(data stored in ACNUC29543 zone)

EMBL: CP000379

ID   CP000379; SV 1; circular; genomic DNA; STD; PRO; 2788459 BP.
XX
AC   CP000379; AAHI01000000-AAHI01000094;
XX
PR   Project:PRJNA13919;
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Burkholderia cenocepacia AU 1054 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Burkholderia cenocepacia AU 1054
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2788459
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Lykidis A., LiPuma J.J., Konstantinidis K.,
RA   Tiedje J.M., Richardson P.;
RT   "Complete sequence of chromosome 2 of Burkholderia cenocepacia AU 1054";
RL   Unpublished.
XX
RN   [2]
RP   1-2788459
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Lykidis A., LiPuma J.J., Konstantinidis K.,
RA   Tiedje J.M., Richardson P.;
RT   ;
RL   Submitted (12-MAY-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f2667cfeabaf61a21d4b09f818b7bdfd.
DR   BioSample; SAMN02598326.
DR   EnsemblGenomes-Gn; Bcen_R0071.
DR   EnsemblGenomes-Gn; Bcen_R0072.
DR   EnsemblGenomes-Gn; Bcen_R0073.
DR   EnsemblGenomes-Gn; Bcen_R0074.
DR   EnsemblGenomes-Gn; Bcen_R0075.
DR   EnsemblGenomes-Gn; Bcen_R0076.
DR   EnsemblGenomes-Gn; Bcen_R0078.
DR   EnsemblGenomes-Gn; Bcen_R0079.
DR   EnsemblGenomes-Gn; EBG00001268273.
DR   EnsemblGenomes-Gn; EBG00001268274.
DR   EnsemblGenomes-Gn; EBG00001268275.
DR   EnsemblGenomes-Gn; EBG00001268276.
DR   EnsemblGenomes-Gn; EBG00001268277.
DR   EnsemblGenomes-Gn; EBG00001268278.
DR   EnsemblGenomes-Gn; EBG00001268279.
DR   EnsemblGenomes-Gn; EBG00001268280.
DR   EnsemblGenomes-Gn; EBG00001268281.
DR   EnsemblGenomes-Gn; EBG00001268282.
DR   EnsemblGenomes-Gn; EBG00001268283.
DR   EnsemblGenomes-Gn; EBG00001268284.
DR   EnsemblGenomes-Gn; EBG00001268285.
DR   EnsemblGenomes-Tr; Bcen_R0071-1.
DR   EnsemblGenomes-Tr; Bcen_R0072-1.
DR   EnsemblGenomes-Tr; Bcen_R0073-1.
DR   EnsemblGenomes-Tr; Bcen_R0074-1.
DR   EnsemblGenomes-Tr; Bcen_R0075-1.
DR   EnsemblGenomes-Tr; Bcen_R0076-1.
DR   EnsemblGenomes-Tr; Bcen_R0078-1.
DR   EnsemblGenomes-Tr; Bcen_R0079-1.
DR   EnsemblGenomes-Tr; EBT00001800204.
DR   EnsemblGenomes-Tr; EBT00001800205.
DR   EnsemblGenomes-Tr; EBT00001800206.
DR   EnsemblGenomes-Tr; EBT00001800207.
DR   EnsemblGenomes-Tr; EBT00001800208.
DR   EnsemblGenomes-Tr; EBT00001800209.
DR   EnsemblGenomes-Tr; EBT00001800210.
DR   EnsemblGenomes-Tr; EBT00001800211.
DR   EnsemblGenomes-Tr; EBT00001800212.
DR   EnsemblGenomes-Tr; EBT00001800213.
DR   EnsemblGenomes-Tr; EBT00001800214.
DR   EnsemblGenomes-Tr; EBT00001800215.
DR   EnsemblGenomes-Tr; EBT00001800216.
DR   EuropePMC; PMC2612433; 18931103.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000379.
DR   SILVA-SSU; CP000379.
DR   StrainInfo; 844878; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635680
CC   Source DNA and bacteria available from James M Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2788459
FT                   /organism="Burkholderia cenocepacia AU 1054"
FT                   /chromosome="2"
FT                   /strain="AU 1054"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:331271"
FT   gene            19..1329
FT                   /locus_tag="Bcen_2986"
FT   CDS_pept        19..1329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2986"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: bur:Bcep18194_B0808 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2986"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77882"
FT                   /db_xref="GOA:A0A0H2XUK3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK3"
FT                   /protein_id="ABF77882.1"
FT                   /translation="MKILRRIACFGLLVILVAAGWFAYTALRPSGPEPVSPFAGVPADL
FT                   PAGVARGAYLARAADCVACHTAPGGTPYAGGRAFDLPFGKIYSTNLTPDKETGIGDWTD
FT                   DAFVRAVRQGVGRAGHLYPAMPYTSYTAMSREDVLDIKTYLLSLAPVRQAAPLNTLAFP
FT                   FNQRWGMAFWNAIFFHEQRFRPDPAKSVEWNRGAYLAGPLGHCGECHTPRNAGFAMQSR
FT                   AYLSGADIDGWKAYNTTQDDLYGIGAWRDEQIAGYLSTGHARGRSSAAGPMAEVVEHSL
FT                   QHLTSNDIGALVAYLRGITPVKGGGAGPVELAPAAARASNPVLPGESARDENGRGRRLF
FT                   AADCAGCHQWNGAGRQSPYADLVGSRAVNDPSGTALMQVLLHGTNVQINGQTHMMPSFG
FT                   SVYSDADVAAVSNYVIAHFGDKKGTVTVQQVHGKRRD"
FT   sig_peptide     19..96
FT                   /locus_tag="Bcen_2986"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.871 at
FT                   residue 26"
FT   gene            complement(1641..2561)
FT                   /locus_tag="Bcen_2987"
FT   CDS_pept        complement(1641..2561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2987"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   atc:AGR_pAT_467 probable transcription regulator PA2316"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2987"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77883"
FT                   /db_xref="GOA:A0A0H2XSJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSJ0"
FT                   /protein_id="ABF77883.1"
FT                   /translation="MEQISLDRLTGLIAFSRAASLGSYSAAARALGVTPSAISKSIQRL
FT                   ERHFEIKLFNRTTRSLTLTQEGRDLHERTLRLLSEMEAIEQAAASARSEPAGILKVTAP
FT                   LPIGVHLIAPALPAFRQRFPKLSIDLRLGDHFVDLVGEGIDVAVRVGDLTGSRLVSRAL
FT                   SPHYIGAYASPDYLAKRGVPRHPDELVEHDCVNFRFQSSGQVLRWTFATDEGPLSLTPD
FT                   ADIVVDTSDAVAAVMAAGGGVGISPTYVAAAYVRRGELVPILTEFVEPRSTITALWPES
FT                   RRSSPNVKVLLAYLKKVFASYAAEH"
FT   sig_peptide     complement(2469..2561)
FT                   /locus_tag="Bcen_2987"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.698) with cleavage site probability 0.432 at
FT                   residue 31"
FT   gene            2671..3408
FT                   /locus_tag="Bcen_2988"
FT   CDS_pept        2671..3408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2988"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: bur:Bcep18194_B2086 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77884"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTP6"
FT                   /protein_id="ABF77884.1"
FT                   /translation="MTSDFDSHSLKSKSVLIFGGTSGIGLAAAKQAKAAGASVTVVGFN
FT                   PEGAEQVAIENGFAGWRSADVTRPETIVSALADIAHVDHLVLLAGTFVAGKVLDADVDY
FT                   LRRAFDERVWAAVHTLRALGDRLAADASVTFISGVLADRPNAYGTAILASASAAMEALA
FT                   RGLVLELAPRRVNTVSPGTTDTPLLARTLGEGRDAYVNALKDKLPLHRLGTAEEVGAAV
FT                   VFLMSNGSMNGETIHVDGGARLV"
FT   sig_peptide     2671..2760
FT                   /locus_tag="Bcen_2988"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.838) with cleavage site probability 0.424 at
FT                   residue 30"
FT   gene            3465..4547
FT                   /locus_tag="Bcen_2989"
FT   CDS_pept        3465..4547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2989"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   zmo:ZMO1885 NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2989"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77885"
