEGADH
FT                   EHKVQLNAMSALPEPQQEHLRAYQREMVKFMSAAIRDAAPDTLAADKDKLRAVTMSVFG
FT                   MLNWHYMWNAGADTEDRKGYADVVARLTLHGVSGL"
FT   gene            458711..458974
FT                   /locus_tag="TM1040_0442"
FT   CDS_pept        458711..458974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0442"
FT                   /product="17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63175"
FT                   /db_xref="GOA:Q1GJJ1"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ1"
FT                   /protein_id="ABF63175.1"
FT                   /translation="MSKTSGLLATLFAASVLVAGCSDNQDINAVSGALAGAAVGNQVGS
FT                   GSGKVAATLIGGAVGAQIGANAPRQCTYRNSAGQTYKAACPS"
FT   gene            complement(459119..460147)
FT                   /locus_tag="TM1040_0443"
FT   CDS_pept        complement(459119..460147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0443"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63176"
FT                   /db_xref="GOA:Q1GJJ0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJJ0"
FT                   /protein_id="ABF63176.1"
FT                   /translation="MSETSFTPRVFSGIQPSGNLHLGNYLGALKRFVDWQSRDVESIYC
FT                   MVDLHAITVWQDPADLKKATRELCAGFIAAGLDPEKSILINQSQVPEHAQLAWIFNCVA
FT                   RMGWMQRMTQWKDKAGKNQQNASLGLLAYPSLMAADILIYHATHVPVGEDQKQHLELTR
FT                   DIATKFNHDYGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADTI
FT                   AKKIRKAKTDPEALPSEAKGLEERPEARNLVNIYAAMADQTVDQVLADVGGKQFSEFKP
FT                   MLADLAVERMAPITTEMARLMENQDEIDKILARGSERARAITAPILRKTYDIVGMVAPV
FT                   EI"
FT   gene            460262..460948
FT                   /locus_tag="TM1040_0444"
FT   CDS_pept        460262..460948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0444"
FT                   /product="Rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63177"
FT                   /db_xref="GOA:Q1GJI9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI9"
FT                   /protein_id="ABF63177.1"
FT                   /translation="MQDQNQSPFNALPPVVVALVIVIIGIEAMFSFGARGYIGGPEAVG
FT                   WRLNALQEYGFGAQYFWWMWENGTWPFDLLKRFVTYAFVHGAFTQAVFVCVFLLAMGKM
FT                   VGEAMGEIAVVLIFIGSAIGGALAYALLVGGNVALFGGFPAVYGLIGGFTHLLWLSLAT
FT                   VGAQQYRAFTLIAFLMGVQLLFGLIFGGSPEWVADLAGFVTGFVMSFFLVPGGWARILQ
FT                   KLRQDR"
FT   gene            complement(460965..462512)
FT                   /locus_tag="TM1040_0445"
FT   CDS_pept        complement(460965..462512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0445"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63178"
FT                   /db_xref="GOA:Q1GJI8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI8"
FT                   /protein_id="ABF63178.1"
FT                   /translation="MKPIKLMSGFLTVGFWTLASRVLGFLREILIAAYIGPGLLGDAFY
FT                   AAFRLPNLFRRFFAEGAFNAAFVPMFAKRWEAGENPQGFAQDAFNLLAAAVLGLTALGM
FT                   VFMPFLVWLTAGGFEGDARFDLTVGYGRIVFPYILCMSLAALFSGVLNATGRFAAAAAA
FT                   PVLLNIFACAAMIAGALRGQAVIDWLVWVVPLAGIAQLALVWIAAARAGVSLRPGLPRL
FT                   TPEMRQLVRVALPAALAMGVTQVNLVVGQAVASAYQGAVSWLSLADRLYQLPLGVVGIA
FT                   VGIVLLPDLSRRLRAGDDEGARDAFSRAGEFSLLLTIPAAAALIAIPVPLVSVLYERGA
FT                   TGAEDVAAIAMAVAIYGAGLPAFVLQKVLQPLFFAREDTRSPFHYALVAMVVNAVLAVG
FT                   LQPLVGWLAPAIAAPAAGWVMVLQLWLGSRRMGEAAQFDARFQRRCLRIVLASVAMGVV
FT                   LLGAATILSDVLSLAYWRYLALLALIVVGAVAYFTIGQIIGAFRLSEFRSALRRGKA"
FT   gene            complement(462509..465190)
FT                   /locus_tag="TM1040_0446"
FT   CDS_pept        complement(462509..465190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0446"
FT                   /product="UTP-GlnB uridylyltransferase GlnD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63179"
FT                   /db_xref="GOA:Q1GJI7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI7"
FT                   /protein_id="ABF63179.1"
FT                   /translation="MAQDHQGAEFRAAVVALLREANKSGRSAIAEAFELQPFAARELAR
FT                   SYTYLTDGLVTSAQMAAVEVLHPIATPTTGERISVFAVGGYGRGEMAPFSDVDLLFLTP
FT                   YKITAWAESVIESMLYILWDLRLKVGHSSRTIKDCIRLGSEDFTIRTAMLEHRFLAGHG
FT                   PLAAELEARLAKDLFAKDSAEFIDAKLAERDARHLKQGERYMVEPNVKEGKGGLRDLQS
FT                   LFWIAKYLYKVQDVAELVPLGLFRPEEFDFFAKAENFLWAVRAHLHLSAGRATEQLTFD
FT                   MQVQVAERMGYEDTSGRRAVEVFMQDYFRHATQVGDVTRILLSKLEDSQLKSEPLLERI
FT                   FRRKPRVKPGYRIHHNRLEIADPESFLEDKLNLLRMFEEALRTGLLLHPDSMRLVRANL
FT                   HLIDDEMRNSPDAQRIFLDLLLKHGNPERVLRRMNELGVLSTLIPEFEPIVAMMQFNMY
FT                   HSYTVDEHTIQVISNFSAIERGELENELPLSSSLIKQGVNRKVLIIAMLLHDIGKGRPQ
FT                   DHSILGAQIARKVAPRLGLNKSESETVEWLVRYHLLMSDTAQKRDIADPRTVRDFAKAV
FT                   QTVKRLDLLLLLTVCDIRGVGPDTWNNWKAVLLRALYSQTRDAMENGLEAFNREHRGTE
FT                   AKKRLRTALPDWEKAAVKRETARHYPPYWQGLHVTAHVDFAEMLREIDALDDPSAMLVR
FT                   LHPDEDRDATRACFVMPDHPGIFARIAGALALVGANVVDARSYTTKDGFVTDAFWIQDA
FT                   DGHPFEASRLPRLRSMIEKTLRGEVIARDALKSRDKIKKRERAFRVPTHITFDNDGSDI
FT                   YTIIEVDTRDRPGLLYDLARTLAASNVYIANAVIATYGEQVVDSFYVKDMFGLKYHSAS
FT                   KQQSLEKKLREAIVDGAKRADT"
FT   gene            complement(465297..466481)
FT                   /locus_tag="TM1040_0447"
FT   CDS_pept        complement(465297..466481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0447"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63180"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI6"
FT                   /protein_id="ABF63180.1"
FT                   /translation="MRFMFAVFNRARKIALTATAVVASAFVAACDPGALSGGGPTINTS
FT                   KPVPVALLVPRGSAQHGDGVLAQSLENAARLAIADLNGVEVDLRVYDTAGNPETAAAVA
FT                   SQAVQDGARIILGPVYAEAANAAGIAAAKRGVNVLAFSNNASIAGGNVFVLGSTFENSA
FT                   NRLTQYAKRQGKNSMVVVSGNNAAGQAGRSAIQQAAVQSGMTITGNVSYELSQQGVINA
FT                   IPTISQNVRQNKADVMFMTATTAGALPLLSQLLPEAGVTPEDVQYMGLTRWDIPAQTLE
FT                   LPGVQNGWFALPDPQKSASFRARYQSAYGAAPHPIGGLAYDGIAAIGALVSSGNSGALT
FT                   GAALTQPAGFQGTGGIFRLRPDGTSERGLAIATIQDKKVVIIDPAPRSFPGAGS"
FT   gene            466570..467433
FT                   /locus_tag="TM1040_0448"
FT   CDS_pept        466570..467433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0448"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63181"
FT                   /db_xref="GOA:Q1GJI5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI5"
FT                   /protein_id="ABF63181.1"
FT                   /translation="MNHKIVSLPPGLYFVATPIGTARDITLRALDILASADVIAAEDTR
FT                   SMRKLLDIHGVPLGDRPVVAYHDHSGTGARARLMADLAAGKSVAYASEAGMPMIADPGY
FT                   DLSREAARAGHLVTAAPGASAALCALTLAGLPTDAFFFAGFLPNASGARRKRLQEVGNI
FT                   PGTLVFYESPKRVAASLADMAEVLGARDAALCRELTKKFEEVRRGPLAELASGLADAPV
FT                   KGEIVILVDRQRAATVTAADLEADLRAALRENSVKDAAAIVAEAHGEPRRKIYQQALQI
FT                   AREDQG"
FT   gene            467439..467813
FT                   /locus_tag="TM1040_0449"
FT   CDS_pept        467439..467813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0449"
FT                   /product="protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63182"
FT                   /db_xref="GOA:Q1GJI4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJI4"
FT                   /protein_id="ABF63182.1"
FT                   /translation="MTQDARARGQNAHFAGAAAEEIAIRAYLARGLTLVKSRWRGPHGE
FT                   IDLILRDGETVIFAEVKSSTTRDKAAARIKPAQMQRVFNSAGAFLEGEPLGQLTPARLD
FT                   VVLVWGAGEVEIIENAYGHG"
FT   gene            467874..468809
FT                   /locus_tag="TM1040_0450"
FT   CDS_pept        467874..468809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0450"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63183"
FT                   /db_xref="GOA:Q1GJI3"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI3"
FT                   /protein_id="ABF63183.1"
FT                   /translation="MKIAFQMDPIMGVDVNADSSFRLAEEAQKRGHELFYYSPDQLAYQ
FT                   EGRITARGHDMVVQRVEGTPATLGELREVDLADFDVIWLRQDPPFDMHYITSTHLLDRL
FT                   KGQALVVNDPFWVRNYPEKLLVLNFPDLTPPTTIARDLETIKAFKAKHGDVILKPLYGN
FT                   GGAGVFRLDANDRNLSSLHELFTGFSREPLIVQKFLPDVSNGDKRVILVDGEPVGAINR
FT                   VPAAGETRSNMHVGGRPEKIGLTERDLEICAAIGPLLKEKGQVFVGIDVIGDYLTEINV
FT                   TSPTGIQELERFNGVNIAEKVWEAIEARVA"
FT   gene            468806..469702
FT                   /locus_tag="TM1040_0451"
FT   CDS_pept        468806..469702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0451"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63184"
FT                   /db_xref="GOA:Q1GJI2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI2"
FT                   /protein_id="ABF63184.1"
FT                   /translation="MSLALDLLLVGLRHVVRPRLRRAHGPLEARRAFDRAAAVTFRAPP
FT                   FLCRIKDRAGLDRIHCGPRLHGKIILYFHGGGYVAGGPHTHAAMLGQLSGLSQLEVCAP
FT                   AYPLAPEHPFPAAFEGAVASWEHLMAAGYAPSDVVLGGDSAGGGLALALLSYLCHAATP
FT                   PAAAFAMSPWCDLSLSGDSLQGNAERDPLLPAERIRELVGYILPEGADDTDPRVSPLFA
FT                   EFPTCPPVLLQYSETEILFDDCRRMAERLRGFDADVLERRHPRAPHVWHLFQGWVPEAR
FT                   KSLREIADFARAAFTAR"
FT   gene            complement(469699..471201)
FT                   /locus_tag="TM1040_0452"
FT   CDS_pept        complement(469699..471201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0452"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63185"
FT                   /db_xref="GOA:Q1GJI1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI1"
FT                   /protein_id="ABF63185.1"
FT                   /translation="MISRAQTVAFQGVEACPVEVQCAVAPGLPAFSIVGLPDKAVSEAR
FT                   DRVRSALAVMSIALPAKRITINLSPADLPKEGSHFDLPIAVALLTALEILPPEAAEETL
FT                   SLGELSLDGTLVAITGALPAALTAAEQQRTLLCPKSSSAEAAWVEAATVIGAASLSDVI
FT                   RHFTGQGVLAPAQPGEVLDDPLEKDLADVKGQEGPRRALEIAAAGRHHLLMSGPPGAGK
FT                   SMLAARLPSILPPLSPGEALETSMIQSICGLIKAGGVSRARPFRAPHHTASMAAIVGGG
FT                   RRAHPGEISLAHNGVLFLDELPEFARAVLETLRQPLETGDVMVARANAHVRYPSRFMLV
FT                   AAANPCRCGYLTDPARACPRAPGCGADYMGRISGPLMDRFDLRIEVEPVAFADLERSRP
FT                   GESSASVASRVAQARALQGERYAACDGTHTNADAEGEMLEKVAELGTDSRALLLQAAEQ
FT                   FGLSARGYHRVLRVARTIADLDAEAQIARDHVAEALSYRLPS"
FT   gene            complement(471312..471992)
FT                   /locus_tag="TM1040_0453"
FT   CDS_pept        complement(471312..471992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63186"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJI0"
FT                   /protein_id="ABF63186.1"
FT                   /translation="MTYTLYIADRMYSSWSLRGWLMLEKFSLPYDTRLVGLYNGTMAQD
FT                   LAEVAPARLVPTLVLPDGTVVGETMAMAETLAERHPEAGLWPASEASRATARWLCAEMA
FT                   AGFEALRSACPMQLGHIWQGFEPSEAVLNDLSRLEKLFAHARAVSGHARGPLFGAYSLA
FT                   DVFYTPVAARVIGFDLPVSTETRAYCVELLSDPAVLAWQAEARKVHYDPEPYALDLERK
FT                   PWAL"
FT   gene            complement(472051..472632)
FT                   /locus_tag="TM1040_0454"
FT   CDS_pept        complement(472051..472632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0454"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63187"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH9"
FT                   /protein_id="ABF63187.1"
FT                   /translation="MITRFHMIRHGPTHAKSMVGWSDLPADLSDAAMLSRLSRALPDTA
FT                   VVISSDLSRAVATADAIQGSRTRLPHTSDLREIHFGDWELRRWSEIDAEDPDHIRAFWE
FT                   KPGDVAPPNGESWNRLMQRVSRQFDRLAETYRGQDVVVVGHFGQILCQVQRALGLTATE
FT                   AFAHKIDNLSLSRIDHESTGWSAGAINQIL"
FT   gene            complement(472629..473249)
FT                   /locus_tag="TM1040_0455"
FT   CDS_pept        complement(472629..473249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0455"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63188"
FT                   /db_xref="GOA:Q1GJH8"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH8"
FT                   /protein_id="ABF63188.1"
FT                   /translation="MLYASWSPAKLRIIRAWASWRMMLNAPTTLRIRKLASKVTIILGG
FT                   AASGKSAFAEQACVKTGKSRVYWATSQIFDSEMQEKVARHVDQRGAGWTTIEEPYEAKT
FT                   ALGAAQSQDVLLMDCATMWLTNHLLAENDLEKETRVLLEAIKDCPAEVVIVTNETGLGI
FT                   VPENALARRFREAQGRLNIALAAAADTVVLVAAGLPMTLKGTT"
FT   gene            473334..474212
FT                   /locus_tag="TM1040_0456"
FT   CDS_pept        473334..474212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0456"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63189"
FT                   /db_xref="GOA:Q1GJH7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH7"
FT                   /protein_id="ABF63189.1"
FT                   /translation="MALDETTKNPLPKQAMKAELLDAETELALAYAWRDEKDVQALHRL
FT                   ITAYMRLAVSMASKFRRYGAPMNDLIQEAGLGLMKAAEKFDPDRGVRFSTYAVWWIKAS
FT                   IQDYVMRNWSMVRTGSTSSQKSLFFNMRRVQAQLEREAAGEGVELDRHKLMQMVAEEIG
FT                   VPLRDVEMMDGRLAGADFSLNAVQSADEDGREWIDALEDDSEQAADRVEADHDRRQLRE
FT                   WLLSALNGLNERERFIVRERKLREEARTLESLGNELGLSKERVRQLEAAAFSKMRKSLE
FT                   GQSREVQNFLA"
FT   gene            474209..475072
FT                   /locus_tag="TM1040_0457"
FT   CDS_pept        474209..475072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63190"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH6"
FT                   /protein_id="ABF63190.1"
FT                   /translation="MRNMHFRRGPGGRQFHLAAVLALLPFITNAQALAETKLAHIIEEA
FT                   KQADVVLLGEIHDNPAHHKVQSEVIAEIAPVAVVWEMLTEDQAARLTPDALSDPAGLGE
FT                   VLDWGESGWPAFAMYQPLFEAAPEAQHWGAAVPRSVARDAVAKGAVAFFGVEDAARFGL
FT                   DLALSQEEQAAREAEQQAAHCNALPYDLLPGMVEVQRLRDATLARVALLAREAAPAGAE
FT                   GPVVIVTGNGHARLDRGAPVYLRYAAPDLDLLSLGQAEDGQIRGEFDLVRNAAPIARPD
FT                   PCAAFY"
FT   gene            475190..476401
FT                   /locus_tag="TM1040_0458"
FT   CDS_pept        475190..476401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0458"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="6.3.2.5"
FT                   /EC_number="4.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63191"
FT                   /db_xref="GOA:Q1GJH5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH5"
FT                   /protein_id="ABF63191.1"
FT                   /translation="MLSGKHILLIIGGGIAAYKSLELIRRLQDQGARVTPVLTRAGEEF
FT                   VTPLSVSALAGNAVHRDLFDLTAEAEMGHIQLSRSADLLVVAPATADLMAKMAQGHAND
FT                   LASTLLLATDTPILLAPAMNVRMWEHPATQRNLTQLKNDGVSVVGPNEGGMACGEYGAG
FT                   RLAEPEEIIAAITTRLAAGPLAGKRIIVTSGPTHEPIDPVRYIANRSSGAQGTALARAL
FT                   RALGAEVVFITGPATVRPPEGVQVVPVETASDMHAAVQAALPADAGVFAAAVADWRVAS
FT                   ASDRKLKKTKDGMPRLAFEENPDILREVASQTQDRPGLVVGFAAETNDVVEHATAKRLR
FT                   KGCDWIVANDVSPATGIMGGAENAVILITAEGEEHWPRMPKDQVAQRLAEKIAATLTPP
FT                   VSGG"
FT   gene            476638..477012
FT                   /locus_tag="TM1040_0459"
FT   CDS_pept        476638..477012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63192"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH4"
FT                   /protein_id="ABF63192.1"
FT                   /translation="MTQPAGDILVLEDDITLGQLLCNMIRMYRLGDPYLSLSEVDACQM
FT                   LRERDFKLCFLGLRLRSGVCKRAVAEADARMVPTLLMVDSEGLEELVPPPRRGLVLQMP
FT                   AREEVIRAAAVTLLEQNAAD"
FT   gene            477198..479711
FT                   /gene="cheR3"
FT                   /locus_tag="TM1040_0460"
FT   CDS_pept        477198..479711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR3"
FT                   /locus_tag="TM1040_0460"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63193"
FT                   /db_xref="GOA:Q1GJH3"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH3"
FT                   /protein_id="ABF63193.1"
FT                   /translation="MSDRSIPFLVGIAASAGGLEALSELVQELGEQNEAAYVIAQHMSP
FT                   NHKSMLSALISRETRLPVRELTPDADIWPEANTIYVVMPGHDVIVTEGGQLGLRAPSGL
FT                   RGQPKPLADLLLKTMAEECGENCAAIILSGTGSDGSYGVRAIREVGGITIAQDPESSKY
FT                   SGMPTSALQTGCVDLTLRPREIGEHLGKILSRPRDFTELQELHQKPNHLSDLFQILTAR
FT                   TGVDFREYKASTINRRIARRMLALGFSEYNAYVDFCRSDLAEVDALYKDLMISVTRFFR
FT                   DPQQFDALKADIQKLVAKLESSSDQRTVRVWVSGCATGEEAYSVAILFLEAMGGLEKVS
FT                   QRRLQVFATDIDQHALDVARRGEYPISAINDIPQELVDRYFVERTDTIEVKKALRAFVL
FT                   FSRHNVIQDPPFTNLDCVSLRNLLIYFNGPLQDKVLARIGYALVPDGLLFLGAAETVGG
FT                   METIFEPTSTSDRIYRKRLVTRKPALQPFIEDATARRPLEQSALPYLADKNKHHSATRQ
FT                   FDNLIRVLAPNGFLASATGAILRVIGDISFVTALTENTGLQVDLKILLPELRSEASSLI
FT                   NVTLRSRGVRSGQWHPLPRSKHEQVRLTCYPIVSAPDGEMDGNSIVLIGVESRIKEEQA
FT                   APPESRNPEEQDRYIRQIEDEVISTREALQQTIEELQTANEELQSVNEEMQAANEELQS
FT                   TNEELETSNEELQSTNEELITVNEEIQVNSSEIQHLSAELSAVLRANPFVMIVVDQALQ
FT                   VRHASRQAMTMFELDALPKSGIHISQCAPVEGMPDLTSRISHVFRTSAPLVENAEFGGA
FT                   SHEMTFTPFREREGRDLIGVAVTIV"
FT   gene            479863..480354
FT                   /locus_tag="TM1040_0461"
FT   CDS_pept        479863..480354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0461"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63194"
FT                   /db_xref="GOA:Q1GJH2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH2"
FT                   /protein_id="ABF63194.1"
FT                   /translation="MTASQFAVDVKIIDPRIRDWGMPSYQTQGSAAIDLFACIDAPKEI
FT                   APQAPAVLIPSGLAFYMGDQSCAALVMPRSGLGHKKGLVMGNNVGLIDADYTGEVFISA
FT                   WNRNPPGAAPIVIEPGERIAQLMFVPVLRATLNEVETFSNSTERGAGGFGSTGSGATGA
FT                   "
FT   gene            480351..481427
FT                   /locus_tag="TM1040_0462"
FT   CDS_pept        480351..481427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0462"
FT                   /product="UBA/THIF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63195"
FT                   /db_xref="GOA:Q1GJH1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH1"
FT                   /protein_id="ABF63195.1"
FT                   /translation="MILVLGLAGLIWWGGRLFGASQSMRWALLGLLFLAVLSIQLTLPE
FT                   GNPLRAATGGSASLWLLIAGTGALVALYGRVLKRLRNRADAREDSADAPEAAAPFRDSE
FT                   LDRYARHIVLREVGGAGQKRLKDARVLVIGAGGLGAPALQYLAAAGVGTIGVIDDDRVE
FT                   NANLQRQVIHRDADIGMPKVFSAQAAMEAQNPFVTVRPYHRRLSEDIASELFAEYDLIL
FT                   DGTDNFDTRYLANAAAVAQRKPLISGALSQWEGQISVFDPASGGPCYQCIFPESPAAGL
FT                   APSCAEAGVIGPLPGVLGAMMAVEAVKQITGAGEVLRAQMLIYDGLYGETRRIALKARA
FT                   DCPICGPNAGTPAPTGEN"
FT   gene            481430..482221
FT                   /locus_tag="TM1040_0463"
FT   CDS_pept        481430..482221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0463"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63196"
FT                   /db_xref="GOA:Q1GJH0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJH0"
FT                   /protein_id="ABF63196.1"
FT                   /translation="MTRTFALTALATAVFATGALAADLPDLEGREVVFATENTYPPLQF
FT                   IDPNSGEAIGWEYDAVAEIAKRINITVVYENSSWDAMIPAITASQYDVAMNGITIRDDR
FT                   KEKVDFSESYLTSQMRMIVAGDEDRFEDAAGFAADDDLLAAAQPGTTPFYVTVYDVLDG
FT                   DEANPRIKLFETFGASLQALRAGDVDLALSDSTAASGVVAASDGALKIVGEPLGTEDFG
FT                   FIFPKGSDLVEPVNAALAAMKADGTLDALNKKWFLDYKMGQ"
FT   gene            482295..483101
FT                   /locus_tag="TM1040_0464"
FT   CDS_pept        482295..483101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0464"
FT                   /product="Amino acid ABC transporter permease protein 3-TM
FT                   region His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63197"
FT                   /db_xref="GOA:Q1GJG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG9"
FT                   /protein_id="ABF63197.1"
FT                   /translation="MTNRHKREDKEDFPWWLVAVGLTALYLGIEVALSDVYAQIMNTLW
FT                   RGVGITIFVTIVSFFSASALGLALALGAESRWLVLRQVCRFYVEVVRGVPIIVLLLYVA
FT                   FVLAPALVDLRNWLGGFLGLEDIRTRNFPLLWRAIVALMIAYSAFIAEVFRAGLQSVPD
FT                   GQIEAAKALGLSGWKRFRFVVFPQAIRTILPPLGNDFVALVKDSSLVSVLGVLDITQLG
FT                   KVTAASNFRYFETYNMVALIYLAMTISLSLALRALERHLRSKQEHR"
FT   gene            483198..485213
FT                   /locus_tag="TM1040_0465"
FT   CDS_pept        483198..485213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0465"
FT                   /product="peptidyl-dipeptidase Dcp. Metallo peptidase.
FT                   MEROPS family M03A"
FT                   /EC_number="3.4.15.5"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63198"
FT                   /db_xref="GOA:Q1GJG8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG8"
FT                   /protein_id="ABF63198.1"
FT                   /translation="MTNPLLRDWQTPFGIAPFDQISDEDFAPALDEALKAHTAQIDAIA
FT                   TNPAPPTFANVIEALETPCQPLEQVLSVFFSVAGADSNPAREALQRAFSPNLAAHFSAI
FT                   TANKALYARVQAVWDQRDTLDLTDEQARVLMLTHRGFVRGGAALNGAEDTRMQEIKSRL
FT                   ATLGTNFTQNLLADERDWFMELSEDDLEGLPDFVVKAARTAGAEKGVSGPVITLARSIV
FT                   TPFLQFSPRRDLREKAFRAWAARGANGGAHDNRAIAAEILSLREERAKLLGYRNFAAYK
FT                   LETEMAKTPEAVRELLMDVWGPAKAQADKDAEVLTRMMHEDGINGDLAPWDWHYYAEKR
FT                   RKIEHDLDEAELKPYLQLDRMIEAAFACANRLFGLEFAPLDVPLYHKDCRAWEVTREGK
FT                   HLAVFIGDYFARGSKRSGAWCSAMRAQAKFPEEQTPIVVNVCNFAKGDPALLSYDDART
FT                   LFHEFGHALHQMLSNVTYESVSGTSVARDFVELPSQLYEHWLEVPEVLQEFATHAETGA
FT                   PMPKEMLDKVLGAATFNMGFQTVEYVASALVDLEFHDGSAPEDPMVKQAEVLAQIGMPA
FT                   AIVMRHATPQFAHVFSGDGYSSGYYSYMWSEVMDADAFESFEEAGGAFDPARAAALEAH
FT                   ILSKGGSEDAAELYTAFRGRLPGVDALLKGRGLAAK"
FT   gene            complement(485294..486220)
FT                   /locus_tag="TM1040_0466"
FT   CDS_pept        complement(485294..486220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0466"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63199"
FT                   /db_xref="GOA:Q1GJG7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG7"
FT                   /protein_id="ABF63199.1"
FT                   /translation="MINALFAARPERWDTYEPTLRAAFEAEGLAVDLRQDFAPEDVDYI
FT                   VYAPNSDLQDFRPYTRCKAVLNLWAGVEKITTNETLTQPLCRMVDPGLTQSMIEWVTGH
FT                   VLRYHLDIDRSLALQNSWSPYIPPLAEERPITILGLGALGQACATALTQLGFPVSGWSR
FT                   TAKSVAGVTCHHGPEGLNAALAEAQIVILLLPDTPHTQNILNAQSLARLPKGARIINPG
FT                   RGPLIDDEALLAALETGQIAHATLDVFRIEPLPEDHPYWAHPKVTVTPHIAAETRPITA
FT                   SRVIAENIRRGEAGEDFVHLVDRNRGY"
FT   gene            complement(486217..486627)
FT                   /locus_tag="TM1040_0467"
FT   CDS_pept        complement(486217..486627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0467"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63200"
FT                   /db_xref="GOA:Q1GJG6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG6"
FT                   /protein_id="ABF63200.1"
FT                   /translation="MSIFHLAYHVDDLDAARRFYGETLGCRAGRSTDTWIDFNFFGHQI
FT                   SLHKGAPFETAKTGRVGEHMVPMPHLGVILPQDEWVRLAERLHDAGVEFEIPPTTRFKG
FT                   EPGEQSTMFFYDPAGNPIEVKGFADMDGVFAT"
FT   gene            486728..487573
FT                   /locus_tag="TM1040_0468"
FT   CDS_pept        486728..487573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0468"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63201"
FT                   /db_xref="GOA:Q1GJG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG5"
FT                   /protein_id="ABF63201.1"
FT                   /translation="MDTRFVASLLAIIEEGSIAAAARRSGVTASALSQRISALEAELGV
FT                   TLLRREGRMVQPTHACRSVLPRLRAMLRLEQDLRADLRGQRLAGPLRVGAISTALGDWA
FT                   AQLLRHLHHAAPDVDLRFVPGTSPGLMALLEAEEIDLALVVEPPLSLPKSLRFQQMFQE
FT                   PVGLLRPALDSASTLPYLVYSREAWGGAICWSALTAREPNPSVLVEMDALEALAQMVED
FT                   GVGQAVLPAWRSLARHAPAARFTAWPGVYRSIGLLHRLRDQDSPFLTLVREGIGQEGGP
FT                   "
FT   gene            complement(487570..488709)
FT                   /locus_tag="TM1040_0469"
FT   CDS_pept        complement(487570..488709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0469"
FT                   /product="Rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63202"
FT                   /db_xref="GOA:Q1GJG4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG4"
FT                   /protein_id="ABF63202.1"
FT                   /translation="MSYLEYHAKSTPTGLRKILFLNWPLVLLLCAAAGVGFLMLYSVAG
FT                   GSFSPWVEPQAKRFLVGLGVMLVVAMVPIWFWRNISVLAYLMALVLLVAVELFGSVGMG
FT                   AQRWVDIGPLRLQPSELMKITLVMVLAAYYDWLPANRTSRPLFVLVPVFLILAPTFLVL
FT                   KQPDLGTSILLLTAGGGVMFLAGVHWAYFAAVIAAAGGLVAAVFQSRGTDWQLLKDYQY
FT                   RRIDTFLDPSQDPLGAGYHITQSKIALGSGGWSGRGFMQGTQSRLNFLPEKHTDFIFTT
FT                   LAEEFGFVGGVMLLSIYVMIIVFCVATAISARDRFSSLVTLGIALNFFLFFAVNMSMVM
FT                   GLAPVVGVPLPLVSYGGSAMLVLLAAFGIVQSANVHRPR"
FT   gene            complement(488706..490652)
FT                   /locus_tag="TM1040_0470"
FT   CDS_pept        complement(488706..490652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0470"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63203"
FT                   /db_xref="GOA:Q1GJG3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG3"
FT                   /protein_id="ABF63203.1"
FT                   /translation="MKRNQKDQDHSHRKLARRTLLLGGLQLGFTGALAMRMRFLQVDQA
FT                   DQFRLLAEENRINIRLLAPSRGEIYDRNGNIIAQNSPSYRIVLVPEDAGDVEEVIANLN
FT                   RLLPLDEEDLERARNEMRRSRPFLPITLADQISWDDISKVAVNAPALPGITPEVGLSRV
FT                   YPQGPDFAHVVGYVGPVSDYDLSKMEDPDPVLLTPRFQFGKVGFESKQEDSLRGKAGIK
FT                   RVEVNAAGRVMRELDRREGEPGADMQLTLDADLQSYVQARLGSESAAAVIMDVENGDLR
FT                   AICSSPSFDPNLFVRGISVADYRALTEDPYRPLANKTVQGTYPPGSTFKMVTALAGLEA
FT                   GVITPAETTWCPGHLEVSGRRFHCWKRAGHGHVNLLDSLKSSCDVYYYDLAIKVGMDRI
FT                   SEMANRLGLGVRHDLPMSAVAAGLAPNREWKSRTYGQDWLVGDTVNASIGQGYMLASPM
FT                   QLAVMTARIASGREISPRLVKSINGIEQPSGLGEPLGLNQNHLNHVRKSMYAVSNDRRG
FT                   TGYRSRIIAEDMRMAGKSGTSQVRNITAAERASGVIRNQDLPWERRDHALYVCYAPYDN
FT                   PKYAVSVVVEHGGGGSTAAAPIARDVLLQALYGGTPPLEAYPRGDRSKIQAQQERLQRE
FT                   MHQREESGGSDRA"
FT   gene            complement(490649..491188)
FT                   /locus_tag="TM1040_0471"
FT   CDS_pept        complement(490649..491188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0471"
FT                   /product="putative rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63204"
FT                   /db_xref="GOA:Q1GJG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG2"
FT                   /protein_id="ABF63204.1"
FT                   /translation="MAKTSPAAIWLMRAVFAGVALLIMFFHLLPLDTMPRRWSPPDLLL
FT                   AFALAWSSRRPDFVPPLLIAAVMLLADLLFQRPPGLWALLALLACEFLKSRLSTHRETP
FT                   FLGEWVAVSIVMIAIALLNRMILGILAVEQAHIALILVQVIMTIAAYPLVVLISQSLFG
FT                   VRRLSAADAETLGARL"
FT   gene            complement(491181..492128)
FT                   /locus_tag="TM1040_0472"
FT   CDS_pept        complement(491181..492128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0472"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63205"
FT                   /db_xref="GOA:Q1GJG1"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG1"
FT                   /protein_id="ABF63205.1"
FT                   /translation="MAKDRSQREDYAGPLKRLLVGLLVLVLAVIFLVWRIDSPRVERFR
FT                   AQVVDAVVPNMQWAMAPVTGAINLVRDFQSYQRLSEQNRELRSELRQMRAWKEAALQLE
FT                   QENARLLDLNNVRLDPQLTYVTGVVLADSGSPFRQSVLLNVGARDGIQDGWAAMDGIGL
FT                   VGRISGTGLDTARVILLTDAASAVPATLQPSGQTALVSGDNTAAPLLNFVENPELVRPG
FT                   DRVVTSGDGKVFPPGLLIGQVAQDRAGRLRVRLSADYERLEFLRVLRHQGSAPISDPGA
FT                   LIAPVPDDMIPLPRPEGFLERAAPGGTQDEGDNG"
FT   gene            complement(492184..493230)
FT                   /locus_tag="TM1040_0473"
FT   CDS_pept        complement(492184..493230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0473"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63206"
FT                   /db_xref="GOA:Q1GJG0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJG0"
FT                   /protein_id="ABF63206.1"
FT                   /translation="MALFGNLGGLFTSDMAIDLGTANTLVYVKGRGVILSEPSVVAYHV
FT                   KDGVKKVLAVGEDAKLMLGRTPGSIEAIRPMREGVIADFDTAEEMIKHFIRKVHKRSTF
FT                   SKPKVIVCVPHGATPVEKRAIRSSVLAAGARRAGLIAEPIAAAIGAGMPITDPTGNMVV
FT                   DIGGGTTEVAVLSLGDIVYARSVRVGGDRMDEAIISYLRRQQNLLIGEATAERIKTSIG
FT                   TARMPDDGRGQSMQIRGRDLLNGVPKEIEISQAQVAEALAEPVQQICEAVMTALETTPP
FT                   DLAADIVDRGVMLTGGGALLGDLDLALREQTGLAVSIADESLNCVALGTGKALEYEKQL
FT                   RHAIDYDS"
FT   gene            complement(493430..494182)
FT                   /locus_tag="TM1040_0474"
FT   CDS_pept        complement(493430..494182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63207"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF9"
FT                   /protein_id="ABF63207.1"
FT                   /translation="MSLRTSLKPGVAIALALIFSLPHSALHANSAGFSLVGDGGFFMRT
FT                   STPSAREAILNDDATGRGAVSMNPSAASLFRGRSSGSLFARAAVAVGVDVAEIMNVIAS
FT                   AEAGRANYDAVQHGAKIKPPAKPTDMTLLEIYTWIDATPGQPHAIGRYQFIPATLRRLV
FT                   KHQGVPLGRKFNKSLQDQLAHQLIEEAGLSQFKAGEISQTKFMNNLAKIWAGLPTSNGK
FT                   SYYHNYAGNRATVTWDTYKARMDAIFSG"
FT   gene            494301..495080
FT                   /locus_tag="TM1040_0475"
FT   CDS_pept        494301..495080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0475"
FT                   /product="protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63208"
FT                   /db_xref="GOA:Q1GJF8"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF8"
FT                   /protein_id="ABF63208.1"
FT                   /translation="MLSYQHIYHAGNLADVQKHALLAWMLDYMTQKDKPLSYLETHAGR
FT                   ALYDLGSSEALKTGEAAKGIDIARDWFAPEHPYARVLELVQAQHGATSYPGSPQIAAEL
FT                   LRPGDRLHLAELHPQEAAALREAMRGSGAKVHVQDGFEMVQSLAPPEPRRGLVLIDPSY
FT                   EIKADYARIPGIIAKLHRKWNVGVIALWYPILSDGTHVPMLKALEAHALPEVFRHEVRF
FT                   APARDGHRMVGSGMFVVNAPFGLSQEAVRLDAKFASL"
FT   gene            complement(495160..496929)
FT                   /gene="mcpK"
FT                   /locus_tag="TM1040_0476"
FT   CDS_pept        complement(495160..496929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpK"
FT                   /locus_tag="TM1040_0476"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63209"
FT                   /db_xref="GOA:Q1GJF7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF7"
FT                   /protein_id="ABF63209.1"
FT                   /translation="MPAAFYGLSTRIYALVALALVAAASLTFYTLNHASQTAYDLRAGE
FT                   LRHITDIARSHLDAHNARVEAGEMTQAEAQASVAQILNDLRFGENGYVYAFDSDIVYSV
FT                   HPFRPQWVGGESQRDLKDVHGNRIFENILGNLDAEGHSLSTIYFENPATKAVEPKLTYA
FT                   QYYEPWDWYLGTGAYMNDIEADIAQMRMQALMGLGVALAVLIGVSLLIIRSMLPPLDAL
FT                   KARMATMADGDLDADVPGLSDRSEIGQMAHAVANFRDGLQMQAALEAEAHIKDEERQRV
FT                   VAILSQRLAKFAQGDLTVRVDDAMPDEFRQVAEDFNATVTQISDLMRTLVAGVERIESE
FT                   SESLDSSSRELGMRTETQAASLEETSAALTELSASVKNSAEESRAASERVQQASERTER
FT                   GAQVVRRTIEAMQGIEESSDKISSITSLIDDIAFQTSLLALNAGVEAARAGEAGRGFAV
FT                   VAGEVRALAGKSSDAAREIAELITNASREVETGVSLARDSGTALDEINAHISAINETVS
FT                   ALAEAAREQATSLSEITSAADQLDQVTQQNAAMFEETSAATQRLRDEANALAQNARQFQ
FT                   VDDADPAAQRRAS"
FT   gene            complement(497149..499365)
FT                   /locus_tag="TM1040_0477"
FT   CDS_pept        complement(497149..499365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0477"
FT                   /product="isocitrate dehydrogenase NADP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63210"
FT                   /db_xref="GOA:Q1GJF6"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF6"
FT                   /protein_id="ABF63210.1"
FT                   /translation="MAENSTPDILYTIVDEAPELASASFLPIIRKFADAAGVSVGTKDI
FT                   SLAARIIATFPENLTEEQRQSDDLAALGELVKTPDANVIKLPNISASVPQLVAAIEELQ
FT                   AQGYKLPDYPYEPATDAEKEIRARYDTIKGSAVNPVLREGNSDRRSAKAVKNYAQNNPH
FT                   SMGAWSGDSKTKVSSMPGNDFYANEKSATISAEQAGDAKIEFVAKDGSVTVLKDGWPLA
FT                   EGTVADATFMSAKALAAFLSGAIEDTKADGTMFSLHMKATMMKVSDPIIFGHAVKAWLG
FT                   PVWDKHGAAIAAAGGSPNSGLGAVLAAIDSLPNADEIKSEIAALERPSMYMVDSDKGIT
FT                   NLHVPSDVIIDASMPAVIRAGGKGWDETGAKGDTNCVIPDRCYSTVYDETINFFKANGA
FT                   LDVTTAGSVANVGLMAQKAEEYGSHPTTFEAPADGEIRVILANGETLHSHEVEAGDIWR
FT                   ACTVKKAPIENWIQLALDRQRLTGSEAIFWLDANRAHDAELIKYVKPALDAAGVADKFL
FT                   IMAPREATRQSLETITAGKDSIAITGNVLRDYLTDLFPILELGTSAKMLSIVKLMNGGG
FT                   LFETGAGGSAPKHVQQLVEENHLRWDSMGEFCALGESLKFLADVKGNEKAGVLGAAAEV
FT                   ATQGILDNNKSPERKVGQPDNRDSHYWFARYWAEALAAQGDDAELAAHFKPIAEALASN
FT                   EAAILSELAAAQGGAADIGGYYHPSVEKKAAVMRPSATLNGIIG"
FT   gene            499866..501158
FT                   /locus_tag="TM1040_0478"
FT   CDS_pept        499866..501158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0478"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63211"
FT                   /db_xref="GOA:Q1GJF5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF5"
FT                   /protein_id="ABF63211.1"
FT                   /translation="MRSMAAGDLFIYAPVPVYRDAGTLYIERQAVNGLRLWSQHFSRVT
FT                   VLMPEKNHDVPKGWIPVDMALADLPAVRLETVPSAFTPLQFLRAWRRERRRIGALVAEA
FT                   SYLSFAIGGLFGDWGAVCALEALRQRKRFAIWTDRVESDVLRKSRDWGDWKQRLKSRLY
FT                   SRPMAWLERALISRAALGLFHGRETFDSYAGFSPNPQLVHDIHISGRDHIRTSALQKKL
FT                   SGLGARPLRIVYAGRAEGMKGPGDWISVLERLAVLNIPFEAEWLGEGSCLAMMRNRVRR
FT                   AGLEDQVRLPGFLEDHAEVRARLQRADVFLFCHKTAESPRCLIEALTGATPIVGYEGGY
FT                   ARDLIAGHGGGILVPQGDTERLAQTLSMLQGAPDTLATLMQSAHLEAAPFTDEKVFAHR
FT                   CDLIRRYLAPSASRRGPGGPGGRILRVVAER"
FT   gene            complement(501173..501775)
FT                   /locus_tag="TM1040_0479"
FT   CDS_pept        complement(501173..501775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0479"
FT                   /product="protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63212"
FT                   /db_xref="GOA:Q1GJF4"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF4"
FT                   /protein_id="ABF63212.1"
FT                   /translation="MGIEAVQTFTEQNERPRSRSVRVALRGALCALVMGGFFVSTAPVA
FT                   TAQESAPERAAAQTLGPVTNLPLPRYVSMKAAEGNVRRGPSLNHRIDWVFKRRGMPLEV
FT                   TAEYGHWRRVRDRDGQGGWVHYALLSGVRTVLVEQDLVQVRARPQEDAPAVAAFELGVV
FT                   AQLGACTRDWCEITAGGHSGWTHKDNLWGVDPDELRE"
FT   gene            501938..502924
FT                   /locus_tag="TM1040_0480"
FT   CDS_pept        501938..502924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0480"
FT                   /product="Glycolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63213"
FT                   /db_xref="GOA:Q1GJF3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF3"
FT                   /protein_id="ABF63213.1"
FT                   /translation="MPRERLSVVVTRRLPEPVETRLSELFDVRLRTDDTPMTRTELAAA
FT                   MKEADVLVPTVTDTIDAGLLGQAGERLRLIANYGAGVDNIDVATARQRGILVSNTPGVL
FT                   TDDTADMTMALIMAVVRRIPEGLAIMQRGDWEGWSPTAMLGGRLAGRRLGILGMGRIGQ
FT                   AVARRARAFGMQVHYNNRRRLRPEVEEELEATWWESLDQMVARMDVISIHCPSTPSTFH
FT                   LMNARRLKLLKPDAVIVNTSRGEVIDENALTRGLRAGEIAGCGLDVYEHGTTVNPRLRE
FT                   LPNVVLLPHMGSATIEGRIEMGEKVLLNIKTFEDGHRPPDQVVPAML"
FT   gene            complement(502866..503246)
FT                   /locus_tag="TM1040_0481"
FT   CDS_pept        complement(502866..503246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63214"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF2"
FT                   /protein_id="ABF63214.1"
FT                   /translation="MASAALPPSRSTRAPASTASGFAAATIQFSASTGVPASRAAIAAA
FT                   AASESESPAAPAPVVAVSGATASAACCADKGCASAAQSAAPKNNGLISFLPNRAARVAP
FT                   DSALTTWQAPPDPVGDAHLQMS"
FT   gene            503457..504770
FT                   /locus_tag="TM1040_0482"
FT   CDS_pept        503457..504770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0482"
FT                   /product="gamma-glutamyltransferase 1. Threonine peptidase.
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63215"
FT                   /db_xref="GOA:Q1GJF1"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF1"
FT                   /protein_id="ABF63215.1"
FT                   /translation="MGTPGTPALLEAAHRKWGRANWGGLFTDAIRLAELGFAVSPRMAD
FT                   SIANDAERLGRFPETAAYFLPEGIPLAAGEVITNQPYANVLRRIAMEGTRAFYSGPVAA
FT                   DIVRAVQGATGNPGVLSELDLALYQVKERPAVCASYRAFEACGMGPPSSGALTVGQILG
FT                   MLEPYDLAALGPDSPESWRLIGDASRLAFADRGRYMADSDYVPVPTKGLLDPEYLSKRA
FT                   ALLEGDAALETVAPGAPEFDHALIWADDESIEFPSTSHISIVDQYGNVLSMTTTIENGF
FT                   GSRLMTNGFLLNNELTDFSFRSHRDGVPIANRLEPGKRPRSSMAPTIVMQDGKPVLAIG
FT                   SPGGSRIIGYVATAIIGWADWGLDIQDAISLPHAVNRFGTYDLEAGTGAEALEAALTDM
FT                   GYQVNVRDLTSGLHAIEIDNGLKGGADPRREGIALGDE"
FT   gene            505027..506433
FT                   /locus_tag="TM1040_0483"
FT   CDS_pept        505027..506433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0483"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63216"
FT                   /db_xref="GOA:Q1GJF0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJF0"
FT                   /protein_id="ABF63216.1"
FT                   /translation="MVQAITLPRNEGGIKAAIAALSEAFGDRLQTGQALREQHGHTTTW
FT                   IDNQAPDAVVFPTSSEEVSGIVKICAEFGVPIIPFGTGTSLEGHVNAPAGGICVDMMRM
FT                   DQIVAVHAEDLDVVVQPGVTREQLNTYLRDQGLFFPIDPGANASLGGMVATRASGTNAV
FT                   RYGTMKDNVLSLEAVMADGSIIRTASRAKKSSAGYDMTRLLVGSEGTLGLITEITLKLQ
FT                   GIPEAIRSARCSFRSVDEACQAVMMTIQYGIPVARIELLDEMSVRAANQHSGLDLPEVP
FT                   LLLLEFHGSDAGVVEQSDTFAQIAEEFGGFDIAATSTPEERNKLWQARHDMYWASLGLR
FT                   PGAKGISTDVCVPISKLADCVSAARSKAEEMGLIAPIVGHVGDGNFHALLLIDMESAEE
FT                   REKADTYVSWLNDLAISMEGTCTGEHGIGQGKRPYLVRELGETTRFMAAVKAALDPDNI
FT                   LNPGKILIDG"
FT   gene            506534..506977
FT                   /locus_tag="TM1040_0484"
FT   CDS_pept        506534..506977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63217"
FT                   /db_xref="GOA:Q1GJE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE9"
FT                   /protein_id="ABF63217.1"
FT                   /translation="MFFIRRLLSLFRFYMFILICGLIMVGVDYDMQAKAVGRTIATYDV
FT                   DSYRLTLQRRLGGEPLRVASDGRVGAPEGEVTSPLDVAFRALRGLAVAKAHVMGQDLEM
FT                   EQVVLLPPPSATQVPIPQQPQTMPVRDTQEQRPCVRRGNVLDC"
FT   gene            complement(506989..507420)
FT                   /locus_tag="TM1040_0485"
FT   CDS_pept        complement(506989..507420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0485"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63218"
FT                   /db_xref="GOA:Q1GJE8"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE8"
FT                   /protein_id="ABF63218.1"
FT                   /translation="MSDQISEKSGKCACGAVQFKVLAPDTYGACHCQMCRRWTGGVWMG
FT                   VVCTKVLSIEGPVRSWESSRIGSRGSCRYCGSSLWHKPRHSEHYTFGQGLFDDQTGWYL
FT                   RREIFSDEKPDHYALADKGQTALTGWGTLWAVILGRLPK"
FT   gene            507703..510210
FT                   /locus_tag="TM1040_0486"
FT   CDS_pept        507703..510210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0486"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63219"
FT                   /db_xref="GOA:Q1GJE7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE7"
FT                   /protein_id="ABF63219.1"
FT                   /translation="MKTQVKALVVGGGAVGTSIAYHLAKAGWDDVMLIERDELTSGSTW
FT                   HAAGLLPLFNMSYATTHIHKYSVDFYKTLEEETGLNAGFAVVGNLRMAQTQERMDEYML
FT                   YASTAETCDVAYEWLTPEQIKERWPLIETGDLKGAIYHTEDGYINPADVTQAMAKGARQ
FT                   RGVEIVRKMQADAFHWNGTHWEVTCTVMAEKGGNLVETDEQVVITAEHVVTASGNHAQR
FT                   TAKMLGIKMPAIPVEHTFIVMDKDPELVKWREAGNPEHPVIRDADNESYAREERGGWIL
FT                   GIYEHGAPARFEHGVPDSFRADLFPLDLDRIAEQYMAMAERVPSCADSGLKDDFNGPIC
FT                   YTPDGNPLVGPAPGLRNMWLAEGFSFGITAAGGTGYYLAQMMVDGEAEIDMASLDPKRY
FT                   SSNWMTTEFAARKNEECYEHVYILHHPDEERPAARPLRTAPAFDRQKARGAQFGWVNGW
FT                   ERPNYFGPVDAPDNFDEEARSFRRGGWWQHAVDEAKAIREGVGLIDATAFTKHVVKGPG
FT                   ATQFLDWFTCNKLPKVGRINLTYALTAFGTTRTEYTIVRNGENNYYLVSAGAWSEYDAD
FT                   FLRKAAEDKMEEFGYIEIQDVTTQWGVFAIAGPKSRDVLKEVIVDADPATALSNKRFPW
FT                   LSAKQIELGMCPVNAIRVAYTGELGWELHHPIEMQNYLFDLLEKAGEKHGMKLVGARAQ
FT                   NWLRQEKSYRAFGNELGRDATPLEADLPRFVDLEKDFHGKDKLVETGVRVKCCTLLIDG
FT                   PEDADPWGREALYAEDGTRVGRLTSGGYSVAFEKSIGMGYVKPEMAVEGTKLKVKIQDK
FT                   LWDAVVTCDSPYDPKNETIRKDG"
FT   gene            510374..511339
FT                   /locus_tag="TM1040_0487"
FT   CDS_pept        510374..511339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63220"
FT                   /db_xref="GOA:Q1GJE6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE6"
FT                   /protein_id="ABF63220.1"
FT                   /translation="MILSKFLAVVADIPARYLDSITRGFCVALLLGLAVKSVLLSHWAL
FT                   SAILVVLAGIILVNIIALHLEREAFIPLWMLVTVLTATVILTTCYVGLSGATWMFPTLV
FT                   GLRFAAPPSQYQPARLVLIAVVPLVVLLQGDPGNAARLLAAGLITSAYLWLAEGEIVSL
FT                   RSRLDGDDGRDPVTRAFSRARMEQDKSMIASHAPVGLVVVRLDGLMDLRVRGEGARADD
FT                   IMASVAAAIIPLLSTRERLYRLGSSEFLIGLAGWRAFECFELGQTVCKTVQPHLPKGIR
FT                   ARSGVAEVTTPQDFDAALDLASSMVSKSGDLGRSVLSTAL"
FT   gene            complement(511342..511809)
FT                   /locus_tag="TM1040_0488"
FT   CDS_pept        complement(511342..511809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0488"
FT                   /product="Calcium-binding EF-hand"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63221"
FT                   /db_xref="GOA:Q1GJE5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE5"
FT                   /protein_id="ABF63221.1"
FT                   /translation="MAQPLPSFVASAPSGPRVLTLAILCLVATLGAQTAGADPDFLASL
FT                   DFDGDGAVTVSEVALVRNQKFEQIDRDGDGFIDADEFDRSLQETRTRFRQMGQGYEEHR
FT                   ASPGRIDAFTFADSDADGLISRREFHRHSDRFAQSLDRDGDGIVSDRDMAR"
FT   gene            complement(511915..512568)
FT                   /locus_tag="TM1040_0489"
FT   CDS_pept        complement(511915..512568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0489"
FT                   /product="protein of unknown function DUF938"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63222"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE4"
FT                   /protein_id="ABF63222.1"
FT                   /translation="MPFRSVPGQASVAEQSEGGKLFAPSAARNLEPLLQIVSQHAPQRG
FT                   RALEIASGTGQHVIGYARALPDIAWHPSDIDPSRRASIDAYASEAGLTNIAPAAALDAT
FT                   TEGWGALIGPFDLIVLSNLLHLISNTEAQTLLSEAATALTRSGRLLIYGPFSREGLLVS
FT                   AGDKAFHTALTEHDPDIGYKNVETVSIWAAEAGLQMAPPNHMPANNLCLVLTTT"
FT   gene            complement(512568..513653)
FT                   /locus_tag="TM1040_0490"
FT   CDS_pept        complement(512568..513653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0490"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63223"
FT                   /db_xref="GOA:Q1GJE3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE3"
FT                   /protein_id="ABF63223.1"
FT                   /translation="MIDTLIIGGGVAGLGAAAHLSPSHQVVVLEREEVLGYHASGRSAA
FT                   MFEQDYGPPAIKALSRASRTFFEAPGEGRETYLSPRGLMLVGRADQRAAFDADLAELDL
FT                   QEIPINDALARVPILNREVVAFAALHDTATDIDTDRLMGDWTKDLRRQGGQTVLRQEVM
FT                   TISRTDKGWRVETRDTQYEARQIVNAAGAWADIIAETAGVTPIGLQPKRRSIAQLPAPE
FT                   GRDVANWPMLMGVGEAWYAKPQAGKLLVSPADADPLPPQDAWADDMVLAEGLARYEEMV
FT                   TTPVTRLETSWAGLRSFAPDGVPVIGEDPDHPGFWWYAGQGGYGFQSAPASARLLRDLM
FT                   TGQRPEIAPHIIDALDPARLR"
FT   gene            complement(513650..514654)
FT                   /locus_tag="TM1040_0491"
FT   CDS_pept        complement(513650..514654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0491"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63224"
FT                   /db_xref="GOA:Q1GJE2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE2"
FT                   /protein_id="ABF63224.1"
FT                   /translation="MIRPNSALRAPGLRVSLRRMTAQTCPPLTTLDGHDVGRFAFGCMQ
FT                   FGGRADAQASAEMYEACRAAGLRHFDTAWLYTEGASEEILGQLIAKDRESLYVATKVGF
FT                   TGGASAANMRAQFDQCRQRLKLDQVDLLYLHRFDPETPLEDTLTCFAELKQEGHIRHVG
FT                   LSNFAAWQVMKAVALAARLGLRIDVLQPMYSLVKRQAEVEILPMCADQGILPVPYSPLG
FT                   GGLLTGKYAQGGTGRLSEDENYRARYGQDWMHRTASDLLHLAEDLGTDPATLAVAWAAG
FT                   HPARPAPILSARSATQLAPSLKATEFDMSPELYARIEALSPRPAPATDRLEEA"
FT   gene            514715..515323
FT                   /locus_tag="TM1040_0492"
FT   CDS_pept        514715..515323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0492"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63225"
FT                   /db_xref="GOA:Q1GJE1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE1"
FT                   /protein_id="ABF63225.1"
FT                   /translation="MFDAKIRPLIDPFLNAQGARLAARGVTANQVTLAGLGLGLASAGL
FT                   IAIGLTCWALAFLLASRMADGLDGAVARQHAPSDFGGYLDIVCDFVFYGAVPLGFVALA
FT                   PEANGLAGAFLLCSFYANGASFLGYAVLAEKREMKTSARGVKTLYFTGGLLEGAETIGF
FT                   FVVLCLWPDGFAPLAYVFGTLCFATAASRVVLAAKVFSA"
FT   gene            complement(515592..516668)
FT                   /locus_tag="TM1040_0493"
FT   CDS_pept        complement(515592..516668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0493"
FT                   /product="basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63226"
FT                   /db_xref="GOA:Q1GJE0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJE0"
FT                   /protein_id="ABF63226.1"
FT                   /translation="MKLTKLLASAAVALGLAAGGALAEDKTKVGFVYVGPVGDGGWTYE
FT                   HDQGRKAVVEEFGDAVETVYVENVAEGPDAERVITQMALQGADLIFTTSFGYMDPTINV
FT                   AKKFPNVKFEHATGYKRAENVSTYSARFYEGRAVQGVIAGHMTESNIIGYIGSYPIPEV
FT                   IRGINSAYIHAKKVNPDVQFKIVWAFTWFDPAKEADAAKVLIEQGADVILQHTDSTAPQ
FT                   AAAQAAGNVITFGQASDMAEYAPKPRVSSIIDNWAPYYIARTKAVMDGTWTSVDTWDGI
FT                   GPGMVGIGEITDAVPEDVKAEALALKDAIASGEYHPFTGPLKKQDGSVFLAEGETADDG
FT                   TLAGMNFYVEGIEGTIPE"
FT   gene            complement(516786..517706)
FT                   /locus_tag="TM1040_0494"
FT   CDS_pept        complement(516786..517706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0494"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63227"