FT                   /db_xref="GOA:A0A0H2XUI8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUI8"
FT                   /protein_id="ABF77885.1"
FT                   /translation="MPTLFDPLRLGAIEVPNRILMAPMTRARGTREHVPTAMMADYYSQ
FT                   RASAGLIISEAIGISRQGLGWPYATGLWTAAQIAGWRTVTDAVHEAGGRIIAQLWHMGR
FT                   VVHPSFLDDAPPVSSSETTAPGHAHTYSGKQPYTQARALETKEIPAIIEQFAAAARNAL
FT                   QAGFDGVQLHASNGYLIDQFLRDSANFRGDAYGGSISNRLRLLIQATRAVADVAGPGRT
FT                   SVRLSPNGETQGVRDSDPLPLFIAAAEALSAVGIGFLELREPPLNGSFGVGYLDPLAAK
FT                   IRPAFKGPLVLNSDFDATRAQAELDAGVADAVTFGRPFISNPDFPRRLAEAIPLASDDP
FT                   ATWFTQDAQGYIDYPFAAST"
FT   gene            4709..5545
FT                   /locus_tag="Bcen_2990"
FT   CDS_pept        4709..5545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2990"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_C6920 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77886"
FT                   /db_xref="GOA:A0A0H2XT65"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT65"
FT                   /protein_id="ABF77886.1"
FT                   /translation="MSFITTRDGVDIFYKDWGPRDAQPIVFHHGWPLSADDWDTQMLFF
FT                   LANGYRVIAHDRRGHGRSSQVAEGHDMDHYAADAFALVETLDLRHAVHIGHSTGGGEVA
FT                   RYVARHGEPTGRVAKAILVSAVTPLMLKTPSNPEGLPLDVFDGLRKGLAENRAQFFVDV
FT                   PAGPFYGFNRPDATVHQGVIQNWWRQGMMGSAQAHYEGIKAFSETDQTEDLQLIGVPTL
FT                   VLHGEDDQIVPYKDAALKAIKLLKNGKLKTFPGFSHGMLTVNASVLNAELLAFVQE"
FT   gene            5622..6011
FT                   /locus_tag="Bcen_2991"
FT   CDS_pept        5622..6011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2991"
FT                   /product="Limonene-1,2-epoxide hydrolase"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   nfa:nfa41920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77887"
FT                   /db_xref="GOA:A0A0H2XUK8"
FT                   /db_xref="InterPro:IPR013100"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK8"
FT                   /protein_id="ABF77887.1"
FT                   /translation="MTTDVLAVALRFFSLWTENRIDDALSMLSDDVLYDNVPFPDIVGR
FT                   DNVRQFHGDFGIGTTFKVDWTVTHIAAAGNVVLNERIDVFQHESGGKITLPVMGTLTIV
FT                   DDRITVWRDYFDPADFDRQLSAIKK"
FT   gene            6210..7409
FT                   /locus_tag="Bcen_2992"
FT   CDS_pept        6210..7409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2992"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: bur:Bcep18194_B0252 peptidase M20D,
FT                   amidohydrolase TIGRFAM: Peptidase M20D, amidohydrolase;
FT                   PFAM: peptidase M20; peptidase dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77888"
FT                   /db_xref="GOA:A0A0H2XSJ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSJ5"
FT                   /protein_id="ABF77888.1"
FT                   /translation="MTTDTPNTRFTEVEDLMPAAGGLREIRHHIHHHPELAYEEHDTAA
FT                   LVADKLEQWGWQVTRGVGKTGVVGTLRVGDGTRSIGIRADMDALPIVEATGLPYASGTH
FT                   GKMHACGHDGHTTMLLGAAQHLAKTRNFSGTVHLYFQPAEEHGVDSGAKKMIDDGLFER
FT                   FPCDAVFGMHNHPGAAPGVFLTRRGPFMSAGDKAIITIEGVGGHAARPHLTVDPVVVAA
FT                   SIVMALQTIVARNVDPSQPAVVTVGSMHAGTANNVIPNGARLELSVRSFSPEVRALLKR
FT                   RITELAETQAASYGASANVEYIEGYPVVVNTDAETDFAAQVARELVGDAHVVEQTDLLM
FT                   GSEDFAFMLQQRPGSFVRLGNGEGEDGCMVHNPKYDFNDRNLPIGAAFWTRLVERYLGQ
FT                   "
FT   gene            7466..8797
FT                   /locus_tag="Bcen_2993"
FT   CDS_pept        7466..8797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2993"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0253 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2993"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77889"
FT                   /db_xref="GOA:A0A0H2XTQ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTQ1"
FT                   /protein_id="ABF77889.1"
FT                   /translation="MQKDHLALHPASAEAADTGAPGAPAVTRRGAIAAAVIGNWLEFFD
FT                   FTVYGFFAVLIGKLFFPSSDPTTSLLLSVATFAAGFFTRPLGSVVLGVYADRKGRKAAL
FT                   NLTIMLMALGTGLIAIAPTYAQVGVAAPLLVVFARLLQGFSQGGEFGAATSTLLEQGGT
FT                   SRRGFRASWQLATQGGAALMGSGFAALLSNTMTKDALEGWGWRLPFLVGVLIAPVGMYL
FT                   RRRLADDAPGDRHHGIERGVLRELFSKHTRTVLLLMLTVMGGTVSTYILTFYMPTYAIH
FT                   TLGLPMKLSMFVGVASGCVMLVTCPLFGWLSDQLGSRRLPIFVGRGVLVALLFPAFWLM
FT                   NHHPTLSVILPLTALMLLFYSLGSASEMALMCESLPRHVRATGISIAYALAVTIFGGTA
FT                   QLIATWLVKTTGSKLAPAGYVAACVVLSLIAVAMLRETARESLD"
FT   gene            complement(8816..9736)
FT                   /locus_tag="Bcen_2994"
FT   CDS_pept        complement(8816..9736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2994"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0254 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2994"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77890"
FT                   /db_xref="GOA:A0A0H2XUJ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUJ3"
FT                   /protein_id="ABF77890.1"
FT                   /translation="MAFTLSQLRIFQAVVEHGSLRAAARALDLAQSGVTQQLQGLEATL
FT                   GATLFTRTNRGIVPTAVGQRLLARSGSILGECEQVEREIRQLSGAYEGTVTLGLVTEPL
FT                   IDAFAPVLTAFRARFDKVDVHLRTGTSRMMIGWLRESAVDFAIALVAKQTDTTDLAVTP
FT                   LRTSAPVVVCRNGHPAMHAQSLAELGDYGWVSTRSPNLSADPVVNRLLAYFDTHGQPPP
FT                   KILATVEGMFETLQIVTQTDSLALETEAITRHGPFAGALVKVPVREQAEAQDICLLQRA
FT                   AVPLTPAAQELATMLASYLRVVRGR"
FT   gene            9873..10646
FT                   /locus_tag="Bcen_2995"
FT   CDS_pept        9873..10646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2995"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bur:Bcep18194_B0255 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77891"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT70"
FT                   /protein_id="ABF77891.1"
FT                   /translation="MKRFLVPLVFLCIGLAATSAYALDAHVVRLGIDPTYPPMDAKAPD
FT                   GSLKGFDVDLGNEICRRAQLRCQWVELEFSGMIPALQARKIDAILSSMAITAKREKQIL
FT                   FSSKLFRFKSRLVARPGSGLDGTAASLAGKRVGVQSGTQFESWALAHWAPAGVGVVPYK
FT                   SQDDVFADLVNGRLDAALLGTVEADYGFLRQPRGKGFAFVGAPLDMGDRGVGIGMRQSD
FT                   TALKASIDGAIASMLKDGTYDRIAKQYFDFNPYGD"
FT   sig_peptide     9873..9941
FT                   /locus_tag="Bcen_2995"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            10702..11817
FT                   /locus_tag="Bcen_2996"
FT   CDS_pept        10702..11817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2996"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bur:Bcep18194_B0256
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2996"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77892"
FT                   /db_xref="GOA:A0A0H2XUL6"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL6"