FT                   /db_xref="GOA:Q1GJD9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD9"
FT                   /protein_id="ABF63227.1"
FT                   /translation="MDLSAINPVLLIASLMVAATPLLLAAIGELVVEKSGVLNLGVEGM
FT                   MIVGAIAGFATAVETGSPLLGFVAAAAAGALLSLLFVIMTQVALANQVASGLALTLFGL
FT                   GLSALMGQRYVGVKPPQMGRVDIPLLSDLPVVGRILFGHDVVLYFGIALTAAVWAVLKY
FT                   SRVGLILRAVGENHDAAHALGYKVVKIRTLAILFGGACAGLGGAYISLIRVPQWTEGMT
FT                   AGIGWIALALVVFASWKPWRALLGAYLFGGVTVVQLNLQAAGVAIPVEYLAMSPYLITI
FT                   LVLVILSADKSSAPASLGRSFHASR"
FT   gene            complement(517706..518788)
FT                   /locus_tag="TM1040_0495"
FT   CDS_pept        complement(517706..518788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0495"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63228"
FT                   /db_xref="GOA:Q1GJD8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD8"
FT                   /protein_id="ABF63228.1"
FT                   /translation="MIRLEKRPQPSRVWSMATPLLAVLATMVMGGLLFATLGKNPVEAI
FT                   RTIFWEPLFGEFAFYYRPQLLVKGAPLVLIAIGLSLGFRAGIWNIGAEGQYIIGALTGA
FT                   GVGLAFYPTDSWVIFPLMVLAGALGGWAWAMIPAVLKTRFGTNEILVSLMLVYVAEQLL
FT                   ASMSLGLMKNPEGFGFPGSRNLQQYESAHNAELIAGTGMHWGVVAAMIAVIFSYVLLNR
FT                   HMLGYHIRLTGEAPRAARFAGVKPARLVLFCLGMSGALAGLAGMFEVSGPSGQVSIDFN
FT                   VGYGFTAIIVAFLGRLHPVGILLAGALMALTYIGGDIAQGNLGLPSSAIQVFQGMLLFF
FT                   LLALDLLTNYRIAIGKPEAL"
FT   gene            complement(518906..520426)
FT                   /locus_tag="TM1040_0496"
FT   CDS_pept        complement(518906..520426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0496"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63229"
FT                   /db_xref="GOA:Q1GJD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD7"
FT                   /protein_id="ABF63229.1"
FT                   /translation="MSTPPLLTLDGLTKAYPGVVANDQVSFTIGTGEVHALLGENGAGK
FT                   STLVKMIYGLVKPDSGRMTLRGAAYEPSEPRQARADGIAMVFQHFSLFDALNVAENIAL
FT                   GMESPPALRDLAARIREVSEAYGLPLDPYRTVGDLSAGERQRVEIIRCLLQDPKLLIMD
FT                   EPTSVLTPQEVEILFETLRKLKSEGTSILYISHKLEEIRALCDHATILRLGKNVGECVP
FT                   RETSAREMAELMVGSALKTPERGARRFGDVALDISGLSVPAPSAFGTALKNVHLTVRRG
FT                   EILGIGGVAGNGQDELLSVMSGEVTTARDAVKFDGQPIGRMGPTARRALGVLSAPEERL
FT                   GHAAAPDMSLTENALLTGSVREGLEQNGFLKWGATKSFAEKIIKAFDVRTPGPENAARS
FT                   LSGGNLQKFVIGREVLQRPEVLIVNQPTWGVDAAAAAAIRQSLLDLAAQGTAVICISQD
FT                   LDELMEISDNFAALNEGRLSAPRPTGELTVDEIGLMMGGAHGMEVAHV"
FT   gene            complement(520423..521358)
FT                   /locus_tag="TM1040_0497"
FT   CDS_pept        complement(520423..521358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0497"
FT                   /product="molybdenum cofactor sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63230"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD6"
FT                   /protein_id="ABF63230.1"
FT                   /translation="MGFDVEALKAALEAHGRVIRVVVAEVKGSAPREVGAAMLVWDGGQ
FT                   SGTIGGGTLEFEAADAARRQDAPYRLSTHALGPDLGQCCGGAVTLLSEVYTEVNIAQLT
FT                   GQVISRAVAPGPEPLAVSRILNHARAQGLAPAPQLIAGWMIEPVACATRPLWIWGAGHV
FT                   GRALVEVLAPLPDYAITWVDVMRSKYPQEIPASVTALPAQEPGRLVPHAPTEAYHLILT
FT                   YSHQLDLALCHRLLEHGFDFAGLIGSKTKWARFRARLAALGHRPEQIARLTCPIGMPEL
FT                   GKHPHAIAIGVAAELMALSQRLDLKKEHSA"
FT   gene            complement(521348..523696)
FT                   /locus_tag="TM1040_0498"
FT   CDS_pept        complement(521348..523696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0498"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein / Xanthine oxidase"
FT                   /EC_number="1.17.1.4"
FT                   /EC_number="1.17.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63231"
FT                   /db_xref="GOA:Q1GJD5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD5"
FT                   /protein_id="ABF63231.1"
FT                   /translation="MSVSTPLPHDAAALHVTGQARYVDDIPTPKGTLHLAFGLAPIASG
FT                   SITAMNLAEVHASDGVVAVLTADDLPFDNDVSPSAHDEPLLAKGEVHYLGQPVFLVVAT
FT                   SHRAARVAARKGDIEYRKTDALLSVEAALAADSRFEDGPRIYEKGDAPAAIQASLHVIE
FT                   DSFDIGGQEHFYLEGQAALALPQEDGGMIVNSSTQHPTEIQHKVAEAIGLPMHAVRVET
FT                   RRMGGGFGGKESQGNALAVACAVAARLTGKACKMRYDRDDDMTITGKRHSFRISYRAGF
FT                   DAEGRITGVEFTHLVNCGWAQDLSLPVADRAMLHADNAYAIPAIRIESHRLKTNLQSAT
FT                   AYRGFGGPQGMVGIERVMDHAAQVLGMDPVELRVRNYYAAPLASKGGSAPRSATSPRDI
FT                   SGKEKDNTTPYGMEVIDFELHEMTAQLVKSADYAARKAEISAWNARHDRLKRGLAFSPV
FT                   KFGISFTLTHLNQAGALVHVYQDGSIHLNHGGTEMGQGLFQKVAQVAAARFGVDLGRVK
FT                   ITATDTAKVPNTSATAASSGSDLNGMAVKAACDIIRDRMAAHLAEVYQQPQSAVSFEKD
FT                   QVRIGSERISFEAAAMQCYTGRVSLSATGFYKTPSLEWDRIKGAGRPFFYFAYGAAITE
FT                   VVVDRLTGENRILRADILHDAGASLNPALDIGQVEGAYVQGAGWLTTEELVWDETGRLR
FT                   THAPSTYKIPACSDRPDVFNVALYDGSNREETIYRSKAVGEPPFMLGISAWLALSDAVS
FT                   RFGEGHPHLNAPATAEEIWRATETLRHGV"
FT   gene            complement(523693..525096)
FT                   /locus_tag="TM1040_0499"
FT   CDS_pept        complement(523693..525096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0499"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63232"
FT                   /db_xref="GOA:Q1GJD4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD4"
FT                   /protein_id="ABF63232.1"
FT                   /translation="MTITFHLNGEQVSLAKPDPTTTLLDWLREERGLTGTKEGCNEGDC
FT                   GACTVMVTDQSGAKALNACILFLPQLHGKSVRTVEGVAAPIGTLHPVQRAMIDHHGSQC
FT                   GFCTPGFVMSMVTAHTNGATDHDDQLAGNLCRCTGYAPIIRAAEAAQDAPVPDHIAQDR
FT                   SFTFSEIPLGEDADRGAEPPNALRPCSSDDLARVYAARPEATLIAGATDVGLWVTKHLR
FT                   QLRDVIFLDGCRDLKKITISDAEVRIGAMADMNHLRAALAPLHPSYAEMLRRYASQQVR
FT                   AAATLGGNIANGSPIGDNPPALIALRATLHLRKGDMRRSLPLQDFFIDYGKQDRAPGEF
FT                   IEAVSFDRQPDSLRVYKLSKRFDQDISAVLGAFNVTVVNGNVTAAVIAFGGMAAIPKRA
FT                   THVEEALVGRPWTEATLVAAQATFDHDFTPLSDMRASAAYRLDCARNMLRRYFSDLNGA
FT                   PEHVLEVQP"
FT   gene            525502..529002
FT                   /locus_tag="TM1040_0500"
FT   CDS_pept        525502..529002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0500"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63233"
FT                   /db_xref="GOA:Q1GJD3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD3"
FT                   /protein_id="ABF63233.1"
FT                   /translation="MTAHPRFIHLRTHTEYSLLEGAVRLKKLPDLCKANQMPAIAITDT
FT                   NSMFAALEFSVTLSGAGIQPIIGCQVDLTFEKSDPGEKPKFPAPVVLLAQDETGYEHLM
FT                   RLSSCLYVDNGGQLPQVSLEELEANAGGLICLTGGPEGPIGKLLQQGQRPAAETLMQRL
FT                   KGMFPDRLYVELQRHPGEDGQPEAETLTERGHVEMAYAMDLPLVATNDVYFPKTEMYEA
FT                   HDALICIAEGAYVDQAEPRRRLTAQHYFKSQEEMIALFADLPEAIENTVEIAQRCAFMA
FT                   YRRDPILPKFADDEVDELRRQANEGLQQRLAVIPHAVPVEKYQERLDFELGIIESMGFP
FT                   GYFLIVADFIKWGKEQGIPVGPGRGSGAGSLVAYALTITDLDPLRYSLLFERFLNPERV
FT                   SMPDFDIDFCMDRREEVIKYVQQKYGRDKVGQIITFGALLSKAAVRDIGRVLQMPFGQV
FT                   DRLSKMIPVEGVKPVSIEKALQDEPRLAEEARNEPVVDRLLTYGQQVEGLLRNASTHAA
FT                   GVVIGDRPLDALVPLYQDPRSDMPATQFNMKWVEQAGLVKFDFLGLKTLTVIENAMKLI
FT                   FKSGRDLHIGADGTELYEPAEGAENQINLIPLDDEVTYNLYSRAKTVAVFQVESTGMMD
FT                   ALKRMKPTCIEDIVALVALYRPGPMENIPVYCEVKNGQREITSVHPLIDHILEETQGII
FT                   VYQEQVMQIAQVMAGYSLGGADLLRRAMGKKIKEAMDAERPKFEKGAAENGVDKKKASE
FT                   VFDLLEKFANYGFNKSHAAAYAVVSYQTAWLKANHPVEFMAGVMNCDIHLTEKLAVYFE
FT                   EVKKGLQLPYVAPDINRSLATFDVVDGELVYALGALKNVGVEAMNMIVTARGDKPFVNL
FT                   YDFARRVDLKRVGKRPLEMLARAGAFDVLDPNRRRVFESLEGLVQYSAAIQEQKNSNQV
FT                   SLFGEAGDDLPEPRMAGVPDWLPAERLSEEFKAIGFYLTGHPLDDYMPALKRKDVMTLD
FT                   EVMAKAERGPFMAKMAGVVAGRQERKSARGNRFAFAQLSDTTGAYEVTIFSDVLEKSRD
FT                   HLETGSKVVITAEATMESDQLKLLMRSAGPVDSAIADAGRSSLRVYLESASAVATVATV
FT                   LEDAKKAAKNASPGEIYVYLQDPALPGDVEMDLGQLFPINPQIKGALKSLEGVMDVEEI
FT                   "
FT   gene            complement(529337..529831)
FT                   /locus_tag="TM1040_0501"
FT   CDS_pept        complement(529337..529831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63234"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD2"
FT                   /protein_id="ABF63234.1"
FT                   /translation="MARSLKTLLSISLVASLPVAATADPKPANARPAPVDKVLSTYSGK
FT                   TAIWRQNCEGGVYFSPNNQARAWCSEQSESLGVGTWSVSADGTLCQTLTWYYPEGNGAG
FT                   SSVSEPICVQHVVNGWGVLYRSWEGDSEWWPVTNSNNVRDFKNGYVFQSEVNSVKNKLG
FT                   L"
FT   gene            complement(529955..530149)
FT                   /locus_tag="TM1040_0502"
FT   CDS_pept        complement(529955..530149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0502"
FT                   /product="SlyX protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63235"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJD1"
FT                   /protein_id="ABF63235.1"
FT                   /translation="MQHLEEQIAYLSRTVDELNEVVTSQQADLDLLKRRVQMLMEREAQ
FT                   REAEGSGGAVFGDERPPHY"
FT   gene            530303..531805
FT                   /locus_tag="TM1040_0503"
FT   CDS_pept        530303..531805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0503"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63236"
FT                   /db_xref="GOA:Q1GJD0"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJD0"
FT                   /protein_id="ABF63236.1"
FT                   /translation="MAKAKKQPRPKAITPKGFRDYFGEEVTQRTHMLATIAEVYHHYGF
FT                   EALESSAVETVEALGKFLPDVDRPNEGVFAWQEAEDDGKGDWMALRYDLTAPLARVYAQ
FT                   HRNDLPSPYRRYAMGPVWRNEKPGPGRFRQFYQCDADTVGTASMAADAEICMMLSDTLE
FT                   KVGIPRGDYLVRVNNRKVLNGVLEAMGLLEDDPKRDDVLRTIDKFDKVGESGVRELLGK
FT                   GRLDASGAYIDGVGLEDHQAEPVLAFLTSKGDTVTETMTNLRAAVGDSKVGQEGIAELE
FT                   LMGSLFAAAGYGEDRILIDPSIVRGLGYYTGPVFEAELTFEIFDEKGRKRQFGSVAGGG
FT                   RYDGLVKRFTGQEVPAVGLSIGVDRLLAALREKGRLAATPTGPVVVTVMDRDRMADYQA
FT                   MVAELRQAGIRAEVYLGNPKNFGNQLKYADKRHSPIAVIEGGDEKDRGVVQIKDLILGA
FT                   KIAESATLEEWKERPSQFEVPRTELVAKVREILVSQSSDREG"
FT   gene            531808..532899
FT                   /locus_tag="TM1040_0504"
FT   CDS_pept        531808..532899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0504"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63237"
FT                   /db_xref="GOA:Q1GJC9"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC9"
FT                   /protein_id="ABF63237.1"
FT                   /translation="MPNRSQIEARAALLRQRFEVAGGVVVDPPLLQPADVLLDLYGEDI
FT                   RARAYVTSDALRGEQMLRPDFTLPMVQMHMKGGAEPARYTYAGQVFRRQEHDPERANEF
FT                   VQVGYEVFDRTDPADADAEVFALFQLQLRGLELRVATGDIGILMAAVEGLNTTEVRKAA
FT                   LRRHIWRPRRFRALLDRFAGRTPMSESRKKLLSTTGPLTGSAPEIGKRRTAEIDARVET
FT                   LRADAGAPPISEHEMEALEALLAVRETVPYALEQMRDIAVDLPAILPALERLEARSAAM
FT                   KARGIAIDQLDFEAAYGRTSMEYYDGFVFGFYAERRPDLPPIATGGRYDALTRYLGQGD
FT                   EIPAVGGVIRPDLILALEGEAEA"
FT   gene            532896..533588
FT                   /locus_tag="TM1040_0505"
FT   CDS_pept        532896..533588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0505"
FT                   /product="ATP phosphoribosyltransferase catalytic subunit"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63238"
FT                   /db_xref="GOA:Q1GJC8"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC8"
FT                   /protein_id="ABF63238.1"
FT                   /translation="MSIKLGVPSKGRLMEKTFDWFAKRGITLSRTGSDREYAGAVEGVE
FT                   GVDLVLLSAGEIPRELAAGRIHLGVTGTDLVHEKLPRWEQQVEELEPMGFGEADLILAV
FT                   PQFWIDVDTLEDLDAVAAAFRRTHGHRLRIATKYHRLIREFLADAGVADYQLIDSQGAT
FT                   EGTVKNETAEMVADITSTGETLRANHLKILSDGLVLRSQATLWRSRVAKCTPEEKQTLQ
FT                   TLLTKIEG"
FT   gene            complement(533746..534213)
FT                   /locus_tag="TM1040_0506"
FT   CDS_pept        complement(533746..534213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0506"
FT                   /product="Uncharacterised conserved protein UCP032025"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63239"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC7"
FT                   /protein_id="ABF63239.1"
FT                   /translation="MTTSKQTTLDTPMDKHINLVKLSVGSESVESLLDWQQSYARRWPD
FT                   GLPRHITRMWPKRESEIVDGGSIYWVIKGLIQCRQRIIRMDEVFGDDDIRRCAIVLDPE
FT                   VHRTHTAPKRPFQGWRYLKPEDTPADLPEGRESEEPLPAELSQALAEMGVI"
FT   gene            complement(534367..534696)
FT                   /locus_tag="TM1040_0507"
FT   CDS_pept        complement(534367..534696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63240"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC6"
FT                   /protein_id="ABF63240.1"
FT                   /translation="MPKEEWGTKRVCPTTGKRFYDLNNNPIISPYTGEVVEIDTTKSRM
FT                   IEADAEDAASLKAKQNTDSDDAVLDDDDDAVDMDLGDDVLDDDDDEDNVSLDELADVAS
FT                   EDEES"
FT   gene            534809..535510
FT                   /locus_tag="TM1040_0508"
FT   CDS_pept        534809..535510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0508"
FT                   /product="protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63241"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC5"
FT                   /protein_id="ABF63241.1"
FT                   /translation="MPELSLSGEPEVRVTLRRSAQARRMSLRISSLDGRVTLTLPKRVS
FT                   EREGRAFLLEKEDWIRSHLARQPERIDVGIGISLPIEGRTITIKAGAGRRVRHAEDTLV
FT                   VPEPAPARRLERYLRELARDRLAAASDLYAERLGRRYSSLTLRDTRSRWGSCSSAGGLM
FT                   YSWRLILAPPDILHYVAAHEVAHLKEMNHSRAFWATVEDIHGDYRDQRHWLQTEGNALH
FT                   RYRFEENVERD"
FT   gene            535543..536205
FT                   /locus_tag="TM1040_0509"
FT   CDS_pept        535543..536205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0509"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63242"
FT                   /db_xref="GOA:Q1GJC4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC4"
FT                   /protein_id="ABF63242.1"
FT                   /translation="MDKLLTGNRPTAENTGSAHDRVYRALRTRIMHGAIAPGASLTLRG
FT                   IGKEYDVSMTPAREAVRRLVAEGALFLSSSGRVSTPELSNERIEELAALRALIEVELAS
FT                   RALPRAHMALIDRLQAINGTVAEMISKRDAVGYIRTNLEFHRTLYLRAQAPAMLAMAET
FT                   VWLQLGPTMRALYGRLGRTEPPQNHKLIIAALKAGDEPGLRLALRTDVTQGLRLLAG"
FT   gene            536336..537115
FT                   /locus_tag="TM1040_0510"
FT   CDS_pept        536336..537115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0510"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63243"
FT                   /db_xref="GOA:Q1GJC3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC3"
FT                   /protein_id="ABF63243.1"
FT                   /translation="MGANPLRQSLLQEVRDLFAQEPALRGLYGYDPDQVGTVPALFAAV
FT                   LSSSSPDPKLRDLVRDLALKVFETGSELVEVILDDLLATTARDEAESAAQVLHSAHGFQ
FT                   ALMSYRLTRALWLDGRQTLALALKLQFTRVFSVEIWPQAQIGRGVWVDHGLGLVIGQAA
FT                   VIEDDVCLWHGVTLGSNFVDMGEARHPTLRRGVVVGAGATLLGPIEIGAGATIAAGAVV
FT                   TRDVPAGHVVAGPPASDRGVGRFAGFTPLQQLRGQDR"
FT   gene            537112..538005
FT                   /locus_tag="TM1040_0511"
FT   CDS_pept        537112..538005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63244"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC2"
FT                   /protein_id="ABF63244.1"
FT                   /translation="MTTLGIDHPLVCVRDLAAKRATYQSLGFLMKPPGMHPWGTSTALV
FT                   IFRNQLLELVSIEDESLLDGYAAGSFRFGRHVEAWLAEREGVCLSALNSMDAEADEAAV
FT                   LARGGSCAGTVEFGRDVVRDDGTPDRTKTTLKIFPHAGLPRLSMFACQQHRRDLIEFPD
FT                   WMDHPNGAHGFASATILAAPSDQGRVRDWLSVLHGADAVRDTDWGFEVATTNGRWRVVS
FT                   RATAPALLGKLPDGLASDGAPSVISLDIRCHALSQLRPFVEAGEFVCQDVNGALVLTEV
FT                   ARLGGILLSFHEIPKV"
FT   gene            538014..539153
FT                   /locus_tag="TM1040_0512"
FT   CDS_pept        538014..539153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0512"
FT                   /product="Peptidase M20D amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63245"
FT                   /db_xref="GOA:Q1GJC1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC1"
FT                   /protein_id="ABF63245.1"
FT                   /translation="MFDTTHIEEAIALRHDLHRHPELGFEEHRTSEIIAGLLHGWGWRV
FT                   HRGLAGTGVVAQMGQGEPVIGLRADIDALPMEEATGLAYASGTPGKMHACGHDGHTAML
FT                   LLAARKIAEEGVATGTVTLIFQPAEENDGGARVMIEQGLFREFPVDQVYGIHNWPGLAP
FT                   GRMVARDDKMMAAFAVFEIEVAGQGGHGAMPEQSDGVIAAAAAMASTLQEIPARALSPL
FT                   EPGVVSVTQIHSGSAWNVCPDRAVLRGTARWFDPAAGDTIEARLTQVANACAAAQGCSA
FT                   RIDYQRRYPATINSAVEAAAARAVAAEMGLETANVAPSMASEDFAFMLNEVSGAYIWLG
FT                   AARDGENPGLHSAKFDFNDAVLPVGAEFWVRLARRQLAT"
FT   gene            539153..540061
FT                   /locus_tag="TM1040_0513"
FT   CDS_pept        539153..540061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0513"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63246"
FT                   /db_xref="GOA:Q1GJC0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJC0"
FT                   /protein_id="ABF63246.1"
FT                   /translation="MDALETKFLREFLAVAHEGSIRRAADRLNVVPSAISRKIAEAEAR
FT                   LGVTLFERSSKGVVLTEAGELLREHAQHMRDEQTYLLDQIGHFRDGRSQIVRIATGEGF
FT                   AADLMGKGLLGLTRAHPELRFIVDHAGTDEIQRKVIEGESDIGIAYNPLITDATRSLAQ
FT                   ARQSLCVIAPTHSPLAQRKSVTLAEVLEHPVAMLNAGYAIRHLVGQAAADRGLALRVQA
FT                   EMASIPLLIHYVCAGVGISFLPRFCATSQAERGDLAVLDIEESSLQQVSTHLMVRARRR
FT                   LPKSVALVARYLAENMQAFRD"
FT   gene            540185..541099
FT                   /locus_tag="TM1040_0514"
FT   CDS_pept        540185..541099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0514"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63247"
FT                   /db_xref="GOA:Q1GJB9"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB9"
FT                   /protein_id="ABF63247.1"
FT                   /translation="MVATQNKRAGVIGLGAMGLGMARSLLKAGFAVSGYDPAETARENA
FT                   AAAGVWLTADTDAVFADCDVIVLSLPTAQHVLAVVQAAQAAGHLAQTGAARVIVDTSTS
FT                   EAATSRTLAAELSALGHGFLDAPVSGGPAGAASGQLSVMLGGETQWLEAARPALEAMAA
FT                   KILHVGPSGAGNVAKLVNNMLVANHMVTTLEALRLGEAAGVAAKEMLEVVNSATGRSAI
FT                   SEVHYPNWVLPRSFDSGFSAGLMRKDLRLARALAAEVSVATPMADRVAELWAETQSGLS
FT                   DSDDFMRMGDPQVDRLSAKEEQA"
FT   gene            541096..542631
FT                   /locus_tag="TM1040_0515"
FT   CDS_pept        541096..542631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0515"
FT                   /product="Aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63248"
FT                   /db_xref="GOA:Q1GJB8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB8"
FT                   /protein_id="ABF63248.1"
FT                   /translation="MTKEMIDITGRVATLLRDLTGTSEVRSYVGGELVQGSGAELELTD
FT                   PASGVVFARYRDAGPDVVARAAEAAQVAQKIWYAKTASERGRILFEIGRQIRQHAAALS
FT                   ELEALSSGRPMRDTGGEPARMAEMFEYYAGWCDKITGDVIPVPSSHLNYTRQEPLGVVA
FT                   QITPWNAPLFTCCWQVAPAICAGNAVMIKPSELTPLTSVVIGILCEKAGAPKGLVNVIA
FT                   GDGPGSGQAMIAHPETALVVFVGSAEAGSKIAAAAAKRLIPSVLELGGKSANIVFDDAD
FT                   IDRAVVGAQAAIFASCGQSCVAGSRLLVHRSVQTEVVEKLSAAAARIPVGDPMDPATQV
FT                   GPVNNLRQWNKIDTMVQAATRAGASVASGGGKPAALAASGGFFYAPTVLDAVTPQMEIA
FT                   NEEVFGPVVSVLPFDDEEEAIQLANATPYGLAGAVWTRDVGRAHRVAGAVRAGTFWINS
FT                   YKTINVMSPFGGFGRSGYGRSSGREALSAYTQTKSVWVETAENPAQGFGYAPG"
FT   gene            542752..543573
FT                   /locus_tag="TM1040_0516"
FT   CDS_pept        542752..543573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63249"
FT                   /db_xref="GOA:Q1GJB7"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB7"
FT                   /protein_id="ABF63249.1"
FT                   /translation="MNIKHIVLDWRLHLSAVVITVVAEAIGVVKVPIGFGAILLLPLLY
FT                   AFVLGLLINPNVVGAAKVWISDRNVKAASPMIVIAIMPFIAKFGTIIGPSMETIIAAGP
FT                   ALILQELGNLATIVLAFPVAVLVLRMGRESIGACFSVAREPNIAIIADKYGLKSQEGAG
FT                   VMGVYVIGTLFGTFIFGILASILATTGMFSIEALAMACGIGSGSMMAACSGALASAVPE
FT                   MKDQILALAGASNVLTYATGMYLCVFVALPVTEKLYDWLGSKETTAPQAGE"
FT   gene            543576..544052
FT                   /locus_tag="TM1040_0517"
FT   CDS_pept        543576..544052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63250"
FT                   /db_xref="GOA:Q1GJB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB6"
FT                   /protein_id="ABF63250.1"
FT                   /translation="MSETQFFEDPTVEQKLGLGVHAAALIVVCVVVLVGNTVATDNSLP
FT                   DGLVGLIVLWLISMVGLTLTEIVPFKLPSVAWISLVGIIATLPWTPGSAWVLDKVAHVN
FT                   FLTLATPCLAYAGIAIAKREIDIAKTSGWKIAVVAVLVMTGTYVGSAVVAQMFL"
FT   gene            complement(544203..545219)
FT                   /locus_tag="TM1040_0518"
FT   CDS_pept        complement(544203..545219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0518"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63251"
FT                   /db_xref="GOA:Q1GJB5"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB5"
FT                   /protein_id="ABF63251.1"
FT                   /translation="MKGPCPQAAEIECMKDMTQARAVPKAINWNRLQDDKDLEIWNRLT
FT                   VNFWLPEKVPLSNDIQSWSQLTPDEQTLTIRVFTGLTLLDTIQNAVGAPTLMQDAITPH
FT                   EEAVLSNISFMEAVHARSYSSVFSTLCQTTEVDEAFRWSAENEHLQAKSRLILGEYDAT
FT                   ASPLRKKIASVFLESFLFYSGFYLPMHWSSRARLTNTADLIRLIIRDEAIHGYYIGYKF
FT                   QRGLERASEAERKELKDFAFGLLFDLYDIEARYTEQLYDGLGLTEDVKNFLHYNANKAL
FT                   QNLGFEALFPEETCRVNPAIMAALSPGSDENHDFFSGSGSSYVIGKAVATEDDDWDF"
FT   gene            complement(545281..547413)
FT                   /locus_tag="TM1040_0519"
FT   CDS_pept        complement(545281..547413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0519"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63252"
FT                   /db_xref="GOA:Q1GJB4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB4"
FT                   /protein_id="ABF63252.1"
FT                   /translation="MLDASVTADLDYHALNAMLNLYDDEGNIQFDADRMAARQYFLQHV
FT                   NQNTVFFHSLDEKLGYLVEKGYYEPEVLDQYSRNFHRKIWDAAYAKKFRFPSFLGAFKY
FT                   YTSYTLKTRDGQRYLERYEDRVVMNALTLARGDEKLAMKLMSEIIDGRFQPATPTFLNA
FT                   GKKARGEFVSCFLLRLEDNMESIGRGINSALQLSKRGGGVALMLTNIREHGAPIKGIEN
FT                   QSSGVIPVMKLLEDSFSYANQLGARQGAGAVYLNAHHPDILRFLDTKRENADEKIRIKT
FT                   LSLGVVIPDITFQLAKKNEDMYLFSPHDVEKVYGQAFSEISVTEKYHEMVDNPQIRKKK
FT                   INARAFFQTIAEIQFESGYPYIMFEDTVNAANPIAGRIAMSNLCSEILQVNEPSKFNDD
FT                   LSYEQMGTDISCNLGSMNIARAMDGGDLAGTVGTAIRALNAVSEMSSIDSVPSIRKGNE
FT                   EGHAIGLGQMNLHGYLARERIHYGSAEGVDFTNIYFCTVLYHAISASNALAKEKKSKFK
FT                   GFEDSAYADGSFFEKYVEKDWLPETDRVKELFETAGVEIPTRKDWEALRDKVMKHGLYN
FT                   RNLQAVPPTGSISYINYATSSIHPITAKIEIRKEGKIGRVYYPAPYMTNDNLEYYRDAY
FT                   EIGPEAIIDTYAAATQHVDQGLSLTLFFPAEASTRDINRAQIYAWKKGIKTIYYIRLRQ
FT                   QALEGTEVEGCVSCSL"
FT   gene            complement(547395..547817)
FT                   /locus_tag="TM1040_0520"
FT   CDS_pept        complement(547395..547817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0520"
FT                   /product="nrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63253"
FT                   /db_xref="GOA:Q1GJB3"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJB3"
FT                   /protein_id="ABF63253.1"
FT                   /translation="MVGLVYYSSRSGNTARLMERLGLEALRLPQTEPSPEVDAPYVLVT
FT                   PTFADGEGRGAVPKPVIKFLNNSRNRALLRGVIAGGNRNFGDTFALAGDVIAKKCNVPV
FT                   LYRFELAGTETDIARMRAGLARFWAAQEQQTCLTQA"
FT   gene            complement(547839..548060)
FT                   /locus_tag="TM1040_0521"
FT   CDS_pept        complement(547839..548060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0521"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   glutaredoxin subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63254"
FT                   /db_xref="GOA:Q1GJB2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB2"
FT                   /protein_id="ABF63254.1"
FT                   /translation="MSITVYSKPACVQCTATTRALEAKGISFDLVDLTEDAAALEMVQG
FT                   LGYRQAPVVVAGEEHWAGFRPDLIGQLA"
FT   gene            complement(548599..548973)
FT                   /locus_tag="TM1040_0522"
FT   CDS_pept        complement(548599..548973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0522"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63255"
FT                   /db_xref="GOA:Q1GJB1"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB1"
FT                   /protein_id="ABF63255.1"
FT                   /translation="MSEVTASCLCGDIRVRASGSPIGVGLCHCMDCRKHHGAVFWAAAV
FT                   YPAEAVEVFGQTQQYQGRHFCPRCGSSVYSCSEGEVELHLGAMDQPNQFTPTYELWTDR
FT                   REHWLTPLARAHQHSRNRGA"
FT   gene            complement(549000..550034)
FT                   /locus_tag="TM1040_0523"
FT   CDS_pept        complement(549000..550034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0523"
FT                   /product="Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63256"
FT                   /db_xref="GOA:Q1GJB0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJB0"
FT                   /protein_id="ABF63256.1"
FT                   /translation="MSIFEKYLSLWVALAMTAGIALGSLAPGVMEAIAALEVARVNLVV
FT                   AALIWAMVYPMMIGVNPRSLRDVARQPKGLAITLVVNWLIKPFTMAALGVLFFEVVFAP
FT                   FLEPQDAQQYIAGLILLGAAPCTAMVFVWSQLTRGDESYTLLQVSVNDLIMVVAFAPIV
FT                   AFLLGVTDIEVPWSTLILSAVLFVALPLMAGLWTRNRLAEEARITAFLARIKPLSMLGL
FT                   ITTVVILFGLQGQVILDRPSVIAMIAVPILIQSYGIFFLAYGAAYALRVPHRIAAPCAL
FT                   IGTSNFFELAVAVAISLFGLHSGAALATVVGVLVEVPVMLTLVAFANRTRARFALTGAD
FT                   HQAS"
FT   gene            complement(550031..551305)
FT                   /locus_tag="TM1040_0524"
FT   CDS_pept        complement(550031..551305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0524"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63257"
FT                   /db_xref="GOA:Q1GJA9"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA9"
FT                   /protein_id="ABF63257.1"
FT                   /translation="MTQSPAQNGLAAYMAVTAAYWAFMLTDGALRMLVLLHFHTLGFSP
FT                   VQLAYLFILYEIAGMVTNLSAGWIAARFGLTTTLYAGLALQVVALLALTQLDPGWQIAT
FT                   SVAFVMGVQGLSGVAKDLAKMASKSAVKLLAPKEGDGLFRWVAVLTGSKNAVKGLGFGL
FT                   GAVLLALAGFTWATLGMALILAAILIAVLIAMPKGLPTGRKGAKFSEVFSKSANINWLS
FT                   AARVFLFGARDVWFVVGIPVYFYAVISDGTEASNRAAFFMIGSFMAVWIICYGAVQAAA
FT                   PRILRASSRSEAELISAARHWASLLALVPAALTVAVVMSGAPAPWLTATLVIGLLLFGA
FT                   LFAVNSSLHSYLILAFSKDERVTMDVGFYYMANAGGRLLGTLLSGLTYQLGGVAACLGT
FT                   AALMIALSALAAGRLSAPTSERATA"
FT   gene            complement(551302..552300)
FT                   /locus_tag="TM1040_0525"
FT   CDS_pept        complement(551302..552300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0525"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63258"
FT                   /db_xref="GOA:Q1GJA8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA8"
FT                   /protein_id="ABF63258.1"
FT                   /translation="MTVYAVNGLGRMGKLALNPLLERGAQIAWINDAVGDAEMHAHLLE
FT                   FDTVHGRWDAEFTCDAESITIDGTRLPVLNKTNLADLPLDGVDVVIDCTGVFKTDAKLA
FT                   PYFEAGVKKVVVSAPVKDGDAANIVMGVNHDIYDPSRHRIVTAASCTTNCLAPVVKVLH
FT                   EGIGIKHGSMTTIHDVTNTQTIVDRPAKDLRRARSALNSLIPTTTGSATAITLIYPELE
FT                   GKLNGHAVRVPLLNASLTDCVFEVARDTTVEEVNAFFKEAANGALDGILGYELRPLVSA
FT                   DYTNDTRSSIVDAPSTMVVNGTQVKIYAWYDNEMGYAHRLVDVAMMVGESL"
FT   gene            complement(552342..553172)
FT                   /locus_tag="TM1040_0526"
FT   CDS_pept        complement(552342..553172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0526"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63259"
FT                   /db_xref="GOA:Q1GJA7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA7"
FT                   /protein_id="ABF63259.1"
FT                   /translation="MEKEIPLRLSVLGHPQRLMVFRLLMRRYPDRVPAGEIATALDVKP
FT                   STLSSYLSALMQAGLVTQTREGTWLNYQVDMTGMRETLDALFLDCCRGRPDLCVPASAD
FT                   MTSEVPAMPDSKYNVLFICTGNSARSIFAETILHSEGAERFNVYSAGTRPYSELNPVAL
FT                   DVLRSKGHDVSRLRAKNVSEFIGDTAPKFDFVFTVCDRAANEECPAWEGQPISGHWGMP
FT                   DPVKAEGSEAEQSLAFQQAYGTLKNRIRAFAALPFTELDRISLQRAVDDIARTH"
FT   gene            553735..554442
FT                   /locus_tag="TM1040_0527"
FT   CDS_pept        553735..554442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0527"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63260"
FT                   /db_xref="GOA:Q1GJA6"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA6"
FT                   /protein_id="ABF63260.1"
FT                   /translation="MRRVLAIIAACLSLGLAETATAKDGRASSLPGWEAVGRLNIAGKY
FT                   MCTGTLIAPNLVLTAAHCVYDARTGQRVNPRGIRFEAGLDGRRVKAQRSVSKAVVHPAY
FT                   EFRTGGNSQLGADLAVLRLSQPINRSDIRPFAMSASANQGASVDVLSYSYHNATRASRE
FT                   QDCQVLSRRTRTLVMSCRVDFGASGAPVLEITPGQPPKIVSVISSKAAMGRRPVSIGTA
FT                   LDRTLRAMMQNAI"
FT   gene            complement(554564..555736)
FT                   /locus_tag="TM1040_0528"
FT   CDS_pept        complement(554564..555736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0528"
FT                   /product="Type I secretion membrane fusion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63261"
FT                   /db_xref="GOA:Q1GJA5"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA5"
FT                   /protein_id="ABF63261.1"
FT                   /translation="MSIAADMDILEGTHGASRMIKLVALVLVMFVTWAGFASVDEIVRA
FT                   DGQVVSSSRAQIVQNLEGGILAELYVRQGDTVQAGQILAKLQDTKFRAASDDLQDQIDA
FT                   LEIKQYRLEAEIEGAYEFAVPDALASRSPDILASERALLKARQSDFDSRRNSAEDILRQ
FT                   LKNELSNLQSLHEQKIVALLEVNEAKKKVSDAQAKFDEIGTQAELTLAEEYSDTLRELT
FT                   SLRQEQRLARDQLDRTVITSPMAGIVNSLAVTTIGGVVRPGDEILEIIPLGEELFVEAR
FT                   VKPEDIANVQRGQDVTIKLTAYDYTIYGSLRGKVDIVSADTFEDERDPRAAPFYRVTVR
FT                   VDRSSLTARQKQIEIRPGMRATAELQTGSKTILSYLLKPLYKSREAFREP"
FT   gene            complement(555733..558348)
FT                   /locus_tag="TM1040_0529"
FT   CDS_pept        complement(555733..558348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0529"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63262"
FT                   /db_xref="GOA:Q1GJA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA4"
FT                   /protein_id="ABF63262.1"
FT                   /translation="MTDQDSHTPAPPASKPAKRGLKLSSITPNLTRKRRGDAANQTEGP
FT                   VKISMVAPTANPKPANAEAKLDARLSVPKFLQRKAKPAAAETPAAPQTQAPPAVDPIEI
FT                   ESFVAPRPAATKPDAAPATEPLATFEPEEDPQNAEAADQDQMRPEPAPQTARETEAASA
FT                   SMVAAEDTLGRLKARAQLLCRLAALRGCTLHAQDMLEHLQASGPAALRPEAMMSALITA
FT                   GLKARVQSVKRPTPRHWPGIAIMQGGQPVLVLSQGKAGVTIYDSSCPDGRAEVPMQEFM
FT                   PYYAGQILTTRATLSQLTQRHTPQLDTSHWFWGEFPKYRRQMGEIMLGSLVANVLAVAV
FT                   ALFSLQVYDRVVPHQSQATLWVLAVGALMAIGMEGILKLARARITDAAGRQIDMAVQHK
FT                   LMRRVIGLKMDQSPLPPSGLFAALRDFASVREFFTSSTLSTLADVPFIAVFLLLVASIG
FT                   GPVVYVILIGAVLMLLPAYFIQKKMLAMTRLAQGASTKSGRLLNEVVNEMETIKTQRGE
FT                   ERVLRLWDELNLLSSQASNGQRKLASALTYWSQGVQQATYICAVILGTYMVFAGEFTVG
FT                   TIIATGILTSRTLAPLTQFAGTLARWSNVRAALDALDMIADAPQEREKGRAYLRRESIE
FT                   GRFELREVVFRYDPDAAPTVDVPAVAVLPGQRVAILGVNGSGKSTLLKLLAGLYTPERG
FT                   RVMLDGTDMSQIEPRDLRRHIGYLGQEVRLFAGTLRDNLNLSYLPHEDERIMEALEFAG
FT                   LAAFVRGHPRGLDLEIGDGGAGLSIGQRQAVGWARLHLQNPSVVLLDEPTAALDQTLER
FT                   TLVSRLDSWLGTRTAIVATHRMPILSLTNRTLILQAGRMVVDGPRDEVLAHLNGGSKAS
FT                   "
FT   gene            complement(558345..559640)
FT                   /locus_tag="TM1040_0530"
FT   CDS_pept        complement(558345..559640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0530"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63263"
FT                   /db_xref="GOA:Q1GJA3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA3"
FT                   /protein_id="ABF63263.1"
FT                   /translation="MALARRISAVALLCSLTACGLPLPGTLSGTQDSTAGRSNFAQAED
FT                   APQSEVITALMQRQSLLQGGTAYDTVASAALSASARASEAALISAKLRAEAKSTNWLPS
FT                   LRPTVSLNDLGEMVASMLLEQVLFDNGRRKAERAFAAADVEVAAVTLSADMNDRVKTAL
FT                   SLYVSGLRGDEKAAYAHRAIRTMRDFERVVVGRVNGGVSDRSDLNVVQSKISGMQSSMA
FT                   TANDAARTARAELQAMTGQSFPASPQRLSLDLPPDGSNYLSVLKAKSEATRAIEQAKME
FT                   RAGLLPQVSASGQVGSEGNGAGVLLNLAEPLGLGTPAALRAVEASKQAALRRIGEAEED
FT                   ARREYSREMQRLASYRRQEREALALSRASRETYNLFKAQFEAGQRPVMDVIPIYEELVK
FT                   REQAYIDAKYEVVMIQLALAASLGLLADGDKI"
FT   gene            complement(559749..562301)
FT                   /locus_tag="TM1040_0531"
FT   CDS_pept        complement(559749..562301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63264"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA2"
FT                   /protein_id="ABF63264.1"
FT                   /translation="MSTVAYITRNASGTNQHGTSAEGSPSVIPTNGATDISLNLDPSDV
FT                   QSYARRGRDLHITLFDGTVVELEGFYDPVATGSKNLFLSDGGDFIEVVLEDKADGMLFA
FT                   SYEPIDISGKWSAYDDMVFLDVDRIEPVVAPLAAPLLGGLGGLGAAAAGAAVLVGGGGG
FT                   GGGDGDGAIVPTVDDADGTYDVPEGDPDGVTITGTGEAGSTVEVDIGGVTGTTTVGEDG
FT                   TWSVDFPTSDLPGDGVYETVVDVVAPDGTTYDDLDGPTIDIDTEAPTVIVTEGTKSVND
FT                   IVNGDEQESGTIISGTGEAGATVTLVIEGHSQTTTVDENGNWTVTFSSDEIDTGEYETD
FT                   IEITTTDPHGNSTVSSDVLVVDTETTVAIDTGLAGGDDLINAAEAAAAAGVAITGTAEA
FT                   GAAVEVVVEGVTRTTTADSNGTWSVIYEAGTLPSGTYDADISVTSTDTAGNSATADSTI
FT                   AVDTEAGFVQLSDDPIETDDVINEDERADGVTITGTATPGETVTVQLGTAQGTVVADSN
FT                   GDWSYDFAASEIPEGTGDLDISATIQDSAGNTASDTDTVAYDTEVTNYTSADQNDTVGV
FT                   NLQQMQQGFTLQGTVEEGSSVSVEINGTTHDAVVDSSGNWSLTVDGDDIGSFSQGGLVA
FT                   TVTATDPAGNVDTLMQPIDIDTLYETPEFAGTTTIAGQIQSIFLDESDDALTMYSLDSS
FT                   GNATQLDATETSSGISGVDKLDLDTPISDGANLIVQSTDDAGNKSSTLVIDQENPTSSL
FT                   LSGLDGFNIDAIDLVFEDGTDGANLVLTEALIKEMSDNSDTLTIRADELANVTHEVTLT
FT                   GATEITSTVSGYSAYSIGDATVLIEEDAGISLNGTPVI"
FT   gene            563004..564938
FT                   /locus_tag="TM1040_0532"
FT   CDS_pept        563004..564938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0532"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63265"
FT                   /db_xref="GOA:Q1GJA1"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA1"
FT                   /protein_id="ABF63265.1"
FT                   /translation="MNKVAELFAEAYGQTREQEMSLQDYLMACRDDPSMYANVAERMLK
FT                   AIGDEELVDTSKDARLGPIFQNRTIKRYSAFKDFYGMEDTVERIVGYFRHAAQGLEERK
FT                   QILYLLGPVGGGKSSLAERLKRIVEDEPIYVLKAGDQMSPIFESPLGLFDPVRMGKLLE
FT                   EEYGIATHRLPGLMSPWAVQRLDEFEGDINKFTVVKLHPSRLRRICVAKVEPGDENNQD
FT                   ISTLVGKVDIRQLEHFSQDNPDAYSFSGGLNRATQGVLEFVEMFKAPIKMLHPLLTATQ
FT                   EGNYMGTESFGAIPFNGLILAHSNESEWQTFKNNKNNEAFIDRVSIVKVPYCLRVSDEA
FT                   QIYEKLIQNSELREAPCAPETLKILSRFSVLTRLKPHENSNLYSKMRVYDGESLKDTDP
FT                   KAKTVQEYQDRAGVDEGMNGVSTRFAFKVLSSVFNHDTQEVAADPVHLMYVLEGMIKRE
FT                   QFPQETEQKYLEFIKTELAPRYEEFIGNEIQKAYLESYTEYGQNVFDRYISYADAWIEE
FT                   QDYKDPDTGQLYDREVLDAELSKIEKPVGIANPKDFRNEVVKFALRHRANTGSNPAWNS
FT                   YEKLRDVIEKHMFSQVEELLPVISFGSKKDSKTESKHQEFVERMRAHGYTDRQVRRLVE
FT                   WYMRVNKAG"
FT   gene            564957..565316
FT                   /locus_tag="TM1040_0533"
FT   CDS_pept        564957..565316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63266"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJA0"
FT                   /protein_id="ABF63266.1"
FT                   /translation="MHHFIDRRANPKGKSLGNRQRFLRRARENIKERVDRSVKEKSIGA
FT                   GETVPENGEKITIPSKGLKEPRLYHGPGGNRRHVLPGNKDFVVGDTLDRPQGGAGEGGR
FT                   QASEDGGGMTSFPSP"
FT   gene            565370..566272
FT                   /locus_tag="TM1040_0534"
FT   CDS_pept        565370..566272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0534"
FT                   /product="protein of unknown function DUF444"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63267"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ99"
FT                   /protein_id="ABF63267.1"
FT                   /translation="MEKATVETETIGTRRAGLTTAGTPNNLNLVRTMRNSLGRRIALQR
FT                   PSTQTQRDLEAQVAELEEIEARSPSQDELLAELVAKLDGIKRKRRVVGYIDPLDLRYDT
FT                   FVPEKIRNSRAVVFCLMDVSGSMQEREKDLAKRFFLLLHLFLTRGYEHTEIVFVRHTHY
FT                   AQEVDEETFFYARETGGTIVSTALEKMKEIIDERYPPDEWNIYGAQASDGENFGNDSVR
FT                   CRKILTEQLLPMCQFYAYVEIVEESAQMLLDNTEAGEDLWQNYRQVKEACRHFEMQRVS
FT                   EPGHIYPIFREFFLPKVKG"
FT   gene            566278..567795
FT                   /locus_tag="TM1040_0535"
FT   CDS_pept        566278..567795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0535"
FT                   /product="SpoVR"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63268"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ98"
FT                   /protein_id="ABF63268.1"
FT                   /translation="METAKTATAPLFDGPEWTFELLEKARDAIEKIALGDLGLDVYPNQ
FT                   IEIISAEQMLDAYSCVGLPLMYQHWSFGKHFARDEALYRTGRQGLAYEIVINSNPCISY
FT                   NMEENTMAMQTLVMAHAAFGHNHFFKNNYLFQQWTDADGIQDYLAFAKNYIAACEERYG
FT                   FDAVEEILDAAHALQSQGVFRYGRPPKPTIEERRAMQQLREAYEKGQSALDIWTDATLG
FT                   LKRDADAPDADLDHSERRKRMNLPQENILYFLEKHSPVLEPWQREILRIVRMLAQYFYP
FT                   QKQTKVMNEGCATFVHYYIINELYEQGLITQGAMMEMMHSHTNVVMQPEYDDPRYSGIN
FT                   PYALGFAMMQDIRRICEEPTEEDREWFPDIAGSKDWRGVLRNAWANYRDESFIQQYLSP
FT                   HLIRKFKLFTLTDDESHPKLVISQIHNRAGYKAIRRDLAKQYDLAYIEPDIQVSDADLK
FT                   GDRTLKLVHKVRDNVHLAEADRDEVLKHLRRLWGYDVKLDAVADGPQ"
FT   gene            complement(567866..568981)
FT                   /locus_tag="TM1040_0536"
FT   CDS_pept        complement(567866..568981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0536"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63269"
FT                   /db_xref="GOA:Q1GJ97"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ97"
FT                   /protein_id="ABF63269.1"
FT                   /translation="MIKTRAAVALEAGKPLEIMEVNLEGPKAGEVLVEIKATGLCHTDE
FT                   FTRSGDDPEGIFPAILGHEGAGVVIEVGEGVKSLKPGDHVIPLYTPECRECDYCLNPKT
FT                   NLCQAIRSTQGQGLLPDGTTRFSLPDGTPIHHYMGCSTFANHTVVPEIALAKIREDAPF
FT                   DKVCYIGCGVTTGIGAVINTAKVEIGSTAIVFGLGGIGLNVIQGLRLAGADQIVGVDLN
FT                   PGKVAMAEKFGMTDFVNPSEVEGDLVAHLVELTGGGADYTFDATGNVSVMRTALEAAHK
FT                   GWGESIIIGVAPAGAEISTRPFQLVTGRSWRGTAFGGASGRTDVPKIVDWYMDGKIEID
FT                   PMITHKLTLDQINEGFDLMHEGKSIRAVVEF"
FT   gene            569385..569786
FT                   /locus_tag="TM1040_0537"
FT   CDS_pept        569385..569786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0537"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63270"
FT                   /db_xref="GOA:Q1GJ96"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ96"
FT                   /protein_id="ABF63270.1"
FT                   /translation="MNIGDVAAKSGLPAKTIRYYEDIGLICPNRSANGYRCFEERDLHK
FT                   LAFLGRARALGFSIEDCRVLLGLYEDDSRASADVKQLAQAHLCKIEAKISDLAAMRETL
FT                   SELITCCSGDNRPDCPILKDLSGETDPIG"
FT   gene            570587..571387
FT                   /locus_tag="TM1040_0538"
FT   CDS_pept        570587..571387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0538"
FT                   /product="transcriptional regulator, SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63271"
FT                   /db_xref="GOA:Q1GJ95"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ95"
FT                   /protein_id="ABF63271.1"
FT                   /translation="MVVVLKVRQYGAFGVYRPDGEPIQLGAKHQALMALMVTAEEGVRT
FT                   RAFLEHTLWSFAQPEQAKASLRTALSTLRKHIGPTASAAFKANRERVTLDLSMIEVERD
FT                   PARGEFMEGFELPHENAFSEWLSEMRSQASGTASVAQEQPWAPRDRSRVILDELLPSIA
FT                   VLPFAQRAPGGSTAPLGAILSEELSRQLSRSQAFSVTSYLASRQFSLEDVRPAEVSSVA
FT                   GVSYLVSGSVFVRVTILLRKLICMTRIGKKSFGRGSFVGAFRIC"
FT   gene            571387..572250
FT                   /locus_tag="TM1040_0539"
FT   CDS_pept        571387..572250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63272"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ94"
FT                   /protein_id="ABF63272.1"
FT                   /translation="MGQGGALRDATSQIGQTVVGEAVRLVSFRPLGNLANHTLLMAAIV
FT                   MMQSKHPDQFEKSNEILDTLMEREMHHPVVLTWAGIWHVMRVQKGLSGDRRKSTLMAEN
FT                   LANAALAQDPAFSLAHTLKGMIASYLTFDFDNAQYSYDKALQDNPNEALALLLKGATRA
FT                   MQNRPDEGVVLTEAARKLTPLGPQRYYFDSLAAAVSLAARDYNRAIELADRSLEENDSY
FT                   PSTLRTKAIALQMSGRSDEARHVVESLMKVTPDFSLSRYMQEHAAGFTPSGPDWASALR
FT                   EAGVPE"
FT   gene            572500..572574
FT                   /locus_tag="TM1040_R0011"
FT                   /note="tRNA-Gln1"
FT   tRNA            572500..572574
FT                   /locus_tag="TM1040_R0011"
FT                   /product="tRNA-Gln"
FT   gene            complement(573038..573619)
FT                   /locus_tag="TM1040_0540"
FT   CDS_pept        complement(573038..573619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0540"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63273"
FT                   /db_xref="GOA:Q1GJ93"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ93"
FT                   /protein_id="ABF63273.1"
FT                   /translation="MASFPALPARSFCLIRHGETTANRDEIIAGRLDVALTDLGRQQAS
FT                   LLKEISFPEPITLFCSPMDRAIKTASLGFHDTTAQVVPDLRERDWGVFEGRPLSELPPR
FT                   DSTPPQGEGWRDMILRVHAAITWCCTQSQGALPVLVCHSGVIRATRLLAQQTGVGTRPA
FT                   NATPILFEHHSGKHIEQWPDHSGANTARLR"
FT   gene            complement(573619..574689)
FT                   /locus_tag="TM1040_0541"
FT   CDS_pept        complement(573619..574689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0541"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63274"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ92"
FT                   /protein_id="ABF63274.1"
FT                   /translation="MSTITVLSGIGDKGPAAMRLDTGRHRWLLDCGFGPEANATFDPDW
FT                   LIGVDAVFVTHDHIDHIGGAAYAVEAGLPIYATRRTAQALPPSAQVIALPEQGETHLDG
FT                   ICLTTGRNGHALGGVWMHFDLGAGLFYSGDWSEESQWFAFDEPPDAATAIIDCSYHLSN
FT                   VPQSQRLQDLDALIDDLGGQILFPVPPSGRAGELALHLMHRFGPEAVLLDPECCDSLRA
FT                   ALRSGGVAPRAQEIAPLLERGPLDEARFLICDTPNADGGAAWAYVRAWRESGRLGRDAH
FT                   VIFTGHMTAHARGIEAVEGGYFRRWNVHPPLSDQIAMIRRLGTKRYAPAFCTMPEDYLV
FT                   EEGFDAQVFLHETVEL"
FT   gene            complement(574699..575739)
FT                   /locus_tag="TM1040_0542"
FT   CDS_pept        complement(574699..575739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0542"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63275"
FT                   /db_xref="GOA:Q1GJ91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ91"
FT                   /protein_id="ABF63275.1"
FT                   /translation="MAELTLSDITKHFGDAPALRSISTTVRDGEFLALLGPSGCGKSTL
FT                   LRLLAGFETPSEGRISIGTREVANAERRLNLPPEERNIGFVFQSYALWPHMNVRRNVGY
FT                   PLEIRRLPRAEQDARIDAALQATALEPYGARMPAELSGGQRQRVALARCLVSDPTAVLL
FT                   DEPLANLDVALRASMQQVFSDFHQRTQATMVYVTHDQAEAMAMADRIAVMNQGEIVQLD
FT                   TPEALYARPRSRFVAEFVGEGAVVPLIGATHHDRGAEATLLGARYPIETDTQTPALACL
FT                   RPENLQISDAGNIRARVERVTYLGGRYRLELTAASGDSLVTQSATRFALGEQIGLTLSA
FT                   PWAFAA"
FT   gene            complement(575727..577433)
FT                   /locus_tag="TM1040_0543"
FT   CDS_pept        complement(575727..577433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0543"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63276"
FT                   /db_xref="GOA:Q1GJ90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ90"
FT                   /protein_id="ABF63276.1"
FT                   /translation="MSSLAAYSSSSRSEGRLLSLILVLAVVLTLAPVVRLFVEGLTAGD
FT                   QLNFGFFAEVLQKPATLSALKHSLVTAGLGTALSLLIGGCFAFLVALTDLRRKGALVFC
FT                   LMIPMMIPPQITALSWTQIMGPSSVFLKTLGLAPPLGAPQPLYSPAGIILLLGIQHTSI
FT                   IFLTLRAGLRAIPQDVVEAARVSGAKGFRIWAQVVLPLTLPSLLAGVAITFVTALGNFG
FT                   IPAMLGIPAGYATLPTLIYQRLAGMGTTVLAEVAVLATLIGVVAIAGILLQRFCQSRQR
FT                   VHLVGGSGRALSIPLGKARLPIEIALWSVIATILVLPMAGLLATSLVPAYGVPLRLDTL
FT                   SFEGWHEALFRQPVTQRAFVNSFGLSLGAAALLMALCLPLAWLMERHKTRLGRVFDSLL
FT                   DLPYALPGVVLAIAMILLLINLPFTDVTLYGTIWIIFIAYLARFFAVMFRPVQSSLRQL
FT                   DPAMDEAAQAVGAPLWRRLRDIILPLSAPSAAAGAILVFLTAFNELTVSALLWSSGTET
FT                   LGVVIFNLDDSGETVMASAVAMTIVFVVMILMAVIQATSRHLPKGVVPWQS"
FT   gene            complement(577430..578398)
FT                   /locus_tag="TM1040_0544"
FT   CDS_pept        complement(577430..578398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0544"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63277"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ89"
FT                   /protein_id="ABF63277.1"
FT                   /translation="MKPLLSAALLAFTASASMAETLTLYTSQPNADAQMTVDAFMKANP
FT                   EIEVEWVRDGTTKLMARLMAEIEAGNPQPDVLLIADTATLEGMAQNGQLKAYQSPEAAA
FT                   YDPALYSAEGYYHSTKLITTGIVYNTGAATQPTSWADLADPALKGQIAMPSPLYSGAAL
FT                   IHLATLTGDKDLGWDYYGDLASNDARAQGGNGGTFKAVASGEKPYGVVVDFLAIRNKAD
FT                   GSPVEFVFPEEGVSYVTEPVAILESAKNVDAAQKFVDFVLSQQGQDLVLDMGYIPARND
FT                   MGVPAGFPARDEIKLMSFDPAQALTDADANKAKFAELFGAE"
FT   gene            578562..579359
FT                   /locus_tag="TM1040_0545"
FT   CDS_pept        578562..579359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0545"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63278"
FT                   /db_xref="GOA:Q1GJ88"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ88"
FT                   /protein_id="ABF63278.1"
FT                   /translation="MRRGELNERRDAIIRLLCAQDELSAQDLAARLNVSVQTIRTDLRE
FT                   LDEAALVQRRHGRVRLRQPSENIGYAPRMSVARSEKQQIAMAVKPMIEDGSRVALGTGT
FT                   TVEACARQLAASHRDLFVATNNIHAVIALQGASGVSVSLAGGAVRLRDLDFVGAASRAF
FT                   FADYMVDIAIFSCGGLSLSGDVLDYNTDEIAAREAISTCATRRVLVVDREKFGRALPCR
FT                   KHMIWDYDVVVTGADFPREIMRKCQEAGCEVLRVATDERPLRA"
FT   gene            579549..580178
FT                   /locus_tag="TM1040_0546"
FT   CDS_pept        579549..580178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ87"
FT                   /protein_id="ABF63279.1"
FT                   /translation="MIPVSLKAATAAAFAISLSACGGNPRTDFNEFSSVSTRLDIDSDL
FT                   SGLTRVAIAPDQEQSMNVFLTGYSWWDNTPRGSAIIARPVIHRSAGGIGTYDDPITLAV
FT                   GHKKTGGRSIMDYKPGTRFYIERLQKYAIVEDMCGDGPRPQDGPCHTGHKGHDWIDIYV
FT                   GGRRMDEASVDACMRHITGIQSVILNPRPGYPVTPGEIASTGCRTF"
FT   gene            complement(580200..582749)
FT                   /locus_tag="TM1040_0547"
FT   CDS_pept        complement(580200..582749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0547"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63280"
FT                   /db_xref="InterPro:IPR021478"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ86"
FT                   /protein_id="ABF63280.1"
FT                   /translation="MKRRCFLKSLGAGAALIPVKSFATDFIGAVTPQTYPVITGIDATT
FT                   SVPHLIAALDSFWERNIPVTCVVSPFDGEGAPLSPQHPLARVLSGYLLGGSGIELAPLT
FT                   ADLATLSQHFQARRAHGALAALREMLSPVERTLGLPIRVPTLACHDVARPASPMAVRSA
FT                   GVFNILSLPRASAPIVSQTWENGVARLFGGRLVDLFQTGEAAPELPAATQNVDYLSATS
FT                   FAQVDVDDLKALTDRYAQRLAQQEVDGTASLLPVSDLQLRDAYDFKRSICVYVQSSLNA
FT                   PAPDAPSALTRLLDRMKLPYLQSPALAGPSASQLAIWVPTETPTHGGEPPPQPHPVTLT
FT                   GVSATGAPLLTTTRPLSAGIAVRLDVDPASHLGIGADGVLTLPRRDVDAPITPESLQAA
FT                   FTGLNDVVVVLRSDDFSDDSTLTALEHALTSAKRTPVTEFTSLEKMTQGMIPNGPLPLR
FT                   YRRVAATQPELTLRKLQLSEERRAELLEDAQVAWRYLERFTHPETGLCPSTVDSSPGGR
FT                   LHEAVTMWDVGSHINGLVAAKQIGLIDKQRFETAIRKILPNIAGRVSDDRRLPQGWIRT
FT                   DRTRWGNRNFDASDAGRLLASLDNLRRHSDFGDQLLKLVASYDLDQVIIDGEVHSVTDG
FT                   KLHSAYVSHSAHYVARAFRRWGHDVRSPYEVFEGRSEPDGQMALLEAVATIGPIGAEPL
FT                   LLEALELGMSQESAYLADVLFSTQLEDFRETGRLICVSEGPIDTSPWFLYQGLQLDAET
FT                   RTWAMDTVGQEPEYRTPEFRDEYLAVSSKAAYLWSALQPHSYSDRLRAYVRENAKTDNG
FT                   YSSSIFVRSGRATRNYTDLNTNSVILQAIAHQLTTSG"
FT   gene            complement(582746..585754)
FT                   /locus_tag="TM1040_0548"
FT   CDS_pept        complement(582746..585754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0548"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63281"
FT                   /db_xref="GOA:Q1GJ85"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ85"
FT                   /protein_id="ABF63281.1"
FT                   /translation="MSLNESCNQLGVLVPDWLRLETTPEGPVVKIESEESRAPLVDYRS
FT                   TSGHAPDLMPVLEVDTGSDKAGFLRNLSTPETAQSVTSQVLAQLRPLYAQGTCISIPGL
FT                   ETADLDVLQPFFKTLTSSLRSEGHSPCLILSGTSTAWQSRETTALFDKVILKLFLDPWV
FT                   GTAPSPLATDAWFEKTAKAALQEIGKDKLVIALGTFAVEWVSGEPLPKVLPYAAAMEKI
FT                   AAAGAELRFSEKTSGSLASYRDPEGRLNKIWMQDVASLINQLVILQQLEIPNSAVWSLG
FT                   LEDPGIWSVLQNRDLSHDALSADLALVKLDSYVSYRGEGALLRLHRRQSPGIRQIGFDT
FT                   ETGRVVSQSYDLLPRPYALERYGKPAGRKVVLTFDDGPHPVFSEQILDILQETQTPATF
FT                   FVTGKSVMNAPEVLNRMIDEGHEIGAHTFSHPRMDQVSKTRATLEYAMLDKVVAGAAGR
FT                   QLTLYREPFQRSGGPVTADRVAALEIAWDRDMQVVGMDVVPHDWAGWSGREIADFAIEE
FT                   VERGAGNVILLHDGGEDRTASVEATRLIITELSAKGYEFTTVADLTGSTRAALMPVTEG
FT                   GYQTFDRVSFSLVAWGQDAIVILFWLALGIGVVRSVAILLLAVLNWRGHRTISLTTPKV
FT                   AVIIPAHNEEKVIRSCIQSVRASDYKNLEIIVVDDGSSDNTLNEIFAFSHMREVRLISQ
FT                   PNQGKWSALNRALMNTSAEIVVCIDADTQIEKSAIGHMVRHFDNPRIGAVAGKIIAGNK
FT                   VNLLTRLQALEYTTAQNVERKAFDLINGMLVVPGALGAWRVAALRKAGHFSDETMTEDT
FT                   DLTIEVNRAGYRIAYEPLARGYTEVPERIGQLLKQRLRWSFGMFQSAWKHKKAMFEGRS
FT                   VGLISIPDMFIFGYLFPLLAPIADLFVAILLYQMVSGGWDSGAVGAQNMQYLLAYLTLP
FT                   ALEFVIAAFALARDKDESMWSLLLFPVQRVLYRPILYYSVIRAILRAITGRLFSWGAQK
FT                   RLGRDYSLATSGT"
FT   gene            586629..587639
FT                   /locus_tag="TM1040_0549"
FT   CDS_pept        586629..587639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ84"
FT                   /protein_id="ABF63282.1"
FT                   /translation="MHYINISDLTDRSWRFLEPYDTEARMGWEMHHGLARNALERAITR
FT                   PALGRYRACLEAVRAARRRADAVLVSHLPNVTVATAALARGLRVTRPHVAFAFNYTQVP
FT                   TGRRLALSRRVLRNIEEFTVFSRYEIGLYAELFDLPSERFTYLPWAMEPPEVAEGMERP
FT                   FDRPYFSAIGGEGRDYRVLAEAMAQAPELRLAIVARPAGIAGIAFPDNVSVFTNLPAPV
FT                   TWAIAQQSCGMAIALKSNHTPNGHVTMVGAQRLGIPLVVTDSLGVADYVDAETALMVAP
FT                   QEVTDMTRALRAVVEDPEAATQRAERAKERAATCSDPRVWLRYFAGLDLRLSGAR"
FT   gene            complement(587652..588155)
FT                   /locus_tag="TM1040_0550"
FT   CDS_pept        complement(587652..588155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0550"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63283"
FT                   /db_xref="GOA:Q1GJ83"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ83"
FT                   /protein_id="ABF63283.1"
FT                   /translation="MSDHPRNRTDESLIALRRILRATELYSRNLAQASGLTPAQLRVLQ
FT                   LLATNGGSATPKELAQTMGVAQATVTALVDKIVSRGMATRMRSEADRRQTNVVLEPSGR
FT                   EAVKAAPDALQQRYVRAFEKLRDWEQAQLLASLERVAAMLDADDMDAAPVLTTGDIKSA
FT                   DRPS"
FT   gene            588383..588934
FT                   /locus_tag="TM1040_0551"
FT   CDS_pept        588383..588934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0551"
FT                   /product="L-24-diaminobutyric acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63284"
FT                   /db_xref="GOA:Q1GJ82"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ82"