FT                   /protein_id="ABF77892.1"
FT                   /translation="MQIRTTPLLSPSIGTQRTLTSFHFGPAGSGRKIYLQAALHADETP
FT                   AMLAAFVLKQRLAQLDAEGRLAAEIVLVPVSNPVGLNHHLLGQFIGRFDLASGRNFNRG
FT                   FLPLAEIAARARDRLGDDGARNRAIVRECVGAALDEIAPRTEFDALQLALLKLSHDADV
FT                   VIDLHCSLEAVMHVYTSDTAWPDVEPLARYLGAEVSLLAEDSGGHAFDDAHHLLWSQLR
FT                   AHLPDGTPMAAGTVAVTVECRGQRDVTYEYAQRDADALVDYLVWCGAVRGERAPLPPLA
FT                   APATPLAGSEQFYAPVSGILVHRAAIGATIRAGDPLFDIVDPLTDAITTISSATDGVFY
FT                   MRRAIRFVTAGAPLGRVTGMVPVRKGMLLGA"
FT   gene            complement(12028..12855)
FT                   /locus_tag="Bcen_2997"
FT   CDS_pept        complement(12028..12855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2997"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="TIGRFAM: Beta-ketoadipate transcriptional regulator,
FT                   PcaR/PcaU/PobR; PFAM: regulatory proteins, IclR; KEGG:
FT                   bur:Bcep18194_B0262 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2997"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77893"
FT                   /db_xref="GOA:A0A0H2XSK0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSK0"
FT                   /protein_id="ABF77893.1"
FT                   /translation="MRYLLGCTTFQALMTTDDIQTKPGDSYVQSFARGLAVIRAFDAAR
FT                   PEQTLTEVASATGLTRAGARRILLTLQTLGYVEADGRLFRLTPKILELGFAYLTSMPFW
FT                   NLADPVMEQLSAQIHESCSAAVLDRTEIVYVLRVPTRKIMTINLSIGSRLPAYCTSMGR
FT                   VLLSALDDAALDETLAQSTIRAHTPRTITDLGELKAAIAQVRQQGWAVVDQELEVGLMS
FT                   LSAPIRNRRGQVIAAMNISGNAQRHTAKQMVKEFLGPLQQAAQTVSELVARRG"
FT   gene            13044..14246
FT                   /locus_tag="Bcen_2998"
FT   CDS_pept        13044..14246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2998"
FT                   /product="Beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bur:Bcep18194_B0263 acetyl-CoA
FT                   C-acetyltransferase TIGRFAM: Beta-ketoadipyl CoA thiolase;
FT                   PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2998"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77894"
FT                   /db_xref="GOA:A0A0H2XTQ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTQ7"
FT                   /protein_id="ABF77894.1"
FT                   /translation="MTEAFLCDAIRTPIGRYGGALSGVRADDLGAVPLKALVERNRDVD
FT                   WTAIDDVIYGCANQAGEDNRNVARMSALLAGLPEGVPGSTINRLCGSGMDAVGVAARAI
FT                   KSGEAALMVAGGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLHGVDSM
FT                   PETAENVAVDYNVSRADQDLFALRSQQKAARAQQDGTLAEEIVSVTIAQKKGDPVVVSR
FT                   DEHPRETSLEALAKLKGVVRPDGSVTAGNASGVNDGAAALLLANEATAKRFGLTPRARV
FT                   LGIATAGVAPRVMGIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVAD
FT                   DDPRVNPNGGAIALGHPLGASGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   gene            complement(14347..14943)
FT                   /locus_tag="Bcen_2999"
FT   CDS_pept        complement(14347..14943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_2999"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   bur:Bcep18194_B0264 protein of unknown function DUF523"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_2999"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77895"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUJ8"
FT                   /protein_id="ABF77895.1"
FT                   /translation="MPRRIFRPAPAVISCHQPSRSATLNNAPPPPATPKILVSMCVVGH
FT                   PVRYNGSAKTAAHEALERWQREGRLVAVCPELAGGLNVPRPPAEIAGGASGQQVLSGHA
FT                   RIVDVNGADVTAPFVAGAQTALALAQAHDCRFAILADGSPSCGSTFIYDGSFASRRQAG
FT                   AGVTAALLREHGIEVFADTEIDALDARLRQLSQAG"
FT   gene            complement(14959..15519)
FT                   /locus_tag="Bcen_3000"
FT   CDS_pept        complement(14959..15519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3000"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0265 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3000"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77896"
FT                   /db_xref="GOA:A0A0H2XT75"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT75"
FT                   /protein_id="ABF77896.1"
FT                   /translation="MTRRTAAERDALSARLLARDDVPLVWTIDRREIIEHLYVLRDGAL
FT                   HLVPEFYDVSGWPDGEADHYTPILLDCHDRGGWFLGRFDGARLVAAAIVDSRPLGPRRD
FT                   MLQLKFLHVSHDWRGCGLGEQLYRAAQVQARAMGAERLYVSATPSQRTIDFYLRLGFTV
FT                   STAPDPELYALEPDDIHLEGPTT"
FT   gene            complement(15516..16373)
FT                   /locus_tag="Bcen_3001"
FT   CDS_pept        complement(15516..16373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3001"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   bur:Bcep18194_B0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3001"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77897"
FT                   /db_xref="GOA:A0A0H2XUM1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM1"
FT                   /protein_id="ABF77897.1"
FT                   /translation="MKKALHELNRLSWNTATVAHNSHKGDQAAFFRNGGSTLFPEEREL
FT                   LGDLTGLRLLHLQCNAGQDTLSLVRDGADATGVDISDEAIDFARQLSADAGLPARFERA
FT                   DVLDWMPAAAARGERFDRVFTSYGAICWLSDLSAWARGIASLLAPGGRFAMVEFHPFSL
FT                   YFDEQWQPRYDYFNGDAIEEPAGVGDYVAASGTGLGEQHDHPGIVDFANPHPSYEFMWG
FT                   IGDVVNALISARLVIDCLNEYPYSNGWKGFDGMRELEGRRMVPPEGMPRLPLMYAIAAH
FT                   RRAA"
FT   gene            16685..18229
FT                   /locus_tag="Bcen_3002"
FT   CDS_pept        16685..18229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3002"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS; PFAM: histidine kinase, HAMP region;
FT                   KEGG: bur:Bcep18194_B0267 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3002"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77898"
FT                   /db_xref="GOA:A0A0H2XSK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSK4"
FT                   /protein_id="ABF77898.1"
FT                   /translation="MRNNQPVTQQEFDFPDDVTLMSTTDADSVITYANTTFAQVSGFSN
FT                   EELVGQPHNVVRRPDMPKEAFADMWATLRRGEPWTALVKNRRKNGDHYWVRANAIPVMR
FT                   NGAPQGYMSVRTKAPHDETRAADALYRAFREGKAGRRRFHKGLVIRTGLLRIASLPQTM
FT                   SVRARVHSALYVLAPAVVGAGWACGLTGGGLAAFAGVTVGVAAAAGWWLDAQIVQPLKR
FT                   LHEQALNVATGESRRGVRMNRVDEIGMTLRTINQLGLMFRWLVDDVSEQVHNVQRASNE
FT                   IAQGNGDLSARTEQAASSVQQTAASMAEMTATVSSNAETALQANQLSVSASDAAERGGQ
FT                   AVSEVVTTMSEITASSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRALAQRSANAAKEIKTLISASVERVESGARIVDGAGKTMEDIVTQVKRVSDLIAEIS
FT                   SSTAEQSTGVAQVDQAVVHLDNITQQNAALVEQSTAASESLKQQATRLVDAVNVFR"
FT   gene            18578..20185
FT                   /locus_tag="Bcen_3003"