FT                   /protein_id="ABF63284.1"
FT                   /translation="MPKDILQTETDSPRTCQPRLRKPNATDGADIWELVRACEPLDRNS
FT                   MYANLIQADHFRDTCVVAELDGDIVGWISGHIIPGEDAFFVWQVAVGEAARGMGLGKKM
FT                   LKALIARDDIRDASVLKTTITKDNAASWGLFRSFARDIGGELSDAPHFEREVHFDGAHD
FT                   TEHMVTITLDNEAKILKRAA"
FT   gene            588982..590268
FT                   /locus_tag="TM1040_0552"
FT   CDS_pept        588982..590268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0552"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63285"
FT                   /db_xref="GOA:Q1GJ81"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ81"
FT                   /protein_id="ABF63285.1"
FT                   /translation="MPKDMATDTSIYTRRESNARSYCRSFTASFDTARGSELFTEDGTR
FT                   YIDFLAGCSSLNYGHNDPDMKDALVAHILKDGITHGLDFHTEAKEAFLHSFTDLILAPR
FT                   GMDHKVMFTGPTGANAVEAAMKIARKVTGRTNVISFTNGFHGVTMGALAATGNGYHRGG
FT                   AGMDKAGVTRMPYDAYVDGVDSAALLDKMLSDPSGGIDAPAAIMLEPVQGEGGLNAASA
FT                   GFVKKVQEIAHKHGALLIIDDIQSGCGRTGTFFSFEDMGVQPDVVTMAKSVSGFGLPMA
FT                   MVLVRPQHDVFGPAEHNGTFRGNTHAFVTARVAIEKFWADDAFQTELARKSELVTSALQ
FT                   EVASHIPGAYLKGRGLMQGVDVGSGELAGDICARAYELGLVVETSGPNDEVVKILAPLT
FT                   TSEQLLCEGFAILSTAAREVAAKTKIAAQ"
FT   gene            590293..590685
FT                   /locus_tag="TM1040_0553"
FT   CDS_pept        590293..590685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0553"
FT                   /product="Ectoine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63286"
FT                   /db_xref="GOA:Q1GJ80"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ80"
FT                   /protein_id="ABF63286.1"
FT                   /translation="MIVRDFNELKNTDRSVSDARWTSTRMLLADDGMGFSFHITVLEAG
FT                   SEHQFHYKHHFESVYCMKGKGSITDIATGETHEIKPGVMYALNLHDKHILRAEEELHMA
FT                   CCFNPPVTGTEVHREDGSYAPAEELA"
FT   gene            590711..592147
FT                   /locus_tag="TM1040_0554"
FT   CDS_pept        590711..592147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0554"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63287"
FT                   /db_xref="GOA:Q1GJ79"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041748"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ79"
FT                   /protein_id="ABF63287.1"
FT                   /translation="MTHTVEKIGGTSMSRVNELVGTLFTGGRKPDDLYGRVFVVSAFGG
FT                   ITNLLLEHKKTGEPGVYARFADAESDHGWHEALSRVGDEMRKAHEAVLENAGDVAQADA
FT                   FVSERIEGARNCLIDLQRLCSYGHFRLAEHMLQIRELLSGLGEAHSAYVTALLLQRAGV
FT                   NARFVDLSGWRDEGDVTLEERISSALNDVDPATEMPIVTGYAQCAEGLMREFDRGYSEV
FT                   TFSCLAALTGASEAIIHKEFHLSSADPKLVGEGVAQKLGHTNYDVADQMSNMGMEAIHP
FT                   KAAKTLRQADVPLRVTNAFEPEDPGTLIDDKPADQPAVEMITGLDIIALELFEQDMVGV
FT                   KGYDAAILEVLTRHDVRIVSKTSNANTITHYLDTSLTVLKRVEKDLAKIYPNADISARL
FT                   LSMASAIGRDLKGLSVLTRGLQAIADVGLASLGASQGPRNVDVQFIVEREDLKPVISAL
FT                   HKVLVEGRPAKQEKPIKAAA"
FT   gene            complement(592559..593632)
FT                   /locus_tag="TM1040_0555"
FT   CDS_pept        complement(592559..593632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0555"
FT                   /product="fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63288"
FT                   /db_xref="GOA:Q1GJ78"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ78"
FT                   /protein_id="ABF63288.1"
FT                   /translation="MNPLTSSNPYFAGLFADQEITALFEGAATADAFLAYEMALTRAAA
FT                   EVGQIDIGLAQRALAAMVDFTPDVAELQSDLSADGMAVPGYVRQLKAHVGAECVAAVHP
FT                   GATSQDLIDTAQALALRAANEIYISRLTTLIDALRDLEETHGDNRLMGRTRMQAALPIS
FT                   AGHRISSWISPLVRHTSRLEILRPEVEALQFGGPVGDGQRSQPHAAAMADHMGKALGLR
FT                   APERCWHTERDSLVTYAGWLSALTGSLGKFGQDVCLMVQQGVDALAQAGGGSSSAMAHK
FT                   QNPVTAEMLVTLSRYNAGQVALMHQASVHEQERSGAMWTLEWMVLPAMMTCTGAALRLA
FT                   TRQVQAITRIGEPPTTR"
FT   gene            complement(593672..594505)
FT                   /locus_tag="TM1040_0556"
FT   CDS_pept        complement(593672..594505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0556"
FT                   /product="protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63289"
FT                   /db_xref="GOA:Q1GJ77"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ77"
FT                   /protein_id="ABF63289.1"
FT                   /translation="MSTPCILCVAITGSLPTKDNNPAVPITISEQIESTHEAFEAGATI
FT                   CHAHVRNDDQTPSSDPEKFERLKEGLEKHCPGMIIQFSTGGRSGAGKARGGMLPLAPDM
FT                   ASLSVGSNNFPTRVYENPPDLVDWLAGEMRTHQVTPEVEAFDLSHILNAIALHKSGALY
FT                   GKLYVQFVMGVKNAMPADKEVFDFYVDLVKRRAPDANWCAAGIGANQLVVNEWAIAAGG
FT                   HTRAGLEDNVRLDRNTLAPSNAALIRRAAELCEKYERPVATWQQAREILDVPLRA"
FT   gene            complement(594515..595132)
FT                   /locus_tag="TM1040_0557"
FT   CDS_pept        complement(594515..595132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0557"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63290"
FT                   /db_xref="GOA:Q1GJ76"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ76"
FT                   /protein_id="ABF63290.1"
FT                   /translation="MVQPLTHLKESPSQTAGPYVHIGCTPNFADIAGVYPEDLGQKMIL
FT                   GDVKGQRIRITGHVIDGTGTPLRDALVEIWQPDAAGLFNAPSETRGAADPNFTGFGRCP
FT                   SDMTTGAFAFDTVKPGAVPFVDGRMQAPHVTFWIVARGINLGLHTRMYFPDEADANVAD
FT                   PILTRIEHQTRVKTLIAEAQGDGQYHFDIRLQGHNETVFFDI"
FT   gene            complement(595135..595857)
FT                   /locus_tag="TM1040_0558"
FT   CDS_pept        complement(595135..595857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0558"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63291"
FT                   /db_xref="GOA:Q1GJ75"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ75"
FT                   /protein_id="ABF63291.1"
FT                   /translation="MSNGYVNRDRRWHPPSITPDYKTSVARGPRHAPLSFPTTLVEETG
FT                   PVFGHEILGPRDNDLILNFAKDGGMAIGPRIIVHGQLRDEFGRGVPGALIEVWQANAGG
FT                   RYRHKKESYLAPLDPNFGGCGRCITDAEGFYEFRTIMPGPYPWPNTMNDWRPAHIHFSI
FT                   FGASFAQRLITQMYFEGDPLIWRCPIVDTIPTREAIESLVAPLDMARTVPMDARAYKFD
FT                   ITLRGRRQTLFENRMEGL"
FT   gene            complement(595854..596258)
FT                   /gene="pcaC"
FT                   /locus_tag="TM1040_0559"
FT   CDS_pept        complement(595854..596258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="TM1040_0559"
FT                   /product="4-carboxymuconolactone decarboxylase (PcaC)"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63292"
FT                   /db_xref="GOA:Q1GJ74"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ74"
FT                   /protein_id="ABF63292.1"
FT                   /translation="MSDCPSNDRYGAGMAVRRKILGDAHVDRAEAAKTAFDEPFQTLIT
FT                   ETAWGNVWASDGVSDRERSMLTLALLAALGNFDEIPMHIRATARTGASKTDVLEAFQHV
FT                   AVYAGVPRANHALKLAKETYAEMDREDQQS"
FT   gene            complement(596251..597039)
FT                   /locus_tag="TM1040_0560"
FT   CDS_pept        complement(596251..597039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0560"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63293"
FT                   /db_xref="GOA:Q1GJ73"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ73"
FT                   /protein_id="ABF63293.1"
FT                   /translation="MRVARLQNAMLHWREDGSPDGPAVVFANSLGTDLRLWDAVIARLP
FT                   QNLRLIRYDKRGHGLSSCPEGPYSIDDLAEDALELLDYAGVSSCVFVGLSIGGMIGQTL
FT                   AARAPDRISALVLSNTAAKMGERQMWLDRIQAIESGGIAALSDAVMARWFAPAFLETDA
FT                   HILWRHMLERTPEAGYIASCHAIANADLHALTQTLHQPTLGIAGRYDGASPPALVEATI
FT                   DLIENARFNVIEDSGHLPCVEAPDAYAGMLTDFIKELGHV"
FT   gene            complement(597039..598208)
FT                   /locus_tag="TM1040_0561"
FT   CDS_pept        complement(597039..598208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0561"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63294"
FT                   /db_xref="GOA:Q1GJ72"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ72"
FT                   /protein_id="ABF63294.1"
FT                   /translation="MRTQVVIVGGGPSGMLLGQLLHLNGIDTIVLERRTKEHVLSRIRA
FT                   GILEQGLVELMHKAGVGARLERESFRHHGTLISHNDEMFGINFERLIGKSVTLYGQTEV
FT                   TRDLYEARESVGATTFFDVEDATIHDADTESPYVTFQKDGKETRIDCDFIAGCDGFHGV
FT                   SRRTIPASVRTEYEKVYPFGWLGILSETPPVNEELIYANSEDGFALCSMRNANLSRYYV
FT                   QCSLGDDVGDWTDTRFWDTLRRRLPSEVAEALVTGPSIEKSIAPLRSFVSEPMRWGRLF
FT                   LCGDAAHIVPPTGAKGLNTAASDVHYLYTGLIQYYEDKDSEGIDRYSEKALARVWKAER
FT                   FSWWMTSLLHRFPDQGPFDVKMQAAELAFLRDNKDAQRVLATNYVGLPY"
FT   gene            598290..599228
FT                   /locus_tag="TM1040_0562"
FT   CDS_pept        598290..599228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0562"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63295"
FT                   /db_xref="GOA:Q1GJ71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ71"
FT                   /protein_id="ABF63295.1"
FT                   /translation="MVNYQHARQVKIRHMQCLLEVVSCGSLKGAAERLYLTQPAISRTL
FT                   KELEDILGSTLLLRSRAGVELTEAGEVFAHFARMSLAALDHGLESLERTRGGALQQTVT
FT                   IGALPSVAAGLLPRVAEGFQRLAPGAVLHLSDGPHGALIDLLRGGAVSMVIGRLGDPAS
FT                   MQGVSFTQVYTEEVVCVVRPGHPCLAAPELDDLSRWPVIFPPVSAAIRPQVERWLISHG
FT                   LSEPPNRIETVSGAFARVHARDTDAIWMISHGVVRNELSDGRLIRLPFDTSLTKGPVGL
FT                   MQRQDADPSPLESLFVKALHEAIEVLGYDAS"
FT   gene            599575..600474
FT                   /locus_tag="TM1040_0563"
FT   CDS_pept        599575..600474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0563"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63296"
FT                   /db_xref="GOA:Q1GJ70"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ70"
FT                   /protein_id="ABF63296.1"
FT                   /translation="MANYANLPAPSPEGGLNRYLQEIRKFPLLEPEEEYMLAKRWVEEQ
FT                   DTEAAHKMVTSHLRLAAKIAMGYRGYGLPQAEVISEANVGLMQAVKRFDPEKGFRLATY
FT                   AMWWIRASIQEYILRSWSLVKLGTTSAQKKLFFNLRKAKARIGALEDGDLRPEVVKKIA
FT                   TDLGVTEDEVISMNRRMSGGDASLNAMVGSDGDSTMQWQDWLEDEDADQAGDYEARDEL
FT                   QARRELLAEAMSVLNDREKDILTQRRLAEQAKTLEELSVQYDVSRERIRQIEVRAFEKL
FT                   QKKMRELAAGKGMLQSKL"
FT   gene            complement(600959..602131)
FT                   /locus_tag="TM1040_0564"
FT   CDS_pept        complement(600959..602131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0564"
FT                   /product="peptidase M19 renal dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63297"
FT                   /db_xref="GOA:Q1GJ69"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ69"
FT                   /protein_id="ABF63297.1"
FT                   /translation="MPAFARWIKRLVGLAICAIMAFFIFAPAALDRQRNPVAEHDSYPI
FT                   SDAARDLHQSLIIGDLHADPLLWKRDLTKRNARGHVDIPRLIEGNVTLQVFTAVTKSPA
FT                   GQNYDHNDADARDNITLLAIGQLWPLPTWTSLYERALHQAEKLHRFQERSEGRLRIIRT
FT                   EADLDILLERKRAGHEVVGGLLGIEGAHPLEGDISKLQGLEEAGYRLIALQHFFDNALG
FT                   GSLHGAGDLGLSAFGRDVVSESVDRGLILDLAHSSPQVVRDVIAMTDVPLVLSHTGIHK
FT                   ACPVKRNLPDALMRDIAATGGVIGIGYWADAVCDASPSGIARAIHSAIEVVGENHVALG
FT                   SDFDGSVATTFDSSELAALTQAMLDEGLSETQIRKVAGENMLRVLRARLD"
FT   gene            602298..603287
FT                   /locus_tag="TM1040_0565"
FT   CDS_pept        602298..603287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0565"
FT                   /product="oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63298"
FT                   /db_xref="GOA:Q1GJ68"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ68"
FT                   /protein_id="ABF63298.1"
FT                   /translation="MTQPIRWGILGAAKFAREHMGPAIHAANGAELAALATSSADKAAP
FT                   FQSFAPGIAVHESYEALLADPLIDAVYIPLPNHLHVEWALKAMQAGKHVLVEKPATLRE
FT                   EEFDQLIAARDAAGVLAAEAYMIVHHPQWQRARELVHTGALGQVKHVSGKFSFDNRRDV
FT                   DNIRNRPETGGGALRDIGVYVLGSARFVTGEEPQDISAQIEWENGVDVLSNVQARFPSF
FT                   LYTAYVSTRLQPFQEMVFHGDKGVLRLTAPFNPRVFGEARLELHQASHAAGSGRVIEER
FT                   FPIADHYKLQVEAFGKSVRDGTPYACPLEFSRGTQRALDQIFACATTL"
FT   gene            603420..603689
FT                   /locus_tag="TM1040_0566"
FT   CDS_pept        603420..603689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0566"
FT                   /product="transcriptional regulators TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63299"
FT                   /db_xref="GOA:Q1GJ67"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ67"
FT                   /protein_id="ABF63299.1"
FT                   /translation="MAGGWAKDGAVSEQIEASISDELARMNARRAPAGESLTHCADCEE
FT                   EIPEARRLAIPGVKLCIDCQEERDGVQRQRGGINRRGSKDSQLK"
FT   gene            complement(603693..604196)
FT                   /locus_tag="TM1040_0567"
FT   CDS_pept        complement(603693..604196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0567"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63300"
FT                   /db_xref="GOA:Q1GJ66"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ66"
FT                   /protein_id="ABF63300.1"
FT                   /translation="MTSPRPQNTASPSLLPLSRSDHDLVRDIAVAPEQVVYCGTIAMAF
FT                   ASDEAGVDFYAIQQAGRFVGFFKIDVKYPRTYNFARQGDLGLRAFMIDHRVQGSGIGSG
FT                   ALRVLPSLLRRTYPKAQALVLTVNMRNHAALRTYLNCGFRDTGDIHDGGIAGPQHVMRL
FT                   PLFD"
FT   gene            complement(604197..605432)
FT                   /locus_tag="TM1040_0568"
FT   CDS_pept        complement(604197..605432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0568"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63301"
FT                   /db_xref="GOA:Q1GJ65"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ65"
FT                   /protein_id="ABF63301.1"
FT                   /translation="MAILTSSDSIDAILFPSTFISGGYIFPTPVYRYDVTDSYISYTLD
FT                   QTRGSTGYYNINPTVRIFGDNLSVDSSGRASGTITAMEFRSSNRGEIARIEQISINASD
FT                   FTDIIFARISGDNTSSTQFETLLAEALDVLEFGNRNQDISDRGMLQYLSFIDLQGGNDE
FT                   FHLARPKTDGTRTIDGGAGQDTLHLDDFGVPDSFVVNLKTGQIITDSTSVNITGFEIID
FT                   GNPFVDRYIGSNSGDHIRAAGRADQINGFGGRDTLSGGWGDDRITGGRGKDRLHGDEGN
FT                   DFLRGDAGADLLVGGAGRDRLVGRAGQDTLIADDGRDRLIGGAGSDLFVFNLSGSGSKI
FT                   RDFDISEGDHIRLDTDGSYAFDTDSLKLTRSGFRINTIDSDSNVETLRVVLNDDARHDL
FT                   SLDALWDVLTFG"
FT   gene            complement(605508..607328)
FT                   /locus_tag="TM1040_0569"
FT   CDS_pept        complement(605508..607328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0569"
FT                   /product="Peptidase M3B oligoendopeptidase-related clade 3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63302"
FT                   /db_xref="GOA:Q1GJ64"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ64"
FT                   /protein_id="ABF63302.1"
FT                   /translation="MFQLPFPVRDANASSGAGDLGKLPEWDLSDLYAGEDAAELSRDLD
FT                   WLQGECAAFAADYEGKLAELDAEGLLTCVHRNEKINNIAGRIMSYAGLRYYQLTTDADR
FT                   AKFLSDVQEKVTVFTTPLVFFTLEINRIEDAKLDALFEANADLARYKPVFDRIRAMKPY
FT                   QLSDELERFMHDLGIVGDAWEKLFDETIAGLTFEIEGEELGIEATLNFLTEQDRSKREA
FT                   AARELARVFADNIKIFARVHNTQAKEKEIIDRWRGMPSPQMGRHLSNDVEPEVVEALRE
FT                   AVVAAYPKLSHRYYELKRKWLGLDRMQVWDRNAPLPMETTRVVDWEEARATVMEAYEAF
FT                   DPRMGELAQPFFDKGWIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHE
FT                   LGHGVHQVLAADQGEMLSSTPLTLAETASVFGEMLTFRKMLEKAQTKEERKVLLAGKVE
FT                   DMINTVVRQIAFYDFECKLHAARAEGELTPEDINALWMSVQAESLGESFDFMEGYETFW
FT                   AYIPHFVHSPFYVYAYAFGDGLVNALYSVYAEGAEGFEDKYFDMLKAGGSKHHKELLAP
FT                   FGLDASDPKFWDKGLSMISGLIDELEAMEA"
FT   gene            complement(607521..608468)
FT                   /locus_tag="TM1040_0570"
FT   CDS_pept        complement(607521..608468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0570"
FT                   /product="alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63303"
FT                   /db_xref="GOA:Q1GJ63"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ63"
FT                   /protein_id="ABF63303.1"
FT                   /translation="MAETAPAPYFSEIARGPDQVEAHWLTTQDGQRIRAGLWRSHGPSA
FT                   GTILLFPGRTEYIEKYGPLAIDLTDRGFDVLTVDWRGQGLADRSLSDGRLGHVAEFGAF
FT                   QLDVAALVAHAEALNLPRPWYLLGHSMGGAIGLRALHEGLPVAACAFTAPMWAIRIPFA
FT                   LRPAARLLARFGTALGVSEKLVPTTTIEQYVQVTPFEGNTLTNDPEMYAFLQMQMTQHP
FT                   ELALGGPTVQWLSQAMLECADLRARPSPDVPCVTFLGENEQIVATEAIHDRMARWPSGK
FT                   LEMIPDAQHEILMEIPQTRRQTCAILTAHFKKHV"
FT   gene            complement(608489..608803)
FT                   /locus_tag="TM1040_0571"
FT   CDS_pept        complement(608489..608803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0571"
FT                   /product="Sterol-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63304"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ62"
FT                   /protein_id="ABF63304.1"
FT                   /translation="MKHHQGKTTMSDTLEQAAAKLNEKMDGGFDSSAKFEITGMGAIIL
FT                   DANGARVGDEDADVTMTADAETFEEILSGELNPTAAFMGGKLTIDGDMGVAMQLAQALA
FT                   "
FT   gene            608877..609461
FT                   /locus_tag="TM1040_0572"
FT   CDS_pept        608877..609461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0572"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63305"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ61"
FT                   /protein_id="ABF63305.1"
FT                   /translation="MGKTRTNLKAIVAAISLGVIPCLPSISMAQEDAHRIPQTEADLLE
FT                   RLRAADPADAARIARELQAEWSKSGSAAMDLLLRRGREAMARQDWQAAIEHFTALTDHA
FT                   PEFAEGWSERARAFFNAELFGPAVADLERALALNPNDFNAIFGLGQVFEFFGDPERAYA
FT                   AYERAEAIHPHHEEVTKALDRLSTKVEGQAL"
FT   gene            609547..612501
FT                   /locus_tag="TM1040_0573"
FT   CDS_pept        609547..612501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0573"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63306"
FT                   /db_xref="GOA:Q1GJ60"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ60"
FT                   /protein_id="ABF63306.1"
FT                   /translation="MTTASRVVAVLGPTNTGKTHYAIDRMLGYRTGVMGFPLRLLAREV
FT                   YDKIVKLRGPSVVALVTGEERIVPPRAQYWICTVEAMPEGMGCDFLAIDEIQLCADPER
FT                   GHVFTDRLLRSRGMKETLFLGADTMRGPIAALVPGVEFVRRERMSELVYAGSKKISRMP
FT                   PRTAIVGFSVDSVYAIAELIRRQKGGAAVVMGALSPRTRNAQVALYQNGEVDYLVATDA
FT                   IGMGLNLDVDHVAFSATSKFDGRRMRPLAPNELAQIAGRAGRGMSHGSFGVTGDARPLE
FT                   EGVAQAIMDHRFTPLQKLNWRSADLRFGSIDALIHSLEASPNHEVLLKAREADDLMVLK
FT                   SLAQDGAIRDRATDAASVRLLWDVCRIPDFRGISHAEHASLLSGIYGYLHQGGVVPDDW
FT                   FARQIRRIDRTEGDIDTLSKRLAFIRTWTYVAQRNGWLRDESHWREETRTVEDRLSDAL
FT                   HARLTQRFVDRRTSVLLRRLKQKEALLAEVNDKGEVTVEGEFVGKLEGFRFSPDKTAQG
FT                   AEAKALKSASLQALAPQYHLRADRFYNAPDTEIDFTDQGGLMWGEHAVGKLVAGADALS
FT                   PQIEVFVDETAGPDVAQKVERRLQHFISRKVQALFEPLIALQKDEALTGLARGFAFRMV
FT                   EALGILPRAGVAQEVKDLDQDARGALRKHGIRFGQFTIFMPALLKPAPTRLRLLLWSLA
FT                   NGLQEFPEAPPPGLVTVPSMPEAPEGYDTMAGYRAAGQRMIRIDMLERLADLLRNEDSR
FT                   GGFEAKPDMLSITGMTLEQFADLMQGLGYRAEKGERAKVKAVDAVVTEGGTPAADQPVM
FT                   DAAADAENTPAAAPAETTPDEAAADVLAGTSEIVDEGVAPVAAGPAESSADEPIAETAE
FT                   AETAVGAAADATVEEPEIEVFYTFTWGRNTRQGNAGRGQRRGEGRGPKADGAGRGKPRG
FT                   GKPQGKPGGKKGGRPDRGGDKGSKTYSARPPKKEKQIDPDNPFAAALMGLKQGD"
FT   gene            612509..612883
FT                   /locus_tag="TM1040_0574"
FT   CDS_pept        612509..612883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0574"
FT                   /product="RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63307"
FT                   /db_xref="GOA:Q1GJ59"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ59"
FT                   /protein_id="ABF63307.1"
FT                   /translation="MSDHADKMRVDKWLWHARFFKTRSLAAKQVGAGHVRVNGSKAAKP
FT                   SQNVSIGDVLTFPQGHQVRVVRITSLSERRGPATEAQTLYFDMTEKQDKPPANPKYEGK
FT                   GRPDKKERRALGLTRVWDGH"
FT   gene            612951..613289
FT                   /locus_tag="TM1040_0575"
FT   CDS_pept        612951..613289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0575"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63308"
FT                   /db_xref="GOA:Q1GJ58"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ58"
FT                   /protein_id="ABF63308.1"
FT                   /translation="MTYVVTDNCIACKYTDCVEVCPVDCFYEGENTLVIHPDECIDCGV
FT                   CEPECPADAIRPDTEPDMDQWVEFNRKYAELWPVIVSKKDPMPGHEERDGEEGKLEKYF
FT                   SEAPGEGG"
FT   gene            613567..614076
FT                   /locus_tag="TM1040_0576"
FT   CDS_pept        613567..614076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0576"
FT                   /product="transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63309"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ57"
FT                   /protein_id="ABF63309.1"
FT                   /translation="MTKSKKLEFRPNDFIVYPAHGVGQIISIEEQEVAGYKLELFVITF
FT                   EKDKMTLRVPTHKAIDIGMRSLSSPDVINQAMKTLKGKAKVKRAMWSRRAQEYEQKINS
FT                   GDLISIAEVVRDLHRTDDQREQSYSERQLYEAALERLTREVAAVSGGDEIAAAKQVDEV
FT                   LTSRAA"
FT   gene            complement(614143..614895)
FT                   /locus_tag="TM1040_0577"
FT   CDS_pept        complement(614143..614895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0577"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63310"
FT                   /db_xref="GOA:Q1GJ56"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ56"
FT                   /protein_id="ABF63310.1"
FT                   /translation="MRKNDFKPIDLLLALVLLTRLPLPHLSKEVFARQAAAVWAFPLVG
FT                   AVVGVVSIFAGAVALIWCPPFVAAGIALATQVLVSGAMHEDGLADMADGFWGGFDPKRR
FT                   LEIMKDSHIGTYGVLALLFGLGLRWSILAALFEAGDIWCLMALASLSRAAMPVMMASMP
FT                   NARGRGLSQSVGRPAWPATLVGLLIALVVGFLSTGGSVIWAALVLGPLLLGLRQLAMTK
FT                   IGGQTGDVLGATQQLSEIALGLTLLALL"
FT   gene            614997..616007
FT                   /locus_tag="TM1040_0578"
FT   CDS_pept        614997..616007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0578"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63311"
FT                   /db_xref="GOA:Q1GJ55"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJ55"
FT                   /protein_id="ABF63311.1"
FT                   /translation="MLPDLTTLSDFRNALAQAPGADADARAACEDRNGQLTKPPGALGQ
FT                   LEEIAIWYGSWRGTARPEVRAPQVIVFAGNHGVTARGVSAFPAEVTVQMVANFKAGGAA
FT                   INQLAQLADARMDVHALELDRPTADFTQGPAMSEEDLLAALRTGWNAVDPASDVLVVGE
FT                   MGIGNTTSAAAICHALYGGEPGDWTGRGTGVDDEGLALKTAVIAEAVALHGSRDGLEVL
FT                   RCLGGREIAAMAGAIAAARVLRIPVILDGFICCAAAASLARLHDQALDHAVAGHQSAEG
FT                   GHQALLARLGKAPLLSLGLRLGEGSGAALAIQVLKGALACHSGMATFAEAGVSDG"
FT   gene            complement(616034..617911)
FT                   /locus_tag="TM1040_0579"
FT   CDS_pept        complement(616034..617911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0579"
FT                   /product="Potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63312"
FT                   /db_xref="GOA:Q1GJ54"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ54"
FT                   /protein_id="ABF63312.1"
FT                   /translation="MDSFLSQASIYLAAAVIAVPIAARLGLGSVLGYLAAGIIIGPILG
FT                   LVGAEAEELQHFAEFGVVMMLFLIGLELDPRALWAMRHHLIGLGGLQITASTALLAGAA
FT                   IFFGHSWQVGLAVGLALSLSSTAIVLQTLSEKGLTRTGGGRATFSVLLTQDIAVIPILA
FT                   LLPLLATQHALSLSEDGSIVRAEEAHGAGHHSLSLVEGLPGWAVTLTTIGAIAFVILAG
FT                   VYLTRPVFRFIHASNLREMYTALALLIVVGISFLMTLVGLSPALGAFLAGVVLANSEFR
FT                   HELESDLEPFKGLLLGLFFITVGAGINYRLFLAEPGDVIGLALLVIFAKGAVLYFVGRA
FT                   FGLRGRNHWLFTLGLAQAGEFGFVLLAFSLQLNVVTADLSEKLLLVIALTMLITPLLFI
FT                   LYEILSKRMKDAQVEHTPDEIDEEGTVIIAGIGRFGQIVHRLVNASGFKTVLLDSDMKA
FT                   VQLMRRFGVKSFLGDPTRPELLKAAGISKAKVLVVALDDQESATKLVTYARRNYPDIHI
FT                   VARAYDRNHVFELYKAGANDIVREMFDSSLRAGRYVLENIGLSEYEAAQAEQTFYAHDR
FT                   HTIRELAGHWIPGTPASENPAYIKRARELEKDLETALLSLAEDHIKHRA"
FT   gene            complement(618069..619292)
FT                   /gene="aer"
FT                   /locus_tag="TM1040_0580"
FT   CDS_pept        complement(618069..619292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aer"
FT                   /locus_tag="TM1040_0580"
FT                   /product="Aerotaxis receptor"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63313"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ53"
FT                   /protein_id="ABF63313.1"
FT                   /translation="MSFVDRRIETRPSSGAAPFELNEVFFSRTDERGVILSCNYVFQRV
FT                   AHYEWEEIIGAPHKLVRHADTPKGLFYLFWEMLKSGKTVGAYVKNKSKDGLHYWVFATV
FT                   VPCGDGYLSARIKPSSKLFAEIQTLYAKIVKAEQEGDLSAEESAQIMLDWVHEKGFDDY
FT                   QHFASHALAEELISRDLGLGRKVDPQISELREMLRNAEKLLDETHGLVKDFEAMHTIPH
FT                   NLRVIASRIEPSGGPVTVLSQNYGAMSREMSDWFERNVMGENTNFATVKHSVNSSLFIA
FT                   GMTRILMECDTQLQKERRDLGDVDMEEERRRLADLVKQQAGHAQKGMAEVDIEAVRIIN
FT                   ACQVMHRHFLGLSSTRVLCKIESARLPSSGETLSDIIDQLGAFQERISERLEHIAKLGE
FT                   EIRSLEGE"
FT   gene            complement(619356..619811)
FT                   /locus_tag="TM1040_0581"
FT   CDS_pept        complement(619356..619811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0581"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63314"
FT                   /db_xref="GOA:Q1GJ52"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ52"
FT                   /protein_id="ABF63314.1"
FT                   /translation="MLDATDIKLLAQLQKNAQATAQELGDVLNLSASQAGRRRQRLEED
FT                   GFIQNYVARLDPSKLGLAVQCFVQVHLHSHGPDNAASFARLVSNRPEITSAWTMTGEAD
FT                   YLLRVYCHDLQELNTLLHEIILPHPAVGRVHSQIVMAQLKGDSPLPV"
FT   gene            619950..621050
FT                   /locus_tag="TM1040_0582"
FT   CDS_pept        619950..621050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0582"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63315"
FT                   /db_xref="GOA:Q1GJ51"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ51"
FT                   /protein_id="ABF63315.1"
FT                   /translation="MGPFPHDAPKSVISAENPAGTDGFEFVEFASPNPEELRELFAKMG
FT                   YELVGRHKTKPGIELWQQGDITYILNAEKGSFAEKFVELHGPCAPSMGWRVVDAQKAFE
FT                   HAVAKGAEPYEGDDKTMDVPAIKGIGGSLIYFIDQYYDTSPYNEEFEWLKQSKPRGVGF
FT                   YYLDHLTHNVFKGNMDKWFHFYGDLFNFKEIRFFDIQGKYTGLFSRALTSPCGRIRIPI
FT                   NEDRGETGQIVAYLKKYNGEGIQHIAVGARDIYDATDEISERGIQFMPAPPATYYDMSH
FT                   DRVQGHEEPLDRMKKHGILIDGEGVVDGGETRILLQIFSKTVIGPIFFEFIQRKGDDGF
FT                   GEGNFKALFESIEQEQINNGEISAAE"
FT   gene            complement(621175..623808)
FT                   /locus_tag="TM1040_0583"
FT   CDS_pept        complement(621175..623808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63316"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ50"
FT                   /protein_id="ABF63316.1"
FT                   /translation="MKPEFALSLSFDGITVLTRGAGGWYRLGSVSPDAKDLPEQLAKLR
FT                   AEALALSEAPLHAKLVLPDSQIRYLSLETGELSHDARISAARAALEGATPYKVDELAFD
FT                   ISVDGAITHVAAVALVTLDEAESFATEHGFAPVSFVAAPEDAAYLGEPFFGTARSARHL
FT                   TVEPDGIAVVEVPPPADPAVAKGDTAEEPDLYPESAADDDLAPRSDAPIILPAAPPVLD
FT                   ASPEEAAPSTDDSTDTKLADTEDETAAQSAESTSAEEPEDIGPAVGFSSRRSRAKLEVT
FT                   STKTTAPKAPSVTPKSAGTSEPAAPKAPSATTAKTGVALATSSVPAAPSLALPTPVLAH
FT                   TTSAPPKPSPSAIAQPVSGPAPEQLQTPQARPMRARSGRIGLLAAGLAAVSAIGAWAVV
FT                   QELPNLWSDLKRADLIETEDPVATPVLAAPDAALDANKELTTTAQGGLGLNLPSAPART
FT                   VATGAETGPAPGELAADTLTETDAAVLEALGAPVVDEAAPLDGQDLIIASLPAPQDITS
FT                   GTSETALAPIDDEAAVFDDSAEIDPEALADGVVPEDQPTDLLQEAPSELEQAAQYAATG
FT                   IWQQVPDIADVPALISLDNVYVASIDNTELSQDAIALPAPDAFETDTPFGAVSSPTEAG
FT                   RQFDFDDRGLVVASPDGTLNPDGIMIYAGRPVKVPPPTPDRPTERVLAAAEEAERLALL
FT                   QQVRPRTRPNDLVEQAERAQLGGVVRSELLSKRPKLRPDSLKTEAQESQPATALAVASA
FT                   PQPRARPTNFANIVDRAQRRQQQAPDQSSSATVASAAVTPAIPSSASVARQATTQRALN
FT                   LRRLNLIGVYGKPSDRRALVRLPSGRYVKVKVGDRIDGGRIVAIGDSQLQYQKGSRNTV
FT                   LNLPNG"
FT   gene            624063..624779
FT                   /locus_tag="TM1040_0584"
FT   CDS_pept        624063..624779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0584"
FT                   /product="protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63317"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ49"
FT                   /protein_id="ABF63317.1"
FT                   /translation="MLKSKTAALMLASAVALTPLSLGAEELRQIHVTGEATSEVTPDRA
FT                   HITLGVRVEAKDAGAAMEQVSQRMQEVTARLGDSGIAAQDMQTEQVSLHPVWNQVTRDG
FT                   DQMREVTGFEASNLLRVTLQDLDAMGGVLDDVLAAGANEFRGLTFTYSEREAAENLLRT
FT                   MAYENAYRKAQQLAEASGMALGPVRDIRDGGASGGAPMMAMEMARSSDMPISPGALSLR
FT                   HSVTVTFDISVPDGPN"
FT   gene            complement(624873..626165)
FT                   /locus_tag="TM1040_0585"
FT   CDS_pept        complement(624873..626165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0585"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63318"
FT                   /db_xref="GOA:Q1GJ48"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ48"
FT                   /protein_id="ABF63318.1"
FT                   /translation="MSDSPTYGFDTLQIHAGARPDPATGARQTPIYQSTAYVFRDADHA
FT                   AALFNLQEVGYIYSRLTNPTVAVLQERLATLEGGVGAVCCSSGHAAQIMALFPLMGPGK
FT                   NVVASTRLYGGTVTQFSQTIKRFGWSAKFVDFDDLDALREAIDDDTRAVFCESVANPGG
FT                   YVTDIRAVADVADAAGLPLIVDNTSATPYLCQPISQGATLVVHSTTKYLTGNGTVTGGC
FT                   IVDSGKFDWSASDKFPSLSAPEPAYHGLKFHETFGNLAFTFHGIAIGLRDLGMTMNPQA
FT                   AHYTLMGIETLSLRMQRHVENAVKVATWLENDPRVDYVTYAGLPSSPYAERAQRCYPKG
FT                   TGGLFTVAIKGGYDACVKLVDSLEIFSHVANLGDTRSLIIHSASTTHRQLTPEQQEAAG
FT                   AGPNVVRVSIGIEDADDLIRDLDQALAKACG"
FT   gene            complement(626316..627305)
FT                   /locus_tag="TM1040_0586"
FT   CDS_pept        complement(626316..627305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ47"
FT                   /protein_id="ABF63319.1"
FT                   /translation="MPRQVFNILIVGQSGRLMFEALLFAASLRQKSPAFEGRLIVATPE
FT                   PGSLWTSNPTIRNGGVLEALARLEAEVIPFESRHFGQAYPYGNKIEALSVLPEGEPFVF
FT                   FDTDTLLTGEIDAVPFDFDRPSASLRREGTWPKPTLYGPGYTEIWRSLYARFGLDFESS
FT                   LDLSQPDEHWRRYLYFNAGYFYGACPHRFGTRFLEYALSIRDDLPPALIGQSLDPWLDQ
FT                   IALPLVIHSFGGARDSLPQGHLDGSKSCHYRSFPLLYARERDKVIATLEEVCAPNWLKK
FT                   VLKGYEPIKRMVYQGRGQRVRALFDQHNLPRKEQAIRNRIKSAGLWMR"
FT   gene            complement(627404..628279)
FT                   /locus_tag="TM1040_0587"
FT   CDS_pept        complement(627404..628279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63320"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ46"
FT                   /protein_id="ABF63320.1"
FT                   /translation="MQIIIHAGAHGTEEDRLMKTLLRNKEDLLARGTAVPGPAKYRTLL
FT                   KDCMSAAQQGDPAPGARDFLWDAILEEETAERVILSNPHFFGSQRDALEGQRLYPEAEQ
FT                   RLLALQALFPEDELHLYMAIRSPVSFLSKLLEKAGAGRRHAVLNETNPLDLRWSAMAAR
FT                   IRTAVPDIPITLWCYEDSPFLWAQIMREMGHLKPDSKVKGGMDLLASIMTREGMRLLRQ
FT                   YLHDRPEMTEVYKRKVFAAFLDKFALDEELEEELDIPDWSPEFIERIDQAYDADVAQLQ
FT                   AIPGVTLLSP"
FT   gene            complement(628389..628832)
FT                   /locus_tag="TM1040_0588"
FT   CDS_pept        complement(628389..628832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0588"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63321"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ45"
FT                   /protein_id="ABF63321.1"
FT                   /translation="MLDNFPRGTICIEDIEMGMTRYLRKQVTDRDIEMFAEVSTDRNPV
FT                   HLDEDYAQDTMFHGRIAHGMLTAGLISAVIGEQLPGHGTIYMSQNLKFLAPVRPGDLVH
FT                   AEVEVTDIQIDKRRVKLDCRCIVDGKKVLVGEAMVMAPSRKFD"
FT   gene            complement(629035..629910)
FT                   /locus_tag="TM1040_0589"
FT   CDS_pept        complement(629035..629910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0589"
FT                   /product="HAD-superfamily subfamily IIA hydrolase
FT                   hypothetical 3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63322"
FT                   /db_xref="GOA:Q1GJ44"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ44"
FT                   /protein_id="ABF63322.1"
FT                   /translation="MSQIISALSEVSDRYKALFVDLWGCVHNGITAYPDAVAALQAYRK
FT                   SGGVVVLVTNSPKPRAGVAEQLSQFGVPDDAYDTIATSGDSARAAMFTGAVGEKVYFMG
FT                   EWERDAGFFEPMKVIHEPIEITRVPLKEAEGIVCCGPFDTLADPEVNRADFLYAKQMGM
FT                   KLLCANPDIIVDRGEVREWCAGALAKLYTEMGGESLYFGKPHPPIYDLARRRLTEIGHD
FT                   VSDRDILAIGDGPHTDISGGMGEGVDTLFITGGLAAKDTQTAHQPEPAALEAYLAQEQI
FT                   APTYSIGFLR"
FT   gene            complement(630062..632194)
FT                   /locus_tag="TM1040_0590"
FT   CDS_pept        complement(630062..632194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0590"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63323"
FT                   /db_xref="GOA:Q1GJ43"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ43"
FT                   /protein_id="ABF63323.1"
FT                   /translation="MRYERTPHLIPTLQQALERRGYTSLTPVQEAVSNPELAGADLLVS
FT                   AQTGSGKTVGFGLAIAPTILGEDGTFERAASPLALVIAPTRELALQVKRELSWLYGDAG
FT                   AVLASCVGGMDMRDERRALERGAHIVVATPGRLRDHITRGSIDLSGVAAVVLDEADEML
FT                   DLGFREDLEFILEETPEDRQTLLFSATVSKPIAALAQTYQNDAQRISTINKSEQHSDIS
FT                   YLAHVVAPHDIENAIINVLRFHEAPNAIVFANTRAAVNRLLTRLSNRGFQVVALSGELS
FT                   QSERAGALQAMRDGRARICVATDVAARGIDLPNLDLVVHADLPSSHETLLHRSGRTGRA
FT                   GRKGASALMVTPRSVRKAERLLREAKLSAEWIDAPSADEVRGRDLERMLSDTVWTEEAP
FT                   ESQQETLAKLVESFSPEQLAAGYLRLWSAARSAPEELTDVAAMDTRKKKEDRAPFGPSV
FT                   WFAIDGGRDAGADPRRLLPMLCKAGGIDKTAIGAIRIVGDKSYAEIAEDKVEGFMATLG
FT                   GEMALDDGSALERLSEAPNLPERSKPPFRKGGGGGRGGFGGGKPGGYKGERKGGGDFKG
FT                   DRKPYRDRDGDADRTVKPRAAKPRPHGDKPAFDKPRGDRSEKGKFDKPRSDKPRGDKPW
FT                   GDKPRGDKPRGDKPHRDKPHGDKPRGDKPKFDKPRASKPKGPPPPKGKPNSKKNKARRS
FT                   DASNTSKRFTPPGRKA"
FT   gene            632483..633289
FT                   /locus_tag="TM1040_0591"
FT   CDS_pept        632483..633289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0591"
FT                   /product="Putative metalloprotease yggG"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63324"
FT                   /db_xref="GOA:Q1GJ42"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ42"
FT                   /protein_id="ABF63324.1"
FT                   /translation="MMLQYFSRLSRPLLMTAGLLTLLSCGTTYELPDTGGVHSDAAARL
FT                   YAEARQSPPPKTLSPTAAQARFARVEPRIMRAGRETCLQLQTGVNCNVDIAIDREMKER
FT                   NAYFTYQDGQPIIRISLPLIQDTGSDDEVAFVLAHEYGHLIGRHVEKQQQQVLAGALIG
FT                   GALAGIVGDSSDAIGLGMGVGASAGGIVYSQSYELESDTLGTRIAYAAGYDPVEGARFF
FT                   ARSEAARGASGGYSIWGTHPPDRRRVATVLATKAQIEGQVGLKAAN"
FT   gene            complement(633408..634328)
FT                   /locus_tag="TM1040_0592"
FT   CDS_pept        complement(633408..634328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0592"
FT                   /product="Inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63325"
FT                   /db_xref="GOA:Q1GJ41"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ41"
FT                   /protein_id="ABF63325.1"
FT                   /translation="MTIQVFGHKSPDTDSTGSAIVWAWYLNEVKGEAATPVLLGEPNTE
FT                   AAFMLKRWGFEQPAIIADVEADAPVVIVDTNNPAELPASINSADIRAIIDHHKLVGGLE
FT                   TKGPIDITVRPLACTATIMYDLMGEDAARMPENIKGAALTCILSDTLEFRSPTTTDHDR
FT                   AVAEKLAADLGLNITDYAAEMFAAKSDVSAFSDAELIRMDSKEYEVDGTKFRVSVLETT
FT                   APEIPLGRKDSLMETFNTVQTEDGVDQVLLFVVDILKEEATLLVPNDLVKTVAEKSFGA
FT                   SVDGDLVVLPGVMSRKKQIIPNLKV"
FT   gene            complement(634464..635525)
FT                   /locus_tag="TM1040_0593"
FT   CDS_pept        complement(634464..635525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0593"
FT                   /product="GumN"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63326"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ40"
FT                   /protein_id="ABF63326.1"
FT                   /translation="MKYLRGRATLIERCGKALLELRARAFTVLIAAVLMASLTQAAAAR
FT                   CDGIDLRQHLTESARHKLDDALAKVPFAVGNHWVAIKGDQRIDVIGTQHSGDARMFPIM
FT                   RRLRPVIEQADAIFLEVTEPQMRAADTAQDSFARYFLLPPGQRLDQMIPEAEWRLLMAR
FT                   LAPFGISSDAAARMQPWYLSDFLTGTDCRKRGLGSRRGLDDRIEHVARTAGIPTFGLES
FT                   PEAGLAALASMPLSDQVRMLRFDLRSETRHQDLYVTLSDSFFEGRLTEGRILLLWMMYR
FT                   DLDVPRQEVHRLLASFDRVVLERRNRTWVKRLLARKEPRLVVAVGAAHLAGDTGVLNLL
FT                   HRAGYALSPVDDR"
FT   gene            complement(635522..636592)
FT                   /locus_tag="TM1040_0594"
FT   CDS_pept        complement(635522..636592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0594"
FT                   /product="GumN"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63327"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ39"
FT                   /protein_id="ABF63327.1"
FT                   /translation="MLSRAQRSGDRRHALGHSGAVPATLRPFLSLICFCLVAVWMATPL
FT                   RAACSGLDLRESAAPGMWAEIEAEIALTPFARGLSWVATRGDRRLHIIGTMHLNDPRHD
FT                   ALVAHMAPAIQAADAVLLEVNRADKARLERTLAETPSLIFITEGPTLIDRLPPEEWDEI
FT                   AERAGAAGIPPFMAAKMRPWFLSLSMSVPLCARAIEDVTDGLDMKLMTLAERAGVETLS
FT                   LEDPLGLFQLFDATPIEEQIKELRSYIAMAGVGADDFYTMVESYFDGEVQAYVLLQLKQ
FT                   FLTSESDLSVAERQAQVDDLLEALLYQRNRDWIPVIEATAGNRLVIAVGAAHLPGEAGV
FT                   LALLEAEGYQIEEALR"
FT   gene            636662..637360
FT                   /locus_tag="TM1040_0595"
FT   CDS_pept        636662..637360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63328"
FT                   /db_xref="InterPro:IPR018679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ38"
FT                   /protein_id="ABF63328.1"
FT                   /translation="MAGMEREQDLYAPVKALLEAQGYAVKGEIGAADVVALRGEEPPVI
FT                   VELKLRFSLALFHQAIERLKVSDTVYVAVARPTGKTARRALKDNLALCRRLGLGLITVR
FT                   ADGRTEVHCDPGPYAPRKSPSKSVRLLREFSRINGDPNAGGAIRGGLMTGYRQDALACV
FT                   SYLQEHGPARGADIAKAKGVSRATHVLYTNHYGWFERVTKGVYGLTDKGRVEPLDWFAS
FT                   AAVSATPRPK"
FT   gene            637635..637922
FT                   /locus_tag="TM1040_0596"
FT   CDS_pept        637635..637922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0596"
FT                   /product="chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63329"
FT                   /db_xref="GOA:Q1GJ37"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJ37"
FT                   /protein_id="ABF63329.1"
FT                   /translation="MALKPLHDRVLVRRTESEEKTAGGLIIPDSAKEKPSEGVVVACGE
FT                   GARKDSGELIAMAVKEGDNILFGKWSGTEVTVDGEELLMMKESDIMGVIV"
FT   gene            637983..639626
FT                   /locus_tag="TM1040_0597"
FT   CDS_pept        637983..639626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0597"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63330"
FT                   /db_xref="GOA:Q1GJ36"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GJ36"
FT                   /protein_id="ABF63330.1"
FT                   /translation="MAAKDVKFDTDARNRMLKGVNTLADAVKVTLGPKGRNVVLEKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQSIVREGL
FT                   KQVAAGLNPMDLKRGIDLATDKVVEAIKAMAREVKDSDEVAQVGTISANGEAEIGRQIA
FT                   DAMQKVGNDGVITVEENKGLETETDVVEGMQFDRGYLSPYFVTNADKMTAELEDCLILL
FT                   HEKKLSSLQPMVPLLEQVIQSQKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLQDIAILTGGQVISEDLGMKLESVTMDMLGTAKKIQITKDETTIVDGAGEKA
FT                   EIEARVAQIRAQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDA
FT                   LNATRAAVQEGVIVGGGVALVQAGKSLEGLTGVNADQNAGIAIVRRALEAPLRQIAENA
FT                   GVDGAVVAGKIRESEDKNFGFNAQTEEYGDMFSFGVIDPAKVTRTALEDAASIAGLLIT
FT                   TEAMVADKPAKEGAAPAGGMPDMGGMGGMM"
FT   gene            639694..639996
FT                   /locus_tag="TM1040_0598"
FT   CDS_pept        639694..639996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63331"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ35"
FT                   /protein_id="ABF63331.1"
FT                   /translation="MLPDLCSVFFGGRSAASPQKKRGRGRVSNVTAHCVRTISRFWKFV
FT                   TLCYDTLRVQPQTDGGTMMNIVIKLRSGVVWTDQGRGSRAYGSPQTGHMAGTCWS"
FT   gene            640194..640463
FT                   /locus_tag="TM1040_0599"
FT   CDS_pept        640194..640463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ34"
FT                   /protein_id="ABF63332.1"
FT                   /translation="MGNTKMLDHPALPHMAPKPMLARLVVEDHFRGLSLMRRLALAVRL
FT                   VLIARPARAGVIDMPLSAHLRADVGLPARTDRVEPPEWYPPPLY"
FT   gene            640633..641526
FT                   /locus_tag="TM1040_0600"
FT   CDS_pept        640633..641526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0600"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63333"
FT                   /db_xref="GOA:Q1GJ33"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ33"
FT                   /protein_id="ABF63333.1"
FT                   /translation="MRLIALTTLVMIAFAANSILGRWAIGPGHMDATGFGLLRLASGAA
FT                   MLWALCALQGRRPREAWRRSLAGGASLTLYMVGFSMAYVALDAGLGALILFGVVQISMF
FT                   GWSLLSRQPVSMLQIAGASIALAGLAYVVWPSAEIEAPLWAVLLMGAGGLGWGIYSLVG
FT                   RAAQVPLAASAVNFLLATGLILPFVWLAGGGTVISVFGCVLAVVSGAVTSGLGYALWYR
FT                   VLPQLSAPVAATVQLSVPVIAILFGALILGEPVGARLMLGTFVVLGGIGLVILCPRPQP
FT                   RPRKDAQGLSGSPPNA"
FT   gene            641536..642342
FT                   /locus_tag="TM1040_0601"
FT   CDS_pept        641536..642342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0601"
FT                   /product="lipase putative"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63334"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ32"
FT                   /protein_id="ABF63334.1"
FT                   /translation="MIRYILAAALLSFAFEAGAQEGASSPASPEAPVTQPTKGCVILLH
FT                   GLARTETSFLLMEEALVARDYEVVRPGYPSTEHTVERLADAVLPRAFDACTQTPVHLVT
FT                   HSMGGILVRYWLSHTRPVTLGRVVMLAPPNQGSELVDEMGDWAVFDLLHGPAGQELGTG
FT                   PNSLPKRLPAVDYPVGIVAGSQSLNPVFSALLPGPDDGKVSVASTAVEGMKTQIILPVT
FT                   HTYLMNNPRVIAQVVQFLETERFEPSLGWLDGVLGRDWDGGLNGVD"
FT   gene            642346..643503
FT                   /locus_tag="TM1040_0602"
FT   CDS_pept        642346..643503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0602"
FT                   /product="Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63335"
FT                   /db_xref="GOA:Q1GJ31"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ31"
FT                   /protein_id="ABF63335.1"
FT                   /translation="MSEDGYVTLRLVGADVLRADGLERSGALTLADGLLQDASGAREVD
FT                   LNGYRLLPGIVDLHGDGFERHVAPRRGAMKQMGEGIRATEAELAANGITTGVLAQFLSW
FT                   EGGLRGAEFAHQVFEGIREVRSQLVTDLIPQLRFEIHLLDLYDTLPAQIADWEVPYVVF
FT                   NDHLPHDRLAQGKKPPRLTGQALKAGRNPEKHFEMLLEMHARRDEVGPALDRLCNLLRQ
FT                   NGICFGSHDDHSAQDREIWRARGAHISEFPETAEAAEAARSAGDHIILGSPNVVRGGSH
FT                   KGNASAVELISMGLCDALASDYHYPSPRRAALMLAKTGLLPLEQAWALVSSGPAKILGL
FT                   HDRGVLTDGKRADLVILDENNQVAATLSGGRVSYMSGAIAARFLS"
FT   gene            complement(643704..644801)
FT                   /locus_tag="TM1040_0603"
FT   CDS_pept        complement(643704..644801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0603"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63336"
FT                   /db_xref="GOA:Q1GJ30"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ30"
FT                   /protein_id="ABF63336.1"
FT                   /translation="MTDLDQILEPGAVIGILGGGQLGRMLSVAASRLGFTTHIYEPAAN
FT                   PPAGHVADRVTTAAYEDEAALRAFAQTVDVITYEFENIPTSALDILEDLKPIRPGREAL
FT                   RVSQDRLTEKTFLQELGLATAPFAEVDDAASLEVALEKVGTPSILKTRRFGYDGKGQMR
FT                   IMHPEEAPEALAAMQGAPAVLEGFVPFSHEVSVIAARSLNGKVACYDPGENVHLEGILS
FT                   TTTVPANLTTGQSMDAVLMAGKILNALDYVGVLAVEIFVTAHGLVVNEIAPRVHNSGHW
FT                   TQEGCTIDQFEQHIRAITGWTIGNGARYADVVMENLIGEDVGRIADLARDPDCAIHLYG
FT                   KAETKPGRKMGHVNRVIHTEGREGY"
FT   gene            complement(644794..645282)
FT                   /locus_tag="TM1040_0604"
FT   CDS_pept        complement(644794..645282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0604"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63337"
FT                   /db_xref="GOA:Q1GJ29"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ29"
FT                   /protein_id="ABF63337.1"
FT                   /translation="MADIKVGIIMGSQSDWPTMKEAANILDELGVAYETRIVSAHRTPD
FT                   RLWDYGKTAAERGLHVIIAGAGGAAHLPGMMASKTRVPVVGVPVQTRALSGVDSLYSIV
FT                   QMPKGFPVATMAIGAAGAANAGLMAAGILATSDAALAERLDAWRDALAASIPEEPTDD"
FT   gene            645532..646422
FT                   /locus_tag="TM1040_0605"
FT   CDS_pept        645532..646422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0605"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63338"
FT                   /db_xref="GOA:Q1GJ28"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ28"
FT                   /protein_id="ABF63338.1"
FT                   /translation="MQDFQFDWVDAFTDRPFGGNGCAVVHGGAHLPEAVACAYVRETSL
FT                   VECTFTGPSEVADIKVRYFLASREIPFAGHPTIATVAAMRDRGLISGQRITLETGAGIV
FT                   PVDLEDDLIVMQQVAPQFGVTPDRALVAAAISLPETAILGQPQLVSTGLPFCITVLKDL
FT                   DSLRAARLDAVAMEPLGRALGADGSDVMEPFLVTLDGFTPTGDTFSRLLMLPPSPPEDP
FT                   FTGSATGAMAAYLWHHGLMDKAVFVAEQGHLMDRPGEAHVALVGDRSAPKGIRVGGRGF
FT                   VLMRGEVGLPTSLQT"
FT   gene            646512..646958
FT                   /locus_tag="TM1040_0606"
FT   CDS_pept        646512..646958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0606"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63339"
FT                   /db_xref="GOA:Q1GJ27"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ27"
FT                   /protein_id="ABF63339.1"
FT                   /translation="MFLSIADLTGRYWEQEMIEGSCCCGNVQFALSAPPSMMGTCHCTR
FT                   CRKLGANVMVFIRRDTLIWRRGRENVAVYQPEAPYKYPRCFCKTCGTSLGEILSTEESF
FT                   PISAQVLDGDLEIRNRFHEFVAEKPSWYEICDSAEQFEGHPVTS"
FT   gene            complement(646940..647470)
FT                   /locus_tag="TM1040_0607"
FT   CDS_pept        complement(646940..647470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63340"
FT                   /db_xref="GOA:Q1GJ26"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ26"
FT                   /protein_id="ABF63340.1"
FT                   /translation="MATKDTFERTEAMMGMTPEIWARHANPWSGWTRLTILPLFALAVW
FT                   SRVWLGWGALVPVVLVLIWTWLNPRIFPRPKRTDNWMSRGVQGEQIWLRHKTAPELSHH
FT                   LAVVRQITLLSAAGALAYLVGLILLWPGLTLTGLCIASLGKLWMLDRMVWVLADVQHSG
FT                   TLAHDDADQDVTG"
FT   gene            complement(647574..649058)
FT                   /locus_tag="TM1040_0608"
FT   CDS_pept        complement(647574..649058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0608"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63341"
FT                   /db_xref="GOA:Q1GJ25"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ25"
FT                   /protein_id="ABF63341.1"
FT                   /translation="MSQNDLEPRHLETLDRDLDRLSSLEQATAYVGRSNVGLGLAFMFI
FT                   LIVAAATGLMLGSADNTFIIVIAAAFGAYMALNIGANDVANNMGPAVGANAMSMGFAIV
FT                   VAAIFESAGALIAGGDVVSTIAKGIISPDTMATSSMFIAAMLAALLASALWVNLATWIG
FT                   APVSTTHAVVGGVMGAGIAAAGFAAVNWSKMSAIAASWVISPLLGGLIAAGFLWLIKSR
FT                   IIYREDKISAARTWVPILVGIMAGAFASYLAVKGLKKLIKIDLSHSLMIGLVVALLVWM
FT                   LMIPVIRKQSKGLENRNKSLKVLFSIPLIVSAALLSFAHGANDVANAVGPLAAIVQAST
FT                   SGDFTHAVSIPFWVMIIGAFGISFGLFLFGPKLIRMVGSQITKLNPMRAYCVALSAAIT
FT                   VIVASWLGLPVSSTHIAIGGVFGVGFFREWDTERRMRKSKAVKADAPNVGPEERRRRKL
FT                   VRRSHFLTIIAAWVITVPAAATLSGVLFVLINRMVG"
FT   gene            complement(649309..649533)
FT                   /locus_tag="TM1040_0609"
FT   CDS_pept        complement(649309..649533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63342"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ24"
FT                   /protein_id="ABF63342.1"
FT                   /translation="MQTPVEMAQAGGRTVYVKTVAVADLPKDVQASVPGRTQLYAVHDE
FT                   AGEQLALVADRKMAFVLARQHDYAPVAVH"
FT   gene            complement(649537..649950)
FT                   /locus_tag="TM1040_0610"
FT   CDS_pept        complement(649537..649950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0610"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63343"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ23"
FT                   /protein_id="ABF63343.1"
FT                   /translation="MSKLTLGSYPHMLGFEQLERLLERSAKSGNEGYPPYNIEQTSDHS
FT                   YRITLAVAGFAEEDLAITVEDRQLVIRGRQRDDSDGRIFLHRGIAARQFQRMFVLADGV
FT                   EVGEAVMENGLLHVDLTRSRPETVVQTINIKKG"
FT   gene            650146..650370
FT                   /locus_tag="TM1040_0611"
FT   CDS_pept        650146..650370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0611"
FT                   /product="protein of unknown function DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63344"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ22"
FT                   /protein_id="ABF63344.1"
FT                   /translation="MNKRSDLAMANEDVLRVELEVFRREHRDLDEAIEALEEKGTADAL
FT                   TIRRLKKQKLVLKDKIALIEDRLLPDIIA"
FT   gene            complement(650528..652246)
FT                   /locus_tag="TM1040_0612"
FT   CDS_pept        complement(650528..652246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0612"
FT                   /product="adenylylsulfate kinase / sulfate
FT                   adenylyltransferase"
FT                   /EC_number="2.7.1.25"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63345"
FT                   /db_xref="GOA:Q1GJ21"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ21"
FT                   /protein_id="ABF63345.1"
FT                   /translation="MPMSSNLAPIPELYVSYDSAQKLKVEAADLTSHDLTPRQICDLEL
FT                   LMNGGFNPLKGFLSEEDYNGVVENMRLADGQLWPMPITLDVTEDFAASIEIGQDIALRD
FT                   QEGVILATMTVTDRWEPNKSREAEKVFGADDEAHPAVNYLHNTAGKIYLGGPVTGIQQP
FT                   VHYDFRARRDTPNELRAYFRKLGWRKVVAFQTRNPLHRAHQELTFRAAREAQANLLIHP
FT                   VVGMTKPGDVDHFTRVRCYEAVLDKYPAATTSMSLLNLAMRMAGPREAVWHGIIRKNHG
FT                   CTHFIVGRDHAGPGKNSAGEDFYGPYDAQDLFRAHQEEIGIEMVDFKHMVYVQERAQYE
FT                   PADEIADKDDVTILNISGTELRRRLAEGLEIPEWFSFPEVVAELRKTKPPRAQQGFTVF
FT                   FTGFSGSGKSTIANALMVKLMEMGGRPVTLLDGDIVRKNLSSELGFSKEHRDLNIKRIG
FT                   YVASEITKNGGIAICAPIAPYAATRRHVREEIEQFGAFVEVHVATTIEECERRDRKGLY
FT                   KLAREGKIKEFTGISDPYDVPQNPELRVETENVEVDNCAHQVLLKLESMGLINGN"
FT   gene            complement(652460..654220)
FT                   /locus_tag="TM1040_0613"
FT   CDS_pept        complement(652460..654220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0613"
FT                   /product="adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63346"
FT                   /db_xref="GOA:Q1GJ20"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ20"
FT                   /protein_id="ABF63346.1"
FT                   /translation="MFPQGVTEATCAPPLQCKKDSSLLAQALWQGNWIHRSRLVSGLVL
FT                   FTFAFFHFLNVAAGLVSPALMEAMQEVREPFSKSPPGQVLLYGSLLVHAGLALWQVAMR
FT                   RTLRMSFVQGLQLLLGVLIPLQLFQHIAHTNYAARVQGYEDEMSSVVVMLWSGPEALHQ
FT                   YLLLLAVWIHGCVGLHMWLRLTRWWGTLTPYMIGLAVLIPALALAGLVTEGRRMWAFFS
FT                   NPEVAQQIIEDYNWPDAAGFAHLAMVSDYSISIFFGCLVLALGTYGVRRLIRRRRSVRI
FT                   TYERGPEVTADRGLTVLEISQMNGIAHPSLCGGKGRCTTCRVAILAGGDDLPPPTAAEA
FT                   RSLRAINAPENMRLACQITPTSALTVKRLYMAKGRHQVHATQGEEKTIAVLFLDIRGFT
FT                   ARSEGLLPYDVVFLLNRFFDAIVPQITRAGGAVDKYMGDGLLALFETSDATSSAQAALT