FT   CDS_pept        18578..20185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3003"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS; PFAM: histidine kinase, HAMP region;
FT                   KEGG: bur:Bcep18194_B0268 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3003"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77899"
FT                   /db_xref="GOA:A0A0H2XTR2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTR2"
FT                   /protein_id="ABF77899.1"
FT                   /translation="MRGVSNQSTSGRKIRHPELHTMRNNQPVTQREFEFADDATLMSTT
FT                   DADSYITYANAAFIQVSGFSPEEIEGQPHNVVRHPDMPKEAFADMWATLKGGEPWTALV
FT                   KNRRKNGDHYWVRANAIPVMRNGQPKGYMSVRTKATRDEIAAAEALYRDFREGKAGSRR
FT                   FHKGLIVRTGALRVASLFQTMSVRARLVSTLCVLAPAVVGAGWAAGLTGGGLAAFAGAA
FT                   VGVTAAAGLWLDAQIVRPLRQLRDEALRVATGESRSGVRMNRVDEIGMTLRTINQLGLM
FT                   FRWLVDDVSEQVLNVQRASNEIAQGNNDLSARTEQASTSVQQTAASMAEMTATVSSNAE
FT                   TALQANQLSVSASEAAGRGGQAVNEVVATMNDITDSSRKIADIIGVIDGIAFQTNILAL
FT                   NAAVEAARAGDQGRGFAVVAGEVRALAQRSANAAKEIKTLIGASVERVESGARIVDGAG
FT                   KTMEDIVTQVKRVSDLIAEISSSTAEQSTGVAQVDQAVVHLDNITQQNAALVEQSTAAS
FT                   ESLKQQAARLVEAVNVFR"
FT   gene            complement(20300..21769)
FT                   /locus_tag="Bcen_3004"
FT   CDS_pept        complement(20300..21769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3004"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="KEGG: bur:Bcep18194_B0279 succinic semialdehyde
FT                   dehydrogenase TIGRFAM: succinic semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77900"
FT                   /db_xref="GOA:A0A0H2XUK2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK2"
FT                   /protein_id="ABF77900.1"
FT                   /translation="MSTVQETLALKDPSLFRQQAYVNGEWQGATNGETFEVRNPATGGL
FT                   LGTVPAMGTAETRHAIDAANAAWPAWRKKTAKERAVILRKWHDLMMDNADDLALILTTE
FT                   QGKSLAEAKGEIGYAASFLEWFAEEGKRVYGDTIPTPASDKRIVVTKEAIGVCAAITPW
FT                   NFPAAMITRKVGPALAAGCPIVVKPAEATPFSALAMAVLAERAGVPAGVFSVVTGDPKA
FT                   IGGELTSNPIVRKLSFTGSTPVGRLLMAQCAATVKKVSLELGGNAPFIVFDDADLDAAV
FT                   QGAIASKYRNSGQTCVCTNRFYVHEAVYDQFAQKLAAAVGQLKVGRGTEPGVTQGPLIN
FT                   EAAVLKVEAHIEDALAKGATVVTGGKRHALGHGFFEPTVLTGVTPAMKVAKEETFGPLA
FT                   PLFKFGSDDEVIRLANDTEFGLAAYFYSRDIGRVWKVAEALEYGMVGVNTGLISNEVAP
FT                   FGGVKQSGLGREGSHYGIDDYVVIKYLCLAV"
FT   gene            complement(21861..23150)
FT                   /locus_tag="Bcen_3005"
FT   CDS_pept        complement(21861..23150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3005"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase, class I and II; KEGG: bur:Bcep18194_B0280
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77901"
FT                   /db_xref="GOA:A0A0H2XT81"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT81"
FT                   /protein_id="ABF77901.1"
FT                   /translation="MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFI
FT                   DFAAGIAVLNTGHRHPKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPK
FT                   KTAFFTTGAEAVENAIKIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPF
FT                   PGDVFHAPYPNAVHGVTTADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEF
FT                   VRALRKICNEHGILLIADEVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVV
FT                   GRADVMDAAAPGGLGGTYAGNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQ
FT                   ADVPQIADVRGPGAMIAVEFLKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRF
FT                   LFPLTIPQAVFDEALVILEEVLKETVGVPA"
FT   gene            23271..24779
FT                   /locus_tag="Bcen_3006"
FT   CDS_pept        23271..24779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3006"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0281 transcriptional regulator, GntR family
FT                   with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3006"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77902"
FT                   /db_xref="GOA:A0A0H2XUM6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM6"
FT                   /protein_id="ABF77902.1"
FT                   /translation="MRASVLSDWLAQRLVRGGEQPIYRQLHRLLQQAILSRELPAGTRV
FT                   PSSRLLAAELGIARNTVTQVYEQLALEGYVNSATGRGTFVADSAPDEIVGAPPDAGAGP
FT                   AVVTPSVRRLSARGTRLVEGAGVSKRQGGAFMPGVPDVSRFPARVWTRLHNKYWRRLRP
FT                   DLLTYAPGGGLALLREALADYLRTSRSVRCTPEQIVITTGIHQSIDLAVRLLTDPGDAI
FT                   WTEDPCYWGVRSVLNVSGLTTRPIPVDDEGIAPSAADLAEPPKLMLVTPSHQYPLGMVM
FT                   SLARRRMLLEYARQHGCWIIEDDYDSEFRYGSRPLASLQGLDTAGQVIYVGSFGKTLFP
FT                   GLRVGYLVAPEPLAESFATASAELYREGQLLQQAVLAEFIAEGHFVSHIRKMRTLYGQR
FT                   REVLLEAVARRYGDTLHALGSDAGLHLVTQLPAGVDDRAVAQAALARNIVVRPLSGYYA
FT                   DRSRAASGLLLGYACVPEDEIATAFATLAEAIDERAFGGAVAVA"
FT   gene            complement(25049..25885)
FT                   /locus_tag="Bcen_3007"
FT   CDS_pept        complement(25049..25885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3007"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B0286 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77903"
FT                   /db_xref="GOA:A0A0H2XSK9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSK9"
FT                   /protein_id="ABF77903.1"
FT                   /translation="MDHLFIGLVLCSALLHAIWNAFLHVSEDRLVQLGTMSLPYLAFGI
FT                   AGAVLLPAPAPAAWPYVAASAALEVAYCFTLARAYRNGEFGQIYPIARGISPLLVSVLA
FT                   LAMLHERPTPFGFAGIALVSFGIMSLALRRGFRFSGEGVPYALLTGVFIAAYSICDGIG
FT                   SRVSGSALGYIAWVYLLWSVPQLVLVCAVRGGPRAVLGSRSAFTQGAIAGTISLAAYGI
FT                   VILAYRHLPVATVSALRETSSIFAVAIGWFVMRERPGPQRLAACALVVAGAALIRL"
FT   gene            25989..27062
FT                   /locus_tag="Bcen_3008"
FT   CDS_pept        25989..27062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3008"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; KEGG: bur:Bcep18194_B0287
FT                   selenide water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77904"
FT                   /db_xref="GOA:A0A0H2XTR7"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTR7"
FT                   /protein_id="ABF77904.1"
FT                   /translation="MPTMTEATQAQPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPP
FT                   ALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAM
FT                   GGKPILALALVGMPINVLPHETIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGLAAI
FT                   GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDADGYAQMVATTTKLNRPG
FT                   AELAALPGVHALTDVTGFGLLGHTLELARGAQLTARVHYASLPWLAGVETFVADGVFTG
FT                   ASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVACAPEAVDDVLACFRADGFDR
FT                   AAVIGEMVDGPARVDVA"
FT   gene            27135..27728
FT                   /locus_tag="Bcen_3009"
FT   CDS_pept        27135..27728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3009"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0288 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77905"
FT                   /db_xref="GOA:A0A0H2XUK7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK7"
FT                   /protein_id="ABF77905.1"
FT                   /translation="MNDFLFGLMIALSVGPVALMIANYGMRAGTATGVRAAIGVAAADG
FT                   CHAVVAFTIGAMLAGTLASHLSLFRMVGALVLLAMGARMLWQALRDRRRTLDGDVVPPP
FT                   GNRPFMAMFFVTLANPLTILLFYGYATAAAGAHRHWLLGAACVFAGSLIGQLVFAFGGG
FT                   AIGRFVKSPGWLAASHVVAALVVLGYGVAGLMRV"
FT   gene            27957..29036
FT                   /locus_tag="Bcen_3010"
FT   CDS_pept        27957..29036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3010"
FT                   /product="purine nucleoside permease"
FT                   /note="PFAM: purine nucleoside permease; KEGG:
FT                   bur:Bcep18194_B0289 purine nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3010"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77906"
FT                   /db_xref="GOA:A0A0H2XT89"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT89"
FT                   /protein_id="ABF77906.1"
FT                   /translation="MLTRSILSAAAFSLAACATAPSIAQDNQGNDAGNAAFAETGSHGR
FT                   PVKVMIITMFGPEGQAWLDRLGPWRDVTVPGLSPDYPAVHCNKQDVCVVTTGMGYANAS
FT                   ATIMALTFSQRFDLRRTYFLVSGIAGVDPAQGTVGSAAWSKYLVDFSLQWELDAREIPA
FT                   GWNTGYLGINTKSPNDKPPLDYRTEVFQLNPQLTDAAYALSRNVVLADSAQAQAARAKF
FT                   TYAPANRPPTVIQCDTSSGNTWFSGTLIGERARQWTKILTDGKGTYCMTAQEDNATYEA
FT                   LKRAASVKRVDLSRVAVLRTGSDFDRPYAGQTSADNLLNYADQGGFAPATENLYRAGNP
FT                   LVQDIVTHWGEWRDGVPRR"
FT   sig_peptide     27957..28031
FT                   /locus_tag="Bcen_3010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(29264..29557)
FT                   /locus_tag="Bcen_3011"
FT   CDS_pept        complement(29264..29557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3011"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77907"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN0"
FT                   /protein_id="ABF77907.1"
FT                   /translation="MNRRHLLSALALTLAVSAPAFADSGTPHAGDYANTSWYSQHNGPR
FT                   TRAEVRAEVEQARKDGTLAYLRKATSYPQGLELAQGPYRPLPEGNQLAGGGR"
FT   sig_peptide     complement(29489..29557)
FT                   /locus_tag="Bcen_3011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(29966..30970)
FT                   /locus_tag="Bcen_3012"
FT   CDS_pept        complement(29966..30970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3012"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0293 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77908"
FT                   /db_xref="GOA:A0A0H2XSL3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSL3"
FT                   /protein_id="ABF77908.1"
FT                   /translation="MDRLQAMQVFTRVVDTSSFTKAAETLGLPRASVTTIIQNLEAFLG
FT                   VRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQANNRKPHGKLRIDMPGSIGR
FT                   LLVIPSLCEFHTRYPDIDLQLGLSDRPVDLLQEGVDCVIRVGALQDSSLVARRVGLFEC
FT                   VTVASPDYLERHGEPQTIDDLGQHKAVNYFSSRTGRTIDWTFLIDGKEVEMKMEGIVSV
FT                   NDADAYVTCGIEGFGLIQPPLFMVLPHLREGRLKEVLPGVKPLPMPVSVVYPHSRHLSP
FT                   KVRVFVDWIAEVFDRCPLLSGKGSLDATCSKRTFEEAERAPVLDTPVINEWVA"
FT   gene            31064..32005
FT                   /locus_tag="Bcen_3013"
FT   CDS_pept        31064..32005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3013"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG:
FT                   bur:Bcep18194_B0294 esterase/lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3013"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77909"
FT                   /db_xref="GOA:A0A0H2XTS5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTS5"
FT                   /protein_id="ABF77909.1"
FT                   /translation="MLPDYRHLSQCLPDPEFVPSRNGCCIVMDASEFSKFLKAALPAQA
FT                   LTGAALTVAEVEIPGYAQDIVLRLYRRPDKTGLPVVLYFHGGGFVRGSLEDADFAARFL
FT                   AERLPALVVSVDYSLAPAFPFPAAPEDAYRAAVWAATRARAFGGNPKKIGVAGHDAGGQ
FT                   LANCLAFIARDRGEVSIAAQALFGPMLDPSMTRIGDAERLASDITARECAACYRAYLPQ
FT                   AAQRMHPYAAPIESVRLAGLPPTLVVTAQNDVLHVEAEKYAGCLISSGVLTQVIRYPDI
FT                   THAALATHEAAFEEAVRFFQCRFQARQPNRPE"
FT   gene            32044..33261
FT                   /locus_tag="Bcen_3014"
FT   CDS_pept        32044..33261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3014"
FT                   /product="secretion protein HlyD"
FT                   /note="PFAM: secretion protein HlyD; KEGG:
FT                   bur:Bcep18194_B0295 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77910"
FT                   /db_xref="GOA:A0A0H2XUL4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL4"
FT                   /protein_id="ABF77910.1"
FT                   /translation="MAILRTSRSRIATAAIVTLAVVGLGTFGAMRVNANAPEKAAAPLP
FT                   EVDVATVVPQTVTDWQSYSGRLEAVEKVDVRPQVSGTIVAVNFKDGALVKKGDVLFVID
FT                   PRPYQAEVDRAAAQLAAAQARNGYAQTDWQRAQRLIGDNAIAKRDYDEKQNAAREANAN
FT                   LKAAEAALETARINLGYTRITAPVSGRVSRAEITLGNVVSAGASAAPLTTLVSVSPIYA
FT                   SFDADEQTYLQYINGARSGRKVPVELGLANETGYSRSGEIDSVDNRLDTSSGTIRVRAR
FT                   FDNADGTLVPGLYARVKVGGSAPHEALLVDDAAINTDQDKKFVFVVDQQGRVSYREVQP
FT                   GMQHGNRRVIVSGLAAGDRVVVNGTQRVRPGAQVKPHMVPMTGGDEPSAPLASTAKPAA
FT                   PAKADS"
FT   sig_peptide     32044..32148
FT                   /locus_tag="Bcen_3014"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.986 at
FT                   residue 35"
FT   gene            33307..36492
FT                   /locus_tag="Bcen_3015"
FT   CDS_pept        33307..36492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3015"
FT                   /product="Hydrophobe/amphiphile efflux-1 HAE1"
FT                   /note="TIGRFAM: Hydrophobe/amphiphile efflux-1 HAE1; PFAM:
FT                   acriflavin resistance protein; KEGG: bur:Bcep18194_B0296
FT                   hydrophobe/amphiphile efflux pump, HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3015"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77911"
FT                   /db_xref="GOA:A0A0H2XT96"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT96"
FT                   /protein_id="ABF77911.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVIILLGGVIAMFLLPISEYPEVVPPSV
FT                   IVKAQYPGANPKVIAETVASPLEEQINGVEDMLYMQSQANSDGNMTITVTFKLGTDPDK
FT                   ATQLVQNRVNQALPRLPEDVQRLGITTVKSSPTLTMVVHLISPDNRYDMTYLRNYALIN
FT                   VKDRLSRIQGVGQVQLWGSGDYAMRVWLDPQKVAQRGLSAEDVVQSIREQNVQVAAGVI
FT                   GASPSLPGTPLQLSVNARGRLQTEDEFGDIVVKTTPDGGVTHLRDIARIELDASEYGLR
FT                   SLLDNKPAVAMAINQSPGANSLQISDEVRKTMAELKQDMPAGVDYKIVYDPTQFVRSSI
FT                   KAVVHTLLEAIALVVIVVIVFLQTWRASLIPLIAVPVSIIGTFSLLLAFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIEGGMNARQATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMSGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAILLKGHGDKEDWLTRVMNRVL
FT                   GGFFRGFNKVFHRGAENYGRGVRGVLSRKTLMLGVYLVLVGATVLVSKVVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMGSIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFSERHGKALSAGAIAGALNQKYSAMKDSFVAVFPPPPVLGLGTLGGFKMQIED
FT                   RGAVGYAKLSDATNDFIKRAQQAPELGPLFTSYQINVPQLNVDLDRVKAKQLGVPVTDV
FT                   FNTMQVYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNDKGEMVPLSSLV
FT                   TVTPTFGPEMVVRYNGYTAADINGGPAPGFSSGQAQAAVERIAHETLPRGVRFEWTDLT
FT                   YQQILAGDSAMYVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILSALTGVWLTQGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGRTPLEAAIEASRLRLRPILMTSIAF
FT                   IMGVVPLVTSTGAGSEMRHAMGVAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGKIHVAG
FT                   KDSTGYGVPAPDA"
FT   gene            36503..38044
FT                   /locus_tag="Bcen_3016"
FT   CDS_pept        36503..38044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3016"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT; PFAM: outer membrane efflux protein;
FT                   KEGG: bur:Bcep18194_B0297 RND efflux system, outer membrane
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3016"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77912"
FT                   /db_xref="GOA:A0A0H2XUN8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN8"
FT                   /protein_id="ABF77912.1"
FT                   /translation="MNNLHNTNGLMRFAKVAAASTLLATLLAACAVGPDYKRPDAAAPA
FT                   AFKEAPTLAAGEQAGTWKTAEPADGEHRGEWWKVFGDPVLDSLETQALAANQNLKAAAA
FT                   RVEEARAATRSARSQWFPQVGAGFGPTREGLSSASQFQPQGTGPTNATLWRAQGTVSYE
FT                   ADLFGRVGRNVEASRADQAQSEALFRSVQLALQADVAQNYFELRQLDSDQDLYRRTVEL
FT                   REQALKLVQRRFNEGDISELDVSRAKNELASAQADAVGVARRRAASEHALAILLGKAPA
FT                   DFAFKETPIVPVAVKIPPGLPSALLERRPDVSAAERAMAAANARIGLAKSAYFPKLDIT
FT                   GSFGYEASTLGNLFLWSSRTFLLGPFAGTALTLPLFDGGRRAAGVQQARAQYDEQVANY
FT                   RQQVLVAFREVEDNLADLRLLDDQIRAQDAAVNASRRAATLSRTQYQEGEVAYLDVIDS
FT                   ERSVLQSQLQANQLTGAQAVSTVNLIRALGGGWGNAPAPTAVGDAASGKADVAAR"
FT   sig_peptide     36503..36598
FT                   /locus_tag="Bcen_3016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.986 at
FT                   residue 32"
FT   gene            38431..38844
FT                   /locus_tag="Bcen_3017"
FT   CDS_pept        38431..38844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3017"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77913"
FT                   /db_xref="GOA:A0A0H2XSL8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSL8"
FT                   /protein_id="ABF77913.1"
FT                   /translation="MSTEWKHRVRLFVQRFWQPTTACMTCMPGSWGNITSLPHWTIAFH
FT                   TGLLTGLLAVLLTFTPVGKLYAHRYGNALVVGVLTTLGDAYSHTSHYRIPYVEHIVTGV
FT                   ISGLLALAASYLLEDRARRLRAAWARVFGQLIR"
FT   gene            complement(39037..39927)
FT                   /locus_tag="Bcen_3018"
FT   CDS_pept        complement(39037..39927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3018"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0300 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3018"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77914"
FT                   /db_xref="GOA:A0A0H2XTT1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTT1"
FT                   /protein_id="ABF77914.1"
FT                   /translation="MLTSDHIDMLLTVIDKGSFSAAARALGRTPSAVSMAIANLEAELD
FT                   LVLFDRGTREPTPTAAMAALLPDARAIAERLHALRAHAQHLSEGVEDTLRLGLAAEIDG
FT                   VPIARALTAVATKYPALAVSVVTAPQDAIVDALHRGTVDLCVAYGGLDLHPQEQIHALW
FT                   TETLIAVAAPGHPAIAEAAHPEAIERLSGFRQIVIADPERPLTDVRPLIGNRTWKVTDM
FT                   GTAIALVKAGHGWANLPESVIGRYVADGELAPLVFANIRNGLPLPVYLRRPKHTGLGKA
FT                   ASELVRALRAERADT"
FT   gene            40029..40469
FT                   /locus_tag="Bcen_3019"
FT   CDS_pept        40029..40469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3019"
FT                   /product="transmembrane pair"
FT                   /note="PFAM: transmembrane pair; KEGG: bur:Bcep18194_B0301
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3019"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77915"
FT                   /db_xref="GOA:A0A0H2XUL8"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL8"
FT                   /protein_id="ABF77915.1"
FT                   /translation="MQGWKRRIVYVVMFEVLGILVASSVLGMLSGASAATSGLLGVMIS
FT                   TTGVTVNFLYNLGFEAWERRRAETTRTVGRRVVHAIGFQVALVTFLIPLIAWWLDVSLW
FT                   QAFLYDAVLIVFFPIFTFTYNWAFDSVFGLPDAVTRKAAPVA"
FT   sig_peptide     40029..40133
FT                   /locus_tag="Bcen_3019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.924 at
FT                   residue 35"
FT   gene            complement(40572..41423)
FT                   /locus_tag="Bcen_3020"
FT   CDS_pept        complement(40572..41423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3020"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_B0304 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3020"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77916"
FT                   /db_xref="GOA:A0A0H2XTA2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTA2"
FT                   /protein_id="ABF77916.1"
FT                   /translation="MNMRIEPSVLANPDLQFATLSSGISLPYVERGSGAPMVFVHGSLC
FT                   DYRYWDPQLAALSAHYRCIAPSLSHYWPAVEAGIQDEFSWQNHVDELAEFIDALDLGPV
FT                   HLVGHSRGGSVAFNVARQHPHLVESLTLADPGGPLQQPGVREAALPAAALALRTKAVNL
FT                   IDQGDVEAGLEMFVDSVSLPGAWKKSTARFRTMAIDNASTLPKQLRDPLPAYSQHTAGD
FT                   IACRTLLIDGQRSPKMFRHNVDTLSQWIGHAQRQTVAGASHGMNAASPAVFNRYVHEFV
FT                   AA"
FT   gene            41753..42889
FT                   /locus_tag="Bcen_3021"
FT   CDS_pept        41753..42889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3021"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP2"
FT                   /protein_id="ABF77917.1"
FT                   /translation="MRSLPNPMPARVALDAFRTLFEKAEGWRVVEEIAQDHVGDLILSN
FT                   DKGQTYVANLKTFNEGRADRVTALFAQALLEARAYAKRQKMRPAILIWVGSAPPSLIQR
FT                   LADFHAEFADREPFAVLSADGTRYVRFPGLDISEHPGQSTRSYSRSRSVQPGLAFSDLN
FT                   QWMLKLLLAIDIKRENLIGAEGRRYTTATDLARAADVSVMTATRLIHALKQEGFIETKP
FT                   FLKVVQRRKLAQRWKAEYLRQAAAVPMKFLVPAAPDVQLRKVLKNEGGTLGLFAAADAL