FT                   AAADIGSALERFNRLLVAEGEQPLRIGMGVHTGTVVLGEIGAAGHAPRTLIGATVNAAS
FT                   RLEAKTKELGVEILISRAVFDTATLPQAETRFQTFELRGVDAPVAALPLEHASRLSDLL
FT                   ADTPSENALR"
FT   gene            complement(654406..655347)
FT                   /locus_tag="TM1040_0614"
FT   CDS_pept        complement(654406..655347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0614"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63347"
FT                   /db_xref="GOA:Q1GJ19"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ19"
FT                   /protein_id="ABF63347.1"
FT                   /translation="MSDTRHTKVLIIGSGPAGYTAAVYASRAMLEPILVQGIEPGGQLT
FT                   TTTEVENWPGHTEIQGPDLMVNMESHARAMGTEIIGDIITSLDTSSRPFVAKGDSGTTY
FT                   TADAVILATGARAKWLGLPSEEKFKGFGVSACATCDGFFYRGQEIVVIGGGNTAVEEAL
FT                   FLTNFASKVTLIHRRDELRAEKILIDRLMKNEKIEPLWFHELDEVVGTDAPLGVEAVRV
FT                   KHTKTGEITEIPAKGVFVAIGHAPATELVKDVLETHNGGYVKVKPGTTETSIPGIFAAG
FT                   DLTDHKYRQAVTSAGMGCMAALDAERFLAEQE"
FT   gene            655592..656092
FT                   /locus_tag="TM1040_0615"
FT   CDS_pept        655592..656092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0615"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63348"
FT                   /db_xref="GOA:Q1GJ18"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ18"
FT                   /protein_id="ABF63348.1"
FT                   /translation="MVTTRLDPIDRKILSELQADGRMTNVELAKRVGISAPPCLRRVRA
FT                   LEEAGLIRGYHAEVNDRELGFEVQVFAMVGLESQAEAELSAFEEKCRSWPLVRECHMLN
FT                   GEVDFILKCVAPDLSTFQSFLTSDLLTTPNVASVKTSLVIRGAKDEPGVPFDVLEERLA
FT                   REA"
FT   gene            complement(656123..656890)
FT                   /locus_tag="TM1040_0616"
FT   CDS_pept        complement(656123..656890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63349"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ17"
FT                   /protein_id="ABF63349.1"
FT                   /translation="MTIPQSLERAAANLAKTKPLVRHQKALPDGSKPQLRRYEVASLLP
FT                   NGNPTETRHIAPALPLFEQAFTAFTRGSLIETDYGPVAIEDLYPGDRVLTRDGSYQTLI
FT                   WKGMTTMVPGHQAATGGPLSMTSFMADSFGMEKPMSCVVTGPAARLLRTPMHLRHAEGD
FT                   SPLLTPVTEFIDGMNIVETTPPTPIDMYHLCLAKHAVIKVGGLEFETYHPGPEALRLVS
FT                   YPIKTLFLNMFPHADKISDFGPLAFDRARTTQA"
FT   gene            657064..657369
FT                   /locus_tag="TM1040_0617"
FT   CDS_pept        657064..657369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ16"
FT                   /protein_id="ABF63350.1"
FT                   /translation="MKPVRRCHRHAGFTDIVCLKRAKSHQADLATGASASEASLRRAII
FT                   SLRSVPRVQGILTSCDEEAEMMDFTNRDCAGILLLLSTSKGGRILSLKSFSTNIAV"
FT   gene            complement(657574..658341)
FT                   /locus_tag="TM1040_0618"
FT   CDS_pept        complement(657574..658341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0618"
FT                   /product="protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63351"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ15"
FT                   /protein_id="ABF63351.1"
FT                   /translation="MTLESVTSDLLSPVVHGFFTRKGGASSGVFQGLNCGVGSSDQREA
FT                   VMLNRARVAEAMEAPTEALLGMHQVHSADVAVIDALPKDPNAPRPKADALVTATPGLVL
FT                   SVLTADCQPVLFADPEAAVIGAAHAGWRGTLDGVLEATIATMVSLGATRENISAVIGPT
FT                   ISQRAYEVGPEFFEAFMTEDEGNARFFAQGEGDRFLFDLPGLGLAKLRAAGVKDSAWTR
FT                   HCTYGDPARFFSYRRATHEKDADYGRLISCIRL"
FT   gene            complement(658338..659411)
FT                   /locus_tag="TM1040_0619"
FT   CDS_pept        complement(658338..659411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0619"
FT                   /product="protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63352"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ14"
FT                   /protein_id="ABF63352.1"
FT                   /translation="MSLMQSLRRRIELDGPMTVADYMSECLLHPDYGYYTTAPAIGAEG
FT                   DFITAPEISQMFGELLGLVLVQSWLDQGRPQPFTLAELGPGRGTLMADMLRATRAVPGF
FT                   HEAMELLLIEASPRLRDLQRQALAPYAPRWVPSVEDLPQHPLFLVANEFFDALPIRQFQ
FT                   REGNQWRERRVGLAEDASGLTLGLGAPAPQPALAHRLEDTKDGDLVEHCEVAAVVTEAI
FT                   AQRIGDHGGVALLVDYGDWRSLGDTLQALRAHAPTDPLAEPGQADLTAHVDFEAICTAA
FT                   SATGCAHTRLTPQGVFLERLGITDRANALASGAAGEPLAQIIAAHRRLTHPEEMGNLFK
FT                   VLGLYPAKFAPPAGLEK"
FT   gene            complement(659408..660316)
FT                   /locus_tag="TM1040_0620"
FT   CDS_pept        complement(659408..660316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0620"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63353"
FT                   /db_xref="GOA:Q1GJ13"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ13"
FT                   /protein_id="ABF63353.1"
FT                   /translation="MLAEMIQFPNLSPEIFSVTLFGTEFALRWYALAYIVGILIAWFLA
FT                   VRAVKRPALWANEAPPMTPRQVEDLMTWIILGVILGGRIGYVLFYQPSVYLQNPAQILR
FT                   IWEGGMAFHGGLLGVVLASWFYARAHNINKLQIADLVAHAVAPGLLLGRLANFVNAELW
FT                   GRATDLPWGVAFPGSAAQKCGQALGEICARHPSQLYEAAMEGLILGALILWMVYRRQAF
FT                   QAPGRILGVFLAGYGIARFIVEFFRQPDAQFISEGNPLGLAWHIGGFGLTQGQALSIPM
FT                   ILIGLWFVLRAGKTDLHEVRA"
FT   gene            660413..660676
FT                   /locus_tag="TM1040_0621"
FT   CDS_pept        660413..660676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0621"
FT                   /product="protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63354"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ12"
FT                   /protein_id="ABF63354.1"
FT                   /translation="MNREMAMQTRNKIMDDISQLMTNAMGVAQGAKDEAETAMKSMIDR
FT                   WLADRDFVTREEFDAVRAMAQKAREENEALKARLDALETKAD"
FT   gene            661243..661743
FT                   /locus_tag="TM1040_0622"
FT   CDS_pept        661243..661743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63355"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ11"
FT                   /protein_id="ABF63355.1"
FT                   /translation="MALSEHELQDDLHPIDIVENLASHHDWDFDRIADDQIAMAVEGQW
FT                   RTYSLTLAWSDYDETLRLVCSFEMEPPEAKIPQLYELINHMNDQCWAGAFSYWPEHKLM
FT                   LYRYGLVLSGGQMATPEQVDAIVQAAVSNSERYYPAIQLMVWGERPAKEAMQVAIAEAY
FT                   GRA"
FT   gene            661804..662619
FT                   /locus_tag="TM1040_0623"
FT   CDS_pept        661804..662619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0623"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63356"
FT                   /db_xref="GOA:Q1GJ10"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ10"
FT                   /protein_id="ABF63356.1"
FT                   /translation="MDMNEIAARGLVLLGCGKMGSAMLKGWLEGGLPREAVYVMDPNPS
FT                   DWLKGTGVHINATVPEQPAIVLVAVKPQVMGAALPSAKSYGGGGTLFISVAAGTPISTF
FT                   ETMLGESTPIVRAMPNTPAAVGRGITALIGNAHVDEAKMAQADALLQAVGQTVRLDDEG
FT                   QMDAVTGVSGSGPAYVFHLIETLAAAGVAQGLPEPLAMQLAKATVAGAGALAEAAEEDP
FT                   SALRVNVTSPNGTTQAALEVLMDEETGFPPLLQRAVAAAAKRSEELSRG"
FT   gene            662612..662962
FT                   /locus_tag="TM1040_0624"
FT   CDS_pept        662612..662962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0624"
FT                   /product="Secretion chaperone CsaA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63357"
FT                   /db_xref="GOA:Q1GJ09"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ09"
FT                   /protein_id="ABF63357.1"
FT                   /translation="MADISFDDFLKVDVRVGTVVRAEPYPEARRPAIKMWIDFGDEIGE
FT                   RKSSAQVTAHYAPESLIGKQVMAVVNFPPRQIGKFMSEVLVLGLPDENGEIVLIGPDGD
FT                   VSAQVPRGGRMH"
FT   gene            662962..663930
FT                   /locus_tag="TM1040_0625"
FT   CDS_pept        662962..663930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0625"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63358"
FT                   /db_xref="GOA:Q1GJ08"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ08"
FT                   /protein_id="ABF63358.1"
FT                   /translation="MAASERRRLLITRPMTAAVEARARAELDVEIRQETTPLSPEEMRQ
FT                   SLGAFDLVMPTLGDAYSADVFAAVPQPRCRLLANFGVGFNHIDAEAARAAGVEVTNTPG
FT                   AVTDATADIALTLMLMTARRAGEGERLVRSGQWQGWHPTQMLGLHLSGKRLGVVGLGRI
FT                   GDAIARRAHFGFGMEISYLARSDKETGYPATRASNLIELAASVDMLVVAVPGGAETRHL
FT                   INADVLAALPSHAHLVNIARGEVVDEAALITALQAGQIAGAGLDVYEFEPKVPAELRAM
FT                   EQVTLLPHLGTATEEVRSAMGHMALDNCVAFLTGAPLPNPV"
FT   gene            complement(664038..664640)
FT                   /locus_tag="TM1040_0626"
FT   CDS_pept        complement(664038..664640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0626"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63359"
FT                   /db_xref="GOA:Q1GJ07"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ07"
FT                   /protein_id="ABF63359.1"
FT                   /translation="MAKLYFNYSTMNAGKSTVLLQASHNYRENNMQTYLLTARIDDRAG
FT                   TGRIASRIGISAEADMFAPEDDLFGKIETRLKDGPVAAIFVDEAQFLTHEQVWQLARVV
FT                   DDLGVPVLAFGLRVDFQGNLFPGSASLLALADEMREVRTICHCGKKATMVVRQDATGQV
FT                   LTEGDQVQIGGNESYISLCRRHWRAAMGDLPTAKTLG"
FT   gene            665179..665640
FT                   /locus_tag="TM1040_0627"
FT   CDS_pept        665179..665640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63360"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ06"
FT                   /protein_id="ABF63360.1"
FT                   /translation="MADIGTYLKKHTEALVKDVGIEAACQITGKSKATLGRYYSENAEH
FT                   ADRFIPVDAVAKLEGAASFPHVTSALADLKNITLSYSSGTEASVSRPGGVNTDVIALSR
FT                   RFAQLMSEYQDAIADGIITVNEAKRLLKETVLLQQVLLDMKLHLEEESG"
FT   gene            complement(665754..666878)
FT                   /locus_tag="TM1040_0628"
FT   CDS_pept        complement(665754..666878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0628"
FT                   /product="3-oxoacyl-(acyl-carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63361"
FT                   /db_xref="GOA:Q1GJ05"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ05"
FT                   /protein_id="ABF63361.1"
FT                   /translation="MYTAAITGTGVYTPSERITNAELVKAFNAYVDLQNEKHADEIASG
FT                   AREPLQYSSEEFILKASGIESRFVMDKSGVLDPEVMHPLLRQRSDDEPGIMAEMAVDAA
FT                   RQALAQAGKSAEDVDLVICAASNMERAYPAVAIEIQQLLGIRGFAFDMNVACSSATFGI
FT                   QTAADMIRSGSIRAALVVNPEICSGHLEWRDRDCHFIFGDVATATLIERSEDATSAHFE
FT                   ILSTRCATEFSNNIRNNNGYLRRSRPDGVADRRDMQFMQNGRKVFKEVLPMVSQHITDH
FT                   MTAEGVGAADLKRLWLHQANKTMNDFIGKKVLGRTPEAGEQPNILQDYANTSSAGSIIA
FT                   FSKFSDDLEAGDTGLICSFGAGYSVGSVLVRRHG"
FT   gene            667095..667577
FT                   /locus_tag="TM1040_0629"
FT   CDS_pept        667095..667577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0629"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63362"
FT                   /db_xref="GOA:Q1GJ04"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ04"
FT                   /protein_id="ABF63362.1"
FT                   /translation="MTVDHSDIWKLYTPEVQAMMGVFALHWQLEQRLNDVCHEGQLGRS
FT                   EHQLLLILAQPRRMGELARLTHKTPSAMTAAAAVLEQSNLIRRVRDPGDGRAWLLELTE
FT                   EGRRRRAQLVDAASGIFYETSGLTREEAEILARLAQKIHNKAVQSGAVAPCEGDQT"
FT   gene            667574..668647
FT                   /locus_tag="TM1040_0630"
FT   CDS_pept        667574..668647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0630"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63363"
FT                   /db_xref="GOA:Q1GJ03"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ03"
FT                   /protein_id="ABF63363.1"
FT                   /translation="MKMTSIRAVMLGAILATPMAAGVAAQAQDATPEQVLLKPVKLMTA
FT                   NGGSAPLERSFFGQVAAKETVDLAFQVGGQVLKLPITEGDEIPKGGLIAQLDLETFQLQ
FT                   LEQAVLNKQQADRTKERNARLAGTVSQVAIEDAETAAGLAEVALRTAQTNLDHATLYAP
FT                   FDALVARREVAQFSTVSAGTPIARLHDMSELHVEIDVPELLFQKANESDAFEIVASFPG
FT                   SSKEYPLQIVEYVAEASAVGQTYRVTLSMEPPEDRHILPGASTTVSVRVSTGLHRIALP
FT                   VTAIVTTPEGKTGVMVFTPTGADAGSVTWTEVEIAPNQFGTFDVLSGVEDGDEVVLTGG
FT                   AALKDGQAVRRFVGFSN"
FT   gene            668659..671709
FT                   /locus_tag="TM1040_0631"
FT   CDS_pept        668659..671709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0631"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63364"
FT                   /db_xref="GOA:Q1GJ02"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ02"
FT                   /protein_id="ABF63364.1"
FT                   /translation="MDIARGSIQRPLYTWLIMLFALFGGIWGFLSLGRLEDPAFTIKQA
FT                   VIQTTYAGASAEQVALEVSEPLESAIQKMEEVKEITSMNRPGVSIIEVEMRDTYDGSEL
FT                   PQIWTKLRAKVRDAARGLPDGVSEPLVNDSFGDVFGIFYAVTAEGFSDREKYELSTFLR
FT                   RELLTVDGVADVDISGLRKETIYVEPDMPIATNLGVSVNAIANAVATSNSVTPAGEIKA
FT                   GPMNTILQTPEGSDSVSEIAGLTVGVGGETINIIDIANVWRGREIDPSLMIRFDGVEAF
FT                   TLGVSGIANENIVDVGHRVDAKLAELDSDIPFGVELHPIYQQHIVVEQASNDFLVNLAM
FT                   SVAIVIVVLALFMGWRAAIVVGTTLLLTVVGTLFFMALFSIEMERISLGALIIAMGMLV
FT                   DNAIVVAEGMQISMQKGRSSREAAQEAASKTQIPLLGATVIGIMAFAGIGLSPDATGEF
FT                   MFSLFAVIGISLLLSWILALTVTPLLGHYFFKRGSGDDQDSYNGLLFRSYGALLRGALK
FT                   ARWLVVVGLIGVTVMCFMGFGLIKQQFFPNSNTPLFYVHYKLPQGTAIEATSAHMAEME
FT                   SWLAARDEVVSTATFVGQGATRFLLTYAGQKANPSYGHLIIRTENLEQIPGLQADLEAW
FT                   GKAHFPEGEFRTERLVFGPGGGAPVEVRFSGPDPAVLRRLANEAKELLETESDLTRDVR
FT                   HNWREQELVLKPVYATDRAQTAGVTREAISSALQFSTNGVTTGVFRERERLIPIVMRQP
FT                   QEDPYNVMNQVVFSETSGSWIPLEQMIDGISYEVQNTLVHRRDRVYTITVGADVLPDVT
FT                   AATAFGEVQAAIEAIEVPVGYKMEWGGEHENSSEANASLGKQLPLSLLIMVLISVLLFN
FT                   AIRQPIIIWLLVPMSVNGVVIGLLGTGLPFTFTALLGLLSLSGMLIKNGIVLVEEIDIV
FT                   RREEGLPLRESIVKASVSRLRPVMLAAITTILGMAPLMSDAFFVSMAVTIMGGLAFATV
FT                   LTLVAAPVFYLIFFKGVERQEQKAAAA"
FT   gene            complement(672273..675635)
FT                   /locus_tag="TM1040_0632"
FT   CDS_pept        complement(672273..675635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0632"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63365"
FT                   /db_xref="GOA:Q1GJ01"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ01"
FT                   /protein_id="ABF63365.1"
FT                   /translation="MPKRTDIKSIMIIGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPGLADATYIEPITPEVVAKIIEKERPDALLPTMGGQTGLNTSLALEE
FT                   MGVLEKFNVEMIGAKREAIEMAEDRKLFREAMDRLGLENPRATIVTAPKKDNGNADLEA
FT                   GVALALEALEDIGLPAIIRPAFTLGGTGGGVAYNREDYIHYCRSGMDASPVNQILVDES
FT                   LLGWKEYEMEVVRDKADNAIIVCSIENVDPMGVHTGDSITVAPALTLTDKEYQMMRTAS
FT                   IAVLREIGVETGGSNVQWAVNPADGRMVVIEMNPRVSRSSALASKATGFPIAKIAAKLA
FT                   VGYTLDELDNDITKVTPASFEPTIDYVVTKIPKFAFEKFPGSEPYLTTAMKSVGEAMAI
FT                   GRTIHESMQKALASMESGLTGFDEVEIPGVQAGLWESVGADDKAAVIKAISQQTPDRLR
FT                   TIAQAMRHGLSDDEIQGVTKFDPWFLARIREIIDAEREIRKNGLPMREDKLRALKMLGF
FT                   SDARLGLLTGRDEDNVRRARHNLGVKAVFKRIDTCAAEFEAQTPYMYSTYESPMMGEVE
FT                   CEARPSDRKKVVILGGGPNRIGQGIEFDYCCCHACFALTDAGYETIMVNCNPETVSTDY
FT                   DTSDRLYFEPLTMEHVMEILRVEQENGTLHGVIVQFGGQTPLKLANALEAEGIPILGTT
FT                   PDAIDLAEDRERFQALVNELGLKQPKNGIASTGEQALKIAEEIGFPLVIRPSYVLGGRA
FT                   MEIVRDMDQLKRYINEAVVVSGDSPVLLDSYLSGAVELDVDAICDGKDVHVAGIMQHIE
FT                   EAGVHSGDSACSLPPYSLDKEVIERIKEQSFALAKALNVVGLMNVQFAIKDNEIYLIEV
FT                   NPRASRTVPFVAKATDSAIASIAARVMAGEPLSNFPQRAPYEPDAGYDVNTPMADPMTL
FT                   ADPDMPWFSVKEAVLPFARFPGVDTILGPEMRSTGEVMGWDRSFARAFLKAQMGAGMVL
FT                   PSKGRAFISIKDEDKTEVMLDTARILIAQGFDLVATRGTQGWLAGHGVECAVVNKVYEG
FT                   RPHVVDMLKDGEIQLVLNTTEGNQAVEDSKPMRSVALYDKIPYFTTAAGAHAAARAIQA
FT                   QAEGEVEVKSLQG"
FT   gene            675784..676980
FT                   /locus_tag="TM1040_0633"
FT   CDS_pept        675784..676980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0633"
FT                   /product="aminodeoxychorismate synthase, subunit I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63366"
FT                   /db_xref="GOA:Q1GJ00"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GJ00"
FT                   /protein_id="ABF63366.1"
FT                   /translation="MASKPLYAGQGRHSLLTETLPVEIRFDNGPSKGAALFEDPVDLIR
FT                   AQDPDEVQGALAALDRARAEGHWVAGYASYELGYALEPRLAHLLNGRGHRRLPLLQFGV
FT                   FRAPVAADVPLWAGDAGVGETTARWDAARYTEAFDRVKSYIGAGDIYQANLTFPIDAQV
FT                   WGGAEALYAALAARQPVGHGALVRQDGLPTILSRSPELFFRTSSDGVIETRPMKGTQPR
FT                   SLDPREDSRRRDFLRSDEKNRAENLMIVDLLRNDISRVSETGSVHVPELFAVESYATVH
FT                   QMVSLVRARLKAGCGLADIFAALYPCGSITGAPKIRAMEILAELEPGARDIYCGTIGWA
FT                   APDGRSEFNVSIRTMMLEGDAATFNVGGGLVWDSTSASEYEEALWKARFAQVTTPISA"
FT   gene            676977..677582
FT                   /locus_tag="TM1040_0634"
FT   CDS_pept        676977..677582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0634"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63367"
FT                   /db_xref="GOA:Q1GIZ9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ9"
FT                   /protein_id="ABF63367.1"
FT                   /translation="MIETFGFAPGQGVARLDLHLARLTRSAEAFGIPFRRAKALAMVED
FT                   LAATTPLRCRMTLAADGFLALTTAEMPAAANLWRVGIAQERLASDEPLLRHKTTRREIY
FT                   DRARARLPAGIDEVIFFNERDEICEGTITNLVLTREDGTRLTPPVSSGCLPGVYRQSLL
FT                   DAGSLKEAVLTMADLQRAAALHLTNALRGEIPATLFEI"
FT   gene            677748..679532
FT                   /locus_tag="TM1040_0635"
FT   CDS_pept        677748..679532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0635"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63368"
FT                   /db_xref="GOA:Q1GIZ8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GIZ8"
FT                   /protein_id="ABF63368.1"
FT                   /translation="MHAFRSHTCAELNKSHVGETVRLSGWVHRVRDHGGLLFIDLRDHY
FT                   GVTQVMADPDSPVFAEIEKVRSEWCIRIDGEVKARDESLVNAKIPTGEIEVFIRDIEVL
FT                   GKSEELPLMVFGEQEYPEETRLRYRYLDLRREKMQRNMVLRSNMIRSIRNRMWDQGFNE
FT                   YQTPIITASSPEGARDFLVPSRLHPGKFYALPQAPQQFKQLMMVSGFDKYFQIAPCFRD
FT                   EDPRADRSPTDFYQLDMEMSFVTQQDVFDTIAPVIAGVFEEFGQGRKVDAPNEWPQISY
FT                   KDAALWYGSDKPDLRNPIKMQVVSEHFRGSGFAIFAKLLEQEGTEIRAIPAPTGGSRKF
FT                   CDRMNAFAQKEGLPGMGYIFWREGADGMEAAGPLAKNIGPERTEAIRQQLGLGVGDAAF
FT                   FLGGKPKTFEAVAGRARNVIGEELNLTDKDRFAFAWIVDFPIYEKDEETGKIDFEHNPF
FT                   SMPQGGMDALNGDPLDVRGNQYDLACNGYELVSGAIRNHKPEIMFKAFEIAGYGKEEVE
FT                   KRFGGMVNAFQYGAPPHGGCAAGIDRMVMLLADEANIREVIMFPMNQRAEDLMMAAPSE
FT                   PMSEQLMELGLRVIPQDD"
FT   gene            complement(680127..680846)
FT                   /locus_tag="TM1040_0636"
FT   CDS_pept        complement(680127..680846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0636"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63369"
FT                   /db_xref="GOA:Q1GIZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ7"
FT                   /protein_id="ABF63369.1"
FT                   /translation="MDDSDLFSSAARLGSGRRPLLGLTILVVEDSRYACEAMRLLCLRS
FT                   GARIRRADSLKSARRHLQVYRPSVVIIDLGLPDGSGAELIEALSTASPRVAVILGISGD
FT                   ENAEAAAMAAGADGFLPKPIVSLAAFQNAILSNMPPERQPIGPRPMTDESVEPDMLAFR
FT                   DDMAHAAEVLDEGKDEQTLDYLAQFLGGVARSVGDAPLETAATRLQETRKSGGPLAVET
FT                   AMIADLVQERLQRKIAI"
FT   gene            681032..681436
FT                   /locus_tag="TM1040_0637"
FT   CDS_pept        681032..681436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0637"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63370"
FT                   /db_xref="GOA:Q1GIZ6"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ6"
FT                   /protein_id="ABF63370.1"
FT                   /translation="MIGRLNHVAIAVPDLEAAMAQYRDTLGANVGAPQDEPDHGVTVVF
FT                   IELPNTKIELLYPLGEGSPIQGFLEKNPAGGIHHICYEVDDILAARDRLKAQGARVLGT
FT                   GEPKIGAHGKPVLFLHPKDFNGCLVELEEV"
FT   gene            681506..681781
FT                   /locus_tag="TM1040_0638"
FT   CDS_pept        681506..681781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63371"
FT                   /db_xref="GOA:Q1GIZ5"
FT                   /db_xref="InterPro:IPR009935"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ5"
FT                   /protein_id="ABF63371.1"
FT                   /translation="MGITSGLVLYAVIWFMTFLVVIPIRLETQGDTGKIVPGTHAGAPE
FT                   RHYLKQKAWITTGAAAVIWAIVAGIILSGMITVNDFDWFDRLPDRP"
FT   gene            complement(681912..682865)
FT                   /locus_tag="TM1040_0639"
FT   CDS_pept        complement(681912..682865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0639"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63372"
FT                   /db_xref="GOA:Q1GIZ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ4"
FT                   /protein_id="ABF63372.1"
FT                   /translation="MPRIDISQISGRVLRVFLTVYDEKSVSRAADVLESSQSTISHNIE
FT                   KLRGLLGDALFVQSGRGIVPSARADVLAPKVRRILIEMEGLADQGIYDPITDPDPFVIA
FT                   LSSSILDGELETIYDALRLSLPQKHLMFRDLGKLSEIEPLLETRQADVVLTLRPRSYPN
FT                   TLRHMALTQDSFRVFYDPNVRGPVDSVEDFCGAPHATVSFGQGSKSLLQTELEALAIHR
FT                   RVTLGVPNLWTLIRLMQGTDMIASLPSRSSRHTTGTLASSPFPVELPPLQFDLVWHRRF
FT                   ADSARLQWLLMTIETALAQQAQDHPNDVGLRAHSFE"
FT   gene            complement(683422..683763)
FT                   /locus_tag="TM1040_0640"
FT   CDS_pept        complement(683422..683763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0640"
FT                   /product="protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63373"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ3"
FT                   /protein_id="ABF63373.1"
FT                   /translation="MTKITIQKATGRWVVRSGGAILGETENALELIEGDLAPVIYFPRE
FT                   DIAMAFLDKTDKTSHCPHKGDATYYSIVNRSSTDENAVWSYENPIDAVSEIKGHLAFMP
FT                   LASVKVEQL"
FT   gene            complement(683825..685609)
FT                   /locus_tag="TM1040_0641"
FT   CDS_pept        complement(683825..685609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0641"
FT                   /product="peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63374"
FT                   /db_xref="GOA:Q1GIZ2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ2"
FT                   /protein_id="ABF63374.1"
FT                   /translation="MFQNFDVTARPEQGPARLAALRAEMERDKIDGFLVPRADAHQGEY
FT                   VAPRDERLAWLTGFTGSAGFCAVLPHIAGVFIDGRYRTQVKGQVADVYTPVPWPDVTLG
FT                   DWLVEQLPEGGIVAYDPWLHSLQEIRDLTERLVSSDISLVESDNLVDRIWPDQPAPPMQ
FT                   PARAHSEDYAGESAEKKAQRLAEGLRKSGQSAAVITLPDSIMWLLNIRGSDIPRNPVAH
FT                   AFAILHDDARVDLFMAAEKLSELVLGAHVTLHAPDRFLEATAGLNGQVAVDARSLPQAV
FT                   ARVLGDRLAAVGDPCALPKARKNAAEIAGSAAAHLRDGAAVVETLAWLDTQEPGTITEI
FT                   DVVKTLEGFRAADPALRDISFETIAGTGANGAIMHYRVTHDTNATLQEGHLLVLDSGGQ
FT                   YLDGTTDITRTIAIGSPGREEAEAFTRVLQGMIAVSRLRWPEGRSGRELEAIGRLPLWM
FT                   AGQDFNHGLGHGVGAFLSVHEGPQGLSRINTVPLEPGMILSNEPGYYREGAFGIRIENL
FT                   VVVEEAPALDTADPDRKMLAWRTLTFAPIDRRLVVPEMLSSGEREWLNSYHAEVNRTIA
FT                   PRVSAAAAEWLNAACAPL"
FT   gene            complement(686000..687877)
FT                   /locus_tag="TM1040_0642"
FT   CDS_pept        complement(686000..687877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0642"
FT                   /product="Cobalt chelatase CobT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63375"
FT                   /db_xref="GOA:Q1GIZ1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ1"
FT                   /protein_id="ABF63375.1"
FT                   /translation="MSKPNDNPADPFKKALAEATKVMADDTELTVNYSVDPAGMSGDTM
FT                   RLPQVSRRMTREEVLLARGTADALALRRRYHDESVASRYAPSGDMARELYDAMESARCE
FT                   AMGARDMPGTASNIDVKIQNEALRRGYDQVTSASEAPLAVSAGYLIRHLATGRPMPEAA
FT                   ANVMELWRGFIEAQAGETLENLDETLSDQAAFAKFARRVISDLGYGDQLGDDPDDLDDE
FT                   MNDESEETAEEEEQPDSSGQDDSDEEEADASPEQAQEQQQDESQAQVSADDMAEEEVTD
FT                   ETEMPDGEAPLEPPAPQPVSDADPDYRVFLDAHDEEIAAEDLAEPQELERLRAYLDQQL
FT                   EPLKGAVSRLANKLQRRLQAQQNRSWEFDKEEGVLDAGRLARVVANPTTPLSFKVEKDM
FT                   EFRDTVVTLLLDNSGSMRGRPISIAAICADVLARTLERCNVKVEILGFTTRAWKGGLSR
FT                   EAWLNEGRPQLPGRLNDLRHIIYKGADAPWRRVRPNLGLMMKEGLLKENIDGEALEWAH
FT                   RRMVNRPEARKILMVISDGAPVDDSTLSVNPANYLEKHLRDVIAMVEKKKQVELLAIGI
FT                   GHDVTRYYDRAVTITDVEQLAGAMTEQLAALFDSDPRARARVMGMRRTG"
FT   gene            complement(688037..689023)
FT                   /locus_tag="TM1040_0643"
FT   CDS_pept        complement(688037..689023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0643"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63376"
FT                   /db_xref="GOA:Q1GIZ0"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIZ0"
FT                   /protein_id="ABF63376.1"
FT                   /translation="MTDGLLDMNAKPTETISVREVFGIDTDMTVKGFAEGTDRVPALDP
FT                   TYKFDPDTTMAILAGFSHNRRVMIQGYHGTGKSTHIEQVAARLNWPSVRVNLDSHISRI
FT                   DLIGKDAIKLRDGKQVTEFHEGILPWALRNPVAIVFDEYDAGRADVMFVIQRVLEHDGK
FT                   LTLLDQNEIITPNPFFRLFATANTVGLGDTTGLYHGTQQINQAQMDRWSLVATLNYLSH
FT                   DAETAIVLSKTPHYNTEKGRKQIAQMVTVADLTRTAFMNGDLSTVMSPRTVINWAQNAE
FT                   IFRDIGYAFRLSFLNKCDELERQTVAEFYQRCFDEELPESAANVSLG"
FT   gene            complement(689252..689851)
FT                   /locus_tag="TM1040_0644"
FT   CDS_pept        complement(689252..689851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0644"
FT                   /product="CzcN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63377"
FT                   /db_xref="GOA:Q1GIY9"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY9"
FT                   /protein_id="ABF63377.1"
FT                   /translation="MFDYLQTTHDLALMVALLAAILLATHLSLSLKCPSLGLWPAADGW
FT                   RHHLAFGLFRVFCGATVVFALTEIGVNGWGHWLRYAVGLPLMVMAFGITLWGYRFLGLD
FT                   NTYCDTGGLVTGGMYEYSRNPQYVTSVLATVGLGITTGSWTTVALALVLFALYFLFVLN