FT                   GVGHVSGVPPTVWVPSLMEAENWRPLRRAKEGERPDLVLQQPGFPQSLGRGVVYRDGLP
FT                   VTDIIQTWLDVSAHPARGAEQAAELEHGVLVNVTGEGA"
FT   gene            42895..43731
FT                   /locus_tag="Bcen_3022"
FT   CDS_pept        42895..43731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77918"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSM2"
FT                   /protein_id="ABF77918.1"
FT                   /translation="MADFSNLAMTLAPWRARIVFIGGWAFRLYSYEPRAWKPDHKPIFT
FT                   QDADVAYAEREVLEGDIKKALESAGFKEEPNFAGGFKPPAMRYTLGKQANGFYAEFLTP
FT                   LTGSLLRRNKVTRRMEQDATEANAGVVSQKLRHLEILLHEPWLVTIPAEESGCGDALVD
FT                   LRIPNPVSFMVQKLLIRDDRIPEKRAQDVLYIHDAMLLFGGAIEDELVPVWKRLEPTLS
FT                   DAQRRSLDAGVGAFFAEVNDTIRAAADIPRPDRQIEPEDLLRLCKNGFEALFGEVP"
FT   gene            complement(43754..44083)
FT                   /locus_tag="Bcen_3023"
FT   CDS_pept        complement(43754..44083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77919"
FT                   /db_xref="InterPro:IPR021969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTT7"
FT                   /protein_id="ABF77919.1"
FT                   /translation="MDRIDITDHGRIAGHLIRGVTRAQKTFRPSDWPERLAGVITLFVG
FT                   ERRPGYPCALSRLAMPVVDGGVKCLFVSDELRAVCADAFEFAMQFAADNDLPVELQGVP
FT                   ALTVR"
FT   gene            complement(44109..45470)
FT                   /locus_tag="Bcen_3024"
FT   CDS_pept        complement(44109..45470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3024"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; SMART: ATPase;
FT                   KEGG: bur:Bcep18194_B0306 two component, sigma54 specific,
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77920"
FT                   /db_xref="GOA:A0A0H2XUM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM3"
FT                   /protein_id="ABF77920.1"
FT                   /translation="MEDEIRVLVVEDDENVRIGVEQAVALAGFPVDAFASAADALAHVA
FT                   PGAPVVIVSDVRMPGIDGLQLLDRVMAIDAQIPVVLISGHADISTAVGAMQVGAYDFIE
FT                   KPFSSDLIAGRVARAVEKRRLTLEVQGLRAALNNWQGIEAFVLGKSPAMADVRKKILRL
FT                   ADTSVSVLITGETGTGKELIARSLHDFGGRRDAHFVALNCGGLPEQVFESELFGHEAGA
FT                   FTGAIKKRIGKIEWADGGTLFLDEIETMPIALQIKMLRVLQERVVERLGANDLIPVDCR
FT                   VVAASKADLAELAADGRFRADLLYRLNVAQIELPPLRERREDVPLLFEHFVLAAARRFG
FT                   QPAPVVTAAQVSELMMHAWPGNVRELQNVADRFVLGLTGDSLLSSGGAPTAGSTLAEQL
FT                   AYFERMLIEDMLRRHNGNVADASEALGMPKKTLYHKLRNLRIPARGDAAADGGE"
FT   gene            complement(45460..47364)
FT                   /locus_tag="Bcen_3025"
FT   CDS_pept        complement(45460..47364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3025"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bur:Bcep18194_B0307 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77921"
FT                   /db_xref="GOA:A0A0H2XTB0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTB0"
FT                   /protein_id="ABF77921.1"
FT                   /translation="MRANVQKSFKGIPWWGWASAAVLYVGVAGAAVDFAWERAIDALEE
FT                   AGAHRLDLYASSLKSELGRFEILPGLVARQDGVRAMLKAAPNDAPELVHAVNTYLEAVN
FT                   RDAGSGAVDVIDLQGDVIAASNWNETISFVGTNVSYRPYFKDALARGSGRFFGIGTNTG
FT                   VPGVYFASAVRSDGVPIGVAAVKISVDPLESAWRAPGVAALVVDSNGVVVISTEPAWKF
FT                   TALRPITAQQQRDIQASRQYAGRTVDALPYRHIGDRSSAAWFGTFPDPRHAGRTTRYLV
FT                   MSRPAPQAGDSLMVLLDIAGARRQQQTAFVFVTGAFLIAALLAGYAIQRRRAILARLSA
FT                   QDALRRANDRLELTVAQRTAALTAANERMQREIDERERTEQRLRASQQEVVHAGKLAVL
FT                   GQMAAGLTHELNQPLVAIRTLCDNARTFFERGQPAPALANLERVGKLVDGMAVLTGELK
FT                   TFARKPDVERVAVSLNEAVAHARLIYDARIRDEGVRLDVNIAPGTTVSAESSQLQQVIV
FT                   NLLGNALDAVHDAPVRRIVIEAAETGDADDATNAGRVRLAVADSGAGIAPDVLPHLFEP
FT                   FVTTKPRGQGLGLGLAITSRIVEAFGARITATNRDEGGAQFTIEFAAATPQQRTEHGR"
FT   sig_peptide     complement(47272..47364)
FT                   /locus_tag="Bcen_3025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.835) with cleavage site probability 0.679 at
FT                   residue 31"
FT   gene            complement(47514..48923)
FT                   /locus_tag="Bcen_3026"
FT   CDS_pept        complement(47514..48923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3026"
FT                   /product="Citrate carrier protein"
FT                   /note="PFAM: Citrate carrier protein; KEGG:
FT                   bur:Bcep18194_B0308 citrate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3026"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77922"
FT                   /db_xref="GOA:A0A0H2XUP6"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP6"
FT                   /protein_id="ABF77922.1"
FT                   /translation="MPRSDAGIPNIRRHVLQTSIHTPSHPEPIAEAGPATRERFWPEGW
FT                   WKLMEIRIGIIPLPVYVILFGLIVGFAVTGKVPGEISMAIAVLAFFGFTCAELGKRLPL
FT                   LRNIGAAAIFATFVPSALTYYHVLPKPVLNLTVEFTKSTNFLYLFIASIIVGSILSMDR
FT                   RVLIQGFVKIFIPLAAGSVAAAIVGTAVGTALGLGARHTLLYIVVPIMAGGVGEGAIPL
FT                   SIGYSELMHLPQGEMFAMVLPPVMLGSLTAIILSGALDMLGKRLPHLTGNGRLQVGESG
FT                   DMMPENEEIRGHVDVTHIAGAGITAITLYLVGLMAHKLFGLPAPVAMLFLAVLVKLARA
FT                   VSPPLQEGAFVVYKFFSTAVTYPLLFAIGVAMTPWDKLTAAFTIVNVVTIVSTVATLMG
FT                   TGFVVGRLLKMYPIDTAIVNACHSGQGGTGDVAILTAANRMQLMPFAQIATRIGGAIVV
FT                   TVTLILVAHFG"
FT   gene            49314..50087
FT                   /locus_tag="Bcen_3027"
FT   CDS_pept        49314..50087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3027"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bur:Bcep18194_B0309
FT                   NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3027"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77923"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSM7"
FT                   /protein_id="ABF77923.1"
FT                   /translation="MLHPVFSSRFSAGRVARLARLLTAALLGVVLLNGARADTAPLKVG
FT                   ISTSPQIEALKIAAKEAKEQGLDVKIVEFTDWNTPNAALANKDIDVNYFQHIPFLENAK
FT                   KQGGYNFISIAPGTIMKIGLYSKKVKSFAELKDGARVAIANDPVNGGRGLLLLQRAGLI
FT                   TLKPGADYRATTHDIVANPKHLKIIPLEASQLARSLDDVDLAQGYPSFIKLAGTTDPNS
FT                   ALLFDGTENKNFAIQWVVRPESANDPRIRKFISIY"
FT   sig_peptide     49314..49427
FT                   /locus_tag="Bcen_3027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.960 at
FT                   residue 38"
FT   gene            50164..51576
FT                   /locus_tag="Bcen_3028"
FT   CDS_pept        50164..51576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3028"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /note="KEGG: bur:Bcep18194_B0310 flavin-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3028"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77924"
FT                   /db_xref="GOA:A0A0H2XTU2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTU2"