FT                   EERWLLKGYGKAFADYMRSTPRFLDERSLERLRAAL"
FT   gene            complement(690169..690795)
FT                   /locus_tag="TM1040_0645"
FT   CDS_pept        complement(690169..690795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0645"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63378"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY8"
FT                   /protein_id="ABF63378.1"
FT                   /translation="MTKSDPFGFDMSIRSAKKKNPRGRRSMSGASETSVRVCDHEGCGE
FT                   PGKFRAPKAPDVLDDFFWFCQQHVREYNQKWNFFEGTTEAEMNAQASKDKVWERTTKPL
FT                   GDPEARAWARLGIEDPHQVLGNNATRNPGKNGQTAGRRLPPTERRAIEILEAKDDWTKA
FT                   EIRKAYKKLIKVLHPDMNGGDRSQEEQLQEVMWAWDQVKDSRSFK"
FT   gene            690913..691167
FT                   /locus_tag="TM1040_0646"
FT   CDS_pept        690913..691167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0646"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63379"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY7"
FT                   /protein_id="ABF63379.1"
FT                   /translation="MSVRDEIENTLREAFDPSRLEVVDDSDSHVGHAGHDGKGESHFNV
FT                   LIRAEAFLGMTRVAQHRAVHKALGDIVPRIHALALDIGS"
FT   gene            complement(691219..691788)
FT                   /locus_tag="TM1040_0647"
FT   CDS_pept        complement(691219..691788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY6"
FT                   /protein_id="ABF63380.1"
FT                   /translation="MQHYEYKVVPAPNKGKKARGVKTPEARFAHGIEGVLNEMAQQGWE
FT                   FQRAEMLPSEERSGLTGSKTTWRNLLVFRRALGNTGLTEPTPATAAEPAPAVDSAPEVA
FT                   APEEAGKVDLPDDAPRVSTPDAQHAPEPAPLTAIAGDPEAPPEAIPVPGPGARRMVADD
FT                   GVEELSPVSGLTAALKARASRGKTDD"
FT   gene            complement(691865..693112)
FT                   /locus_tag="TM1040_0648"
FT   CDS_pept        complement(691865..693112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0648"
FT                   /product="peptidase T. Metallo peptidase. MEROPS family
FT                   M20B"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63381"
FT                   /db_xref="GOA:Q1GIY5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY5"
FT                   /protein_id="ABF63381.1"
FT                   /translation="MTDSFDNTLQSRLVRYAAIDSQSDENSPTAPSTKIQFDMLHLVRD
FT                   ELTEIGAQDVQLTDYGVVLATIPGRSEAPTVGFLAHVDTAPQFNATGVKPRVIKGYNGG
FT                   EISFPDDPELVLSPEAHPYLAEKIGHDLITASGTTLLGADDKAGVAIIMTMAEHLLQNP
FT                   DAARPTIRIAFTPDEEIGRGVQPQLERDLGADFAYTLDGGELGEVEYESFSADRAVVKI
FT                   TGVSIHPGLAKEKMVNAIHLASKIIQTLPQATMTPETTADREGFIHATDMFGGSSEMEI
FT                   RFILRDFEMADLEAKGALLRSVCEAVAATEPRAEITCEITPQYRNMRYWLEKDMTPVDL
FT                   AHAACRDVGLEPVSVPIRGGTDGSRLTEFGTPTPNIFTGMQCIHGPLEWISVQDMSLAT
FT                   QMCLSLAARAATLDKT"
FT   gene            complement(693219..694622)
FT                   /locus_tag="TM1040_0649"
FT   CDS_pept        complement(693219..694622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63382"
FT                   /db_xref="GOA:Q1GIY4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GIY4"
FT                   /protein_id="ABF63382.1"
FT                   /translation="MTSNPPDLRPDLAPKPTFGTAPRPDQPTLGMVSLGCPKALVDSER
FT                   ILTRLRAEGYGISADYAGADAVIVNTCGFLDSAKAESLEAIGEALKENGKVIVTGCLGA
FT                   EPDYIREHHPRILAVTGPHQYEQVLDAVHAAVPPSPDPFVDLLPATGVSLTPRHFSYLK
FT                   ISEGCNHKCKFCIIPDMRGKLASRPAHAVLREAEKLVTAGVRELLVISQDTSAYGLDRK
FT                   YDVNPWKDGEVRSHITDLSRALGELAPADQLWVRLHYVYPYPHVRELIPLMADPENAVL
FT                   PYLDIPFQHAHPDVLRRMARPAAAAKTLDEIRAWRAICPDITLRSTFIVGYPGETEAEF
FT                   QHLLDWMDEAQLDRVGCFKYENVDGARSNDLPDHVAEEVKQNRWERFMEKAQAISEAKL
FT                   ASKVGQTLQVIVDEIDEDGIATCRTKADAPEIDGNLFIDEGTANLSVGDLVTVEVDEAG
FT                   EYDLWGALR"
FT   gene            694800..696089
FT                   /locus_tag="TM1040_0650"
FT   CDS_pept        694800..696089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63383"
FT                   /db_xref="GOA:Q1GIY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY3"
FT                   /protein_id="ABF63383.1"
FT                   /translation="MTDAPEIPEGLRPANENPWYILMTLYGEQEGEEIDVELHKKNRRA
FT                   WNAWVGQALSAEERVAAAKSSQIKVTELEAWDELGEKIKARFFEESNRRNVDTEGMLVF
FT                   PEPAKPIWMGNTVFSENLVFENMVIASKVNFGSANFMRNARFGFVTFAGVAVFGSAKFE
FT                   QEAWFHFANFQKAALFGRARFKDFVYFFRARFGGCSGVRCLPSFAYCQFERPTIFSRAL
FT                   FCDGYPDFSGAVLHDKTSFTARMDPTSDEVAQDKDLEGRTFWPQRTKQDPVSARESCAT
FT                   IRHLLTQQGLPEEAHFFFRREMRFASQIGSFWQRLPYRSFGWLSDFGYSIQRPLWWLAG
FT                   ICFLGMAAFWTVFSFPGGPPVLSESDLGTAAALSFSNLFPLFGFGRVFLSEVLASLPRW
FT                   AQVLSGAQTVLSLPLLFFLGLALRQRFRLR"
FT   gene            696203..698143
FT                   /locus_tag="TM1040_0651"
FT   CDS_pept        696203..698143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0651"
FT                   /product="AsmA"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63384"
FT                   /db_xref="GOA:Q1GIY2"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY2"
FT                   /protein_id="ABF63384.1"
FT                   /translation="MRLILRILSAIVITIAVGVAILTFLPGQKIAELAAQQIEKQTGRQ
FT                   VVFGGDVRFSFWPTLGIQADDVALANADWAGPEPLLTAGRLTIGVDAADLIRGDIRITE
FT                   LTAIVPHLNLETREDGIGNWVFDAPAVGETPAQVETDAEGEGTSVAIEAITLRGASLRY
FT                   AAHGQDVVETNQVDLQLAWPDPNGTANVDLTLRPAGKPLRIAGEVGSFRRFLLGEVASL
FT                   GVTVTAEASKLRFDGQADLSGAFDGRITGASDDTSALLVALGQAAVDLPKGLGRAMTFA
FT                   ADTTYTPDGRVSLRDLSLALDHNALRGDADLNLAASPLKVTAALEGDMLDLSALGAPTT
FT                   GAGGNTAEPATQGWSTTPIDASMLALIEGDISLDVKGLQTSSVIFGPSRMTLSIERARA
FT                   VLSFLPVQAFGGTLQGELIANNRNGLSVAGNLQFANVEMREALGQLAGYDKLNGEALGN
FT                   LEFLGVGNSMDQIMRSLDGKGRVELGKGFFTGFDLQSVMDPNGGNGGTTIFEGLTASFD
FT                   MIDGTLRNDDLNAALKVLKAAGAGRVGLGSQDLDYTFTPTAFASETSAGVSVPVRIQGS
FT                   WFDPEIKPDLSKLVQPKLDEAEEKAKQAVRDKLSDELGVPVETEEDLNDALKRRVEEEA
FT                   RKQLLKFLGSD"
FT   gene            complement(698293..699789)
FT                   /locus_tag="TM1040_0652"
FT   CDS_pept        complement(698293..699789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0652"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63385"
FT                   /db_xref="GOA:Q1GIY1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY1"
FT                   /protein_id="ABF63385.1"
FT                   /translation="MTKPLPEVTPNSWSFLRDAMIKPTGFREYDARWKYPEEINLPGMT
FT                   ALGLGLGTQMIRRGIAPVIAVGNDYRDYSLAIKNALILGLMQAGIKVKDIGPALSPMAY
FT                   FAQFHLDVPAVAMVTASHNPNGWTGVKMGFDRPLTHGPDEMSELRDIVLNGEGERREGG
FT                   SYEFVEGVKEAYIDDLVGDFKMSRPLKVVCATGNGTASAFAPEVFERIGVEVVPSHNAL
FT                   DYTFPHYNPNPEALEMLHDMSASVKASGADLALGFDGDGDRCGVVDDEGEEIFADKVGV
FT                   IMARDLSKLHPGSTFVADVKSTGLFASDPELQKNGVKADYWKTGHSHMKRRVKEIGALA
FT                   GFEKSGHYFLAEPVGRGYDCGMRVAVEVCKMLDRNPDMKMSDLRKALPRTWATPTMSPY
FT                   AADTEKYDILARLVDKLVAKHDAGELMAGRTIKEVVTVNGARVILDNGSWGLVRASSNT
FT                   PNLVVVCESSESEDEMRAIFADIDAVIRTEPAVGDYDQTI"
FT   gene            complement(699813..700646)
FT                   /locus_tag="TM1040_0653"
FT   CDS_pept        complement(699813..700646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0653"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63386"
FT                   /db_xref="GOA:Q1GIY0"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIY0"
FT                   /protein_id="ABF63386.1"
FT                   /translation="MKKIDINGLTIGNDCPLTVIAGPCQLESADHAQMIAGKLKEACDA
FT                   AGAQFIFKASYDKANRTSLSGKRGLGIDKGLEVLAGVRDTFGVPVLTDVHTEAQCIVAG
FT                   DVVDVLQIPAFLCRQTDMLLAAGNTGKAVNIKKGQFLAPWDMDNVVAKVESTGNDKILL
FT                   TERGTSFGYNALVADMRGLPRMAQTGYPVVMDATHSVQQPGGQGGSTGGQREFAPVMAR
FT                   AAVSLGIASVFIETHEDPDNAPSDGPNMIYLKDMPQLIETLMGFDALAKANPIRI"
FT   gene            complement(700651..702408)
FT                   /locus_tag="TM1040_0654"
FT   CDS_pept        complement(700651..702408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0654"
FT                   /product="Capsule polysaccharide export protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63387"
FT                   /db_xref="GOA:Q1GIX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX9"
FT                   /protein_id="ABF63387.1"
FT                   /translation="MTTKPKAKKFRIRRPSSGAEQPQAAAAATARPVPPPPAQETGRDQ
FT                   PLEMQSQVEQAAKASSAGDFAPAASDTPARASSPQMTPSQSGATTPPQDASEDVGSTDI
FT                   EDIKREGLTGRQLRLARRVAQKHDLPATSDYDAVRLLRLRGIDPFKRANMLELVVPQSQ
FT                   NASVPATQAPQGAPKPQTLPQTVEKSKPSAPPADHLSPTERRNREIRSIQRDIARRRRR
FT                   KMALLGARLGAFVLIPTLLAGYYYYKVATPMYASHSEFLVLKADSTGSSGFGGLLSGTQ
FT                   FATSQDSIAVQAYLQSKVAMRRLDEEAGFRAHFSQDWIDPIQRLEPDASNDDAYKTYQR
FT                   NVKIGYDPTEGVIRMDVSAAEPAVAAEFSRRLISYAQENVNHLSEQKRADQVGDAEEAL
FT                   ALAEQQRRDAQAELVRLQQQGSVLDPEGVIASLRSQINTFELQLQQKRLELAALQDNLR
FT                   PNAAKVEGTAADIKRLEALIANLNERMTDASQGENSLASLSVKIQMAQADLATRDMMLQ
FT                   SALQQVEQTRMEANRQVRYLTTAVEPVPADTPSSPRKFENTILAFLIFSGIYLMCALTA
FT                   SILREQVSS"
FT   gene            complement(702386..703045)
FT                   /locus_tag="TM1040_0655"
FT   CDS_pept        complement(702386..703045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0655"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63388"
FT                   /db_xref="GOA:Q1GIX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX8"
FT                   /protein_id="ABF63388.1"
FT                   /translation="MLEFVNVSKSFWTGTQRKIILDKVSFTVELGTSLGILAPNGTGKT
FT                   TLINMMAGLEKPDEGEIYRGCKISFPLGFMGGVINRLSAMENCRYIARLYGLDPDYVES
FT                   YCRWLCGLNEYFDQPLGTYSAGMKSRFSFALMLALDFDIYLIDEGMPSSTDVEFNRKAG
FT                   IILQERLETTTIVIVSHQPRTLEKFANTAAVLMNGQLHMFETLEEAKQLYDYETQG"
FT   gene            703380..703982
FT                   /locus_tag="TM1040_0656"
FT   CDS_pept        703380..703982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0656"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63389"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX7"
FT                   /protein_id="ABF63389.1"
FT                   /translation="MQSNTDELKKEISACRLCAARFASTRTAHEPRPVVWFEPSARILI
FT                   AGQAPGMRVHQSGRPFTDSSGDRLREWLGLSEDCFYDTSRVAIVPMAFCFPGYDAKTAD
FT                   LPPPRICGETWHDRVMSALGKLRLRILVGGHAHRYHLGTRLGVTELVKGWRSLPEGVFA
FT                   LPHPSWRNTAWLKRNPWFEAELLPVLRARVKEQMQHD"
FT   gene            703975..704766
FT                   /locus_tag="TM1040_0657"
FT   CDS_pept        703975..704766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63390"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX6"
FT                   /protein_id="ABF63390.1"
FT                   /translation="MTEMTPLDLAHAAMEAAPADDAARLRFFERLADSELFLLLDKEPE
FT                   GDRISPEIFETGEGRFVLVFDREERLAQFAERIVPYAALSGRVIASMLAGQGIGLGVNL
FT                   EVAPSSILIPDAAMGWLAETLAHAPGEVEAAISEVHPPRGLPETLLAALDTKLATATGL
FT                   ARMAYLAAVNYESGGSGHLLAFIGAEPGAEPALAKAAGEALTFSGIEAGALDVGFFAAS
FT                   EEISARLARVGLRFDLPEVETGQIYQPQRPGSDPEKPPRLK"
FT   gene            complement(704912..705784)
FT                   /locus_tag="TM1040_0658"
FT   CDS_pept        complement(704912..705784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63391"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX5"
FT                   /protein_id="ABF63391.1"
FT                   /translation="MSDTTYTPPKVWTWEQESGGQFASINRPIAGATHDKELPVGEHPF
FT                   QLYSLATPNGVKVTVMLEELLAAGVKDAEYDAWLINIGEGDQFGSGFVEINPNSKIPAL
FT                   HDRSGDAPVRVFESASILMHLAEKFGHFLPKEGAARTEVLNWLFWQMGSAPYLGGGFGH
FT                   FYAYAPEKFEYPINRFTMESKRQLDVLNRELATKTYIAGEDYSIADMAIWPWYGQLVLG
FT                   RLYDAAEFLDVESYEHVMRWAKAIDARPAVQRGRMVNRAFGELSTQLRERHSAEDFETK
FT                   TQDKLEAAE"
FT   gene            706043..706831
FT                   /locus_tag="TM1040_0659"
FT   CDS_pept        706043..706831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0659"
FT                   /product="protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63392"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX4"
FT                   /protein_id="ABF63392.1"
FT                   /translation="MANTEKPPLLAVLIDADNISAKFAGAMFEEIASLGEASIRRIYGD
FT                   FSGGGPQGWSKDKLAAFAIVPHQQFANTTGKNASDIALVIDAMDILHSGRFDGFVLISS
FT                   DSDFTRLASRIREQGLDVYGMGMRKTPAAFVRACKRFIYVENLLTEVPKDVPKPQKSKP
FT                   KPSTQSSGATLEQTAAPQDDEAPAELEDPQKLVLRAMDAISQEDEWFSLGQIGQYITAA
FT                   SPDFDTRSYGKRKLSDLIATMKILETRRGEGNQILVRRLD"
FT   gene            706831..707241
FT                   /locus_tag="TM1040_0660"
FT   CDS_pept        706831..707241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63393"
FT                   /db_xref="GOA:Q1GIX3"
FT                   /db_xref="InterPro:IPR025356"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX3"
FT                   /protein_id="ABF63393.1"
FT                   /translation="MSVPQAADAPARIWQRIEGGLICAAGLWLYAGAEAVLPIWGAMLL
FT                   FFAPDLSCVGYLFGRRAGAFCYNLVHLYAAGVVTLALAHLWQSPLLWEIAALWLAHCGF
FT                   DRLLGYGLKSTQGFEFTHLGRIGRAREPRSDA"
FT   gene            707349..707921
FT                   /locus_tag="TM1040_0661"
FT   CDS_pept        707349..707921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX2"
FT                   /protein_id="ABF63394.1"
FT                   /translation="MRLDWSVQRPWAQEEDFVMKRFALAAVAALSFGLPAFAGEQFVDD
FT                   TGFAVSGYDVVAYRSLEQAPVGQAQPAAVPGKADITADYNGATFAFATEENRATFLENP
FT                   AYYAPAYDGHCAYGVSKGGKVPGNPNLWRIVDDKLYLNITKNVVSFWEEDIPGNITLAE
FT                   GNWPAIDPNPASGNPIPNFTSSAPVQD"
FT   gene            complement(708098..708688)
FT                   /locus_tag="TM1040_0662"
FT   CDS_pept        complement(708098..708688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0662"
FT                   /product="GcrA cell cycle regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63395"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX1"
FT                   /protein_id="ABF63395.1"
FT                   /translation="MSWTDERVELLKKMWGEGQSASQIAKELGGVTRNAVIGKVHRLGL
FT                   SNRTTGGGSKAAAEPKEKPAPKAAAKPKAQPKTEPARPVTPEPVAEAPAAEPKPSTPAR
FT                   KQIIPAGQPLPPQPSANEIPAEALAKVNEIEKKAKKLSLMELTERTCKWPVGDPATEDF
FT                   WFCGLPVQQGKPYCEAHVGVAFQPMSSRRDRKR"
FT   gene            708878..709702
FT                   /locus_tag="TM1040_0663"
FT   CDS_pept        708878..709702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0663"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63396"
FT                   /db_xref="GOA:Q1GIX0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIX0"
FT                   /protein_id="ABF63396.1"
FT                   /translation="MSDNNAQSSFRIEVGERRFGRVNWLGLQTLAGREIKRFMVVYTQT
FT                   LLAPMVTAALFLLIFSIAIGPRRGDVMGVPFISFIAPGIMMMTVIQNAFANTSSSLVIS
FT                   KVQGNIVDTLMPPLSGFEILLGYLAGAITRGLFVSVGIGLGLALVLGMVPAHPLVALGF
FT                   VVLGAAFLGGLGIVAGVFADKFDQMAAITNFVVTPLAFLSGTFYSVEALPPVLYAISHV
FT                   NPVFYLIDGVRYGMIGVSDSDPAFGALVCLGATAVILLLAWQMLRTGYRLKN"
FT   gene            complement(709699..710691)
FT                   /locus_tag="TM1040_0664"
FT   CDS_pept        complement(709699..710691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0664"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63397"
FT                   /db_xref="GOA:Q1GIW9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW9"
FT                   /protein_id="ABF63397.1"
FT                   /translation="MGTLRPRLLRLPLGEPERTDDAMTHETPQNPPLAAALILLATVFI
FT                   AGTTLLAKSLGTEVLAPPLHALQISQGRFVFAFIGISAAVVVLRQKIHTPHWGLHIGRS
FT                   SFGWGGVTLMFASVAFIPLADATAISFLNPVIGMILAIPFLGEKVGPWRWLAAAIALLG
FT                   AMVLLRPTPASFQPAALLAFGAALAMGAELIFIKTLARREPPLQILWVNNLIGMVIAST
FT                   AALAVWQMPTPAQWAALVALGALMACAQACFVNAMARADASFVAPFAYATLVFAALYDA
FT                   LIFGVLPDWVTVLGAGIILSGAGLLAWRESVNGKRPLVTEPLPRSDTVL"
FT   gene            710999..712174
FT                   /locus_tag="TM1040_0665"
FT   CDS_pept        710999..712174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0665"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63398"
FT                   /db_xref="GOA:Q1GIW8"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW8"
FT                   /protein_id="ABF63398.1"
FT                   /translation="MIPSVLPTYNRAPLNFVKGEGSWLIEADGRRFLDLGSGIAVNALG
FT                   HAHPALVEALTAQAQNLWHVSNLYEIPQQQALADKLVAESFADTVFFTNSGTESCELAV
FT                   KMARKYHYEKGHPEKVEIITFEGSFHGRSSAGIAAAGSEKMTKGFGPLLPGFVHLPWGD
FT                   AQAVAAAIDDKTAAILVEPVQGEGGIRPMPDQDLKDLRALCDEHGLLLILDEVQCGVGR
FT                   TGKLFAHEWAGIAPDIMMVAKGIGGGFPLGAVLASEEAASGMTAGTHGSTYGGNPLGCA
FT                   VGCAVMDHVAAPDFLSEVNRKAGLLRQKLEGLVASHPDVFEEVRGSGLMLGLKCRAVNA
FT                   EVVKAGYDAEVITVPAADNVIRLLPALTITDADIEEAITRLDAAATAVEAA"
FT   gene            712251..713177
FT                   /locus_tag="TM1040_0666"
FT   CDS_pept        712251..713177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0666"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63399"
FT                   /db_xref="GOA:Q1GIW7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GIW7"
FT                   /protein_id="ABF63399.1"
FT                   /translation="MNHFLDIHKTAPEDLRQIIDQAGQMKTARLGRPKGTPDDEQPLAG
FT                   HMVALIFEKPSTRTRVSFDVGVRQMGGETMVLSGKDMQLGHGETIADTARVLSRYVDMI
FT                   MIRTFDETVLTEMAEYADVPVINGLTDRTHPCQIMADILTYEEHRGPIKGKKVVWTGDG
FT                   NNVCASFLHAAGQFGFDLTFTGPAQLDPEDEFIGFARNAGSKITIERDAAKAVEGADLV
FT                   VADTWVSMHDSQSSKERRHNMLRPYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMD
FT                   GPQSVIFDEAENRLHAQKAVMRWCLGV"
FT   gene            complement(713370..714860)
FT                   /locus_tag="TM1040_0667"
FT   CDS_pept        complement(713370..714860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0667"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63400"
FT                   /db_xref="GOA:Q1GIW6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW6"
FT                   /protein_id="ABF63400.1"
FT                   /translation="MTQPDWRSLDKDLVRLNQTERTTGYVVRPLLGFGLALTFMALAGV
FT                   EAAFVLGTSQTTMMAMVAAMFGAYLALNIGANDVANNMGPAVGAKALPMTAALIAAALA
FT                   EVTGALLGGSEVVATVSTRLIEPDAMSAPHMLIQAMMSAMIASALWVNLATWMGAPVST
FT                   TQSIIGAILGATTAAAGFGAVDWLTFGSIATSWMLSPLIGAVLAMALLALIRQVITEQD
FT                   EKLEAARRWVPILLAGMGGAFGTFFVLKLPETVAAATSAQALLAGGCLGLLSFVIARPL
FT                   ILRRAAELENQKGAIKALFRLPLVIAAILMSFAHGANDVANAIGPLASIVQAMDLENTG
FT                   SHPAEINAFTTLDVPVWVLIIGAFGMAMGVVLFGPRLVNMVGNQITKLNPIRAYCVSTS
FT                   AALTVIMASWLGLPVSSTHVAVGAVFGVGFYREHAAAQARRAGQKETRPGLPHEDRSRR
FT                   RLVRRSHVLTILAAWLITVPLSGLLSAGIYGILHLFSG"
FT   gene            complement(714982..715449)
FT                   /locus_tag="TM1040_0668"
FT   CDS_pept        complement(714982..715449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0668"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63401"
FT                   /db_xref="GOA:Q1GIW5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW5"
FT                   /protein_id="ABF63401.1"
FT                   /translation="MQQLLHKIWSQTFQPMLSRPRRLQVAALCYRRDKSGCEVLLITSR
FT                   DTGRWVVPKGWPMEGKSSAESAAQEAWEEAGVRCGRFEETPVGRFEYDKRLNNGALEPL
FT                   ETLVYAIEVQELRDDFPEAHERTRKWVSPKDAAEMVREPQLQDLLRGFSPS"
FT   gene            complement(715629..718154)
FT                   /locus_tag="TM1040_0669"
FT   CDS_pept        complement(715629..718154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0669"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63402"
FT                   /db_xref="GOA:Q1GIW4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW4"
FT                   /protein_id="ABF63402.1"
FT                   /translation="MTRLPIDDALPQLISALRARGRAVLEAPPGAGKTTKVPLAILDAK
FT                   LTEGRILMLEPRRLAARTAAERMASTLGEPAGHTVGYRVRGEAKVSRSTRIEVVTEGIL
FT                   TRMLQSDPDLPGVGAVIFDEFHERSLNGDLGLAFCLEVASALRDDLLLLAMSATLDAAP
FT                   VAALMNAPIVTSEGRSYPVETRWLPAPLPAKARRIDALVDLVVQAEAETRDKDDRAGSG
FT                   GLLVFLPGEGEIRRAASALERRLPAACQVRPLFGALPFAEQRAAIAPATEGRKVVLATS
FT                   IAETSLTIEDIRVVVDMGQARRARFDPGAGMSRLVTERVTRAEATQRQGRAGRVSAGVC
FT                   YRLWAQGEEGALAAYPPAEIEAADLTSLALELALWGAEPQDLPLLTPPPAGSFAEAQLL
FT                   LQMLGALDTKMRITEHGRALARLPLHPRLAHMFTIAGPESATLAALLADRDPLRGAPVD
FT                   LALRLEALQDLRRFRDRRPYEVKAPAHQAITAEAKRLKRHRGGHGTAAPNPVDGPAAPL
FT                   FPAAPSGEPLSPAAMAALAYPDRVAQRRKGDDARFVLSGGKGAVLDNADPLAGASYLVV
FT                   TDTDGNPREAKIRQAAQITLAEIRGLFGDQIAWQEVCSWSKRDRRVVARKQERFGALVL
FT                   DDRIWKDVPPDAVAHAMLDGVRDLGLRLSPAAARLATRVELLRAEGRDLPDFSEEGLMA
FT                   KLEDWLLPMISGMRSDADWKSFDALPALRAVLTWDQTQMLDRDVPGSFVTPLGRKIPID
FT                   YDGEIPGIAVRLQEVFGVTRHPTVAGVALKVTLLSPARRPIQITRDLPGFWAGSYADVR
FT                   KDMRAQYPKHPWPEDPTKAEATLRARPRK"
FT   gene            718401..719402
FT                   /locus_tag="TM1040_0670"
FT   CDS_pept        718401..719402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0670"
FT                   /product="LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63403"
FT                   /db_xref="GOA:Q1GIW3"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW3"
FT                   /protein_id="ABF63403.1"
FT                   /translation="MDITELSKKILQADRRALARAITLVESARADHRAQADALLSELAK
FT                   SDRQALRIGLSGTPGVGKSTFIEAFGMMLIEQGLRVAVLAVDPSSARSGGSILGDKTRM
FT                   ERLSRERAAFIRPSPSQSHLGGVARRTRDAVALCEAAGFDVVLIETVGVGQSETVVSEL
FT                   SDLFLLLLAPAGGDELQGVKRGIMEIADMILINKADGDLKATATRTCADYAGALRLLRK
FT                   RPQDPEGFPKALTVSAIEAAGLDQAWEEIQALAGWRRENGFWDKNRSQQAQYWFAEEVR
FT                   QALLSRLQTSWAKSRMADLSAQVAGGAQTPQDAARDMLLGLGVGDVDPSGAP"
FT   gene            719704..719994
FT                   /locus_tag="TM1040_0671"
FT   CDS_pept        719704..719994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0671"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63404"
FT                   /db_xref="GOA:Q1GIW2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1GIW2"
FT                   /protein_id="ABF63404.1"
FT                   /translation="MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGR
FT                   GVKLRISAAALRSVDHRGGLDAFLAKAKDEELSAAALKVKKEIAKAQAAEA"
FT   gene            720156..720500
FT                   /locus_tag="TM1040_0672"
FT   CDS_pept        720156..720500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63405"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW1"
FT                   /protein_id="ABF63405.1"
FT                   /translation="MKVMRRYIALLLAAALLLTGHSAAASRFDRDATGQVILCTGSGPV
FT                   TVYVDANGTPTGAPHICPDCITHLLDLAEYAPHLRAPYAPVRLVHRVLSRAQSTVAPLE
FT                   EVRARAPPLV"
FT   gene            720577..721068
FT                   /locus_tag="TM1040_0673"
FT   CDS_pept        720577..721068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0673"
FT                   /product="protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63406"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIW0"
FT                   /protein_id="ABF63406.1"
FT                   /translation="MSYKSLGRSAAFGVFASVAFATSASAQMLVQDAYARSSNKMAGAA
FT                   FMEITNQGASEDRLIDARSDVAKRVQLHTHQEDANGVMKMMHVEEGFAIPAGETHLLRR
FT                   GGDHVMFMGLTRELKDGETVDVILVFENAGEVSVQIPVDMDRAPKGGHGNHSGHGDHSN
FT                   "
FT   gene            complement(721127..721825)
FT                   /locus_tag="TM1040_0674"
FT   CDS_pept        complement(721127..721825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0674"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63407"
FT                   /db_xref="GOA:Q1GIV9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIV9"
FT                   /protein_id="ABF63407.1"
FT                   /translation="MKKIVILTGAGISAESGLGTFRDKGGLWSQHRIEDVATPEGFARD
FT                   PELVHRFYSARRQHAAEALPNAAHDALARLEERWTGDVIIITQNVDGLHEKAGSRGVLH
FT                   MHGALSGALCAACAHRWPAPLQMTPETRCPACDANTARPDVVWFGEVPYHMEQIASHLA
FT                   EADLFVAIGTSGQVYPAAAFVQEAATYGAQTLELNLEPSEVSADFAQHRFGKASDVVPI
FT                   WVEDLLRDAA"
FT   gene            721940..722389
FT                   /locus_tag="TM1040_0675"
FT   CDS_pept        721940..722389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0675"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63408"
FT                   /db_xref="GOA:Q1GIV8"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIV8"
FT                   /protein_id="ABF63408.1"
FT                   /translation="MESVLFVCLGNICRSPAAEAIFRESCPNIQCDSAGTAGYHVGSPP
FT                   YPEMAKAARARGIDMSDLRARQFCAEDFRNFDLIVVMDQDNQENVESLRPAGDRTPVVL
FT                   FAPMAAGFDVEAVPDPYYTRDFDGCLDLLESAAQGLKRYVTQAGV"
FT   gene            complement(722497..723462)
FT                   /locus_tag="TM1040_0676"
FT   CDS_pept        complement(722497..723462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TM1040_0676"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:TM1040_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABF63409"
FT                   /db_xref="GOA:Q1GIV7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1GIV7"
FT                   /protein_id="ABF63409.1"
FT                   /translation="MLMKGVTLRGLEVFEALAKSGSVAQAADITGLSQPAVSQQLRNLE
FT                   KALGSDLVDHGRRPMVLTSAGRSFLSRTQAILSELRLAQSELTVMDLSHLPALSIGLID
FT                   DFDNDLTPRLATILADSLTQCRFKMVTASSHDIHRAMAEKDLHIGVAASTGELRTGVTE
FT                   YPLVEEPFILVAPRGCITDPDDVGNQLNHLPLLRYARDQLISQQIESHLSRNKMEFDDR
FT                   FEIGSHLALMAMVARRIGWAITTPLGYMRAVRFHEDIDAYALPFAGFSRRISLFAQSDW
FT                   PDTVPLEVAGTVRRLTQSQMITPAINRLPWLAGQLRVIEE"
FT   gene            complement(723729..724040)
FT                   /locus_tag="TM1040_0677"
FT   CDS_pept        complement(723729..724040)
FT                   /codon_start=1
FT                   /transl_table=11
FT