FT                   /protein_id="ABF77924.1"
FT                   /translation="MTTANRKKILLNAFNMNCVGHINHGLWTHPRDRSAHYTDLDYWAD
FT                   LARTLERGKFDGIFLADIVGVYDVFGGGPDAALRESVQVPVNDPLLLVPAMAQVTRHLG
FT                   FGVTANLTYEPPYLFARRMSTLDHLTKGRVGWNIVTGYLDSAARGMGLAQQIGHDDRYE
FT                   RADDYMDVVYKLWEQSWDDDAVIRDAQARVFAQPGKVRRVKHDGPFYSIDAIHLSEPSL
FT                   QRTPVLYQAGSSARGVEFAGRHAECVFVNGQSKAAARAATLDIRAAAARQGRDPASIKI
FT                   FAGVSVVTAETELLAREKFDEYRRYASPEAGLAHFASSTGIDFAKYGLDEPISYVKTDS
FT                   IQSAVDAISRKSTTGTWTVRRMLEQMSLGGRYAPIVGSPSQVADELQSWIDETGIDGFN
FT                   LTRTVMPESFEDFVDWVVPELQNRGVYKEDYDPAPTLREKLFGVGPRLPAWHTGAQHRP
FT                   AAAAEPAHPAHA"
FT   gene            51595..52779
FT                   /locus_tag="Bcen_3029"
FT   CDS_pept        51595..52779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3029"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0311 ABC metal ion transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3029"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77925"
FT                   /db_xref="GOA:Q1BR30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BR30"
FT                   /protein_id="ABF77925.1"
FT                   /translation="MTQLFDTLGFIEASAVRAGAGADAVAHEEAVTPVGGAAVSLEQVG
FT                   KVFATPRGQAAALRDVTLDVRRGEVFGIIGRSGAGKSTLLRLLNGLERPSSGRVRVQGV
FT                   DVGALDEDGLVALRRRTGMVFQHFNLLSAKTVFENVALPLKIAGVPKAERVRKVEALLE
FT                   LVGLAAKRDAYPASLSGGQKQRVGIARALVHDPEVLLCDEATSALDPETTQSILALLAD
FT                   INRRLGLTIVLITHEMEVIRAVCDTVAVIEQGEVVETGPVWRVFGDPRHGATRALLSTL
FT                   QHDLPAELAARVRPLPEQAALPDGAQIVLDVRYTGESGGEPDVGALAAALGGSVRFLHG
FT                   GIESIQGHAQGRLVIAATPRADDAGPSTARGGAVAALLERARRHANHAEVLGYV"
FT   gene            52772..53428
FT                   /locus_tag="Bcen_3030"
FT   CDS_pept        52772..53428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3030"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0312 ABC
FT                   metal ion transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3030"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77926"
FT                   /db_xref="GOA:A0A0H2XUM8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM8"
FT                   /protein_id="ABF77926.1"
FT                   /translation="MFDLWWPELLDAIRDTLSMVAASAAIAALIGIPLAVILVTTAPGG
FT                   IYARRGVNAVLGALVNVFRSTPFIILLVALLPFTRVLIGTTIGVWAAVVPLSIAAIPFF
FT                   ARIAEVSLREVDRGLIEAALAMGAKRRHIVWHVLLPEALPGMLGGFTITVVALIGSTAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTTVMATVIVILIALVSAVQITGDRLVRRVTRRT"
FT   gene            53480..54322
FT                   /locus_tag="Bcen_3031"
FT   CDS_pept        53480..54322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3031"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTB5"
FT                   /protein_id="ABF77927.1"
FT                   /translation="MTLPIGAPREWNGQFEEALFLEVARRHRPDFPDKVATPPREPCNG
FT                   DELAAVADYYTKMASHDLFIVQVVAKAIDTLFRDDPHFQLILSRQLGDDGAHAVIGRER
FT                   VTELTGRDPLPEVDRLVAAHWARIGDIAVRDVAGFLAFEWHYELHILAKLWIQRKTGRI
FT                   GDSAMREHGENRIRPDEEWHRVQIVQWWFDTLQALPAAERDALIDRVIAADEETQARLD
FT                   GYLHDEYAHTALVFGADIAEYRAIYDDWRREILSRLTGRQLGALVPLSGETVEQEAVA"
FT   gene            54319..55530
FT                   /locus_tag="Bcen_3032"
FT   CDS_pept        54319..55530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3032"
FT                   /product="Acyl-CoA dehydrogenase, type 2-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   bur:Bcep18194_B0314 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3032"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77928"
FT                   /db_xref="GOA:A0A0H2XUQ0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ0"
FT                   /protein_id="ABF77928.1"
FT                   /translation="MNDPRGPATLAPDTDAPAVDRAALARAIDALRVSAAERDRAGGHA
FT                   AREKQWLADAGLLTLAVPRAFGGQEAAWPEIYDAIRQVARVDSALAHLVGFQCLQVVSV
FT                   DVWGNAAQRERYLRGTVDRRWWWGNAVNPLDTRLVATATPDGGYRLDGVKGFCSGTRGS
FT                   QRMTVSAHDPAIGRTVFGVVPTDRAGITVNDDWDPVGQRQTDSGSVRFDGVTLAPDEVL
FT                   HRSEAPPTPRATLRTLVSQLVLTNLFVGLAEGALAEARDYVRQHGRPWIHSDVERAEDD
FT                   PYTLQRFGDMRVRAIAAAALADRAANTLQHAWARQDALTADERAEVALAVSEAKIVAQR
FT                   AALDNGEALFDACGARATAASLGLDRFWRNARTHTLHDPLDYRLRDVGRYALTGELPPA
FT                   SLYT"
FT   gene            complement(55547..56356)
FT                   /locus_tag="Bcen_3033"
FT   CDS_pept        complement(55547..56356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3033"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSN1"
FT                   /protein_id="ABF77929.1"
FT                   /translation="MKNKTLATLLLCAAAPGIALAQSIAAPALKPGDTWTYVDTVEIGP
FT                   NGWRQTRDEITVQRTTPGHIYVESRQSGATQAPHEMIVDADWSRARSINGTETVVNRPL
FT                   AFPLTIGKTWTIQYSESHPNPQHASEAYDTHYKVVGHETVTVTGGKFDAIKIEAEGSWK
FT                   AQSAPGQSITSGVSRNAGGSTIVVQSRNNGTAEGTGKTYKAFWYVPAVGRWVKSVEEYY
FT                   DTNGMRTARYSDELASYKRAGADGSAPLAGGPAPASVAPDGPPPGDQ"
FT   sig_peptide     complement(56291..56356)
FT                   /locus_tag="Bcen_3033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            56463..57734
FT                   /locus_tag="Bcen_3034"
FT   CDS_pept        56463..57734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3034"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /note="PFAM: cobalamin synthesis protein, P47K; KEGG:
FT                   bur:Bcep18194_B0316 cobalamin synthesis protein/P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3034"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77930"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTU8"
FT                   /protein_id="ABF77930.1"
FT                   /translation="MLYRSDTIYHFISNVLFRNRPMNPALHPSTRLPVTVLSGFLGAGK
FT                   TTLLNHILNNREGRRVAVIVNDMSEVNIDAALVRDGGAGLSRTDEKLVEMSNGCICCTL
FT                   REDLLIEVDRLAREGRFDQLVIESTGISEPLPVAETFTFEGEDGRSLGEVARLDTMVTV
FT                   VDAFNFLRDYASRDSLQARGESMGDEDARTVVDLLIDQIEFCDVLVINKIDLIDASARE
FT                   RLIALLRGLNPRARIEIAEFGKVPLERVLDTGLFDFDAASRAPGWLQELRGTHTPETDE
FT                   YGIRSFVYRARRPFHPQRFFDLVESEWPGVVRSKGFFWLATHPTVAGSWSQAGAVARHG
FT                   PAGHWWAAVPPERWPRDAEAVAQIRARWDEHVGDARQELVLIGMDMDEPALRARFDACL
FT                   LTDAEMAAGPEHWTTWDNPFRDWA"
FT   gene            57763..58713
FT                   /locus_tag="Bcen_3035"
FT   CDS_pept        57763..58713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3035"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   bur:Bcep18194_B0317 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3035"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77931"
FT                   /db_xref="GOA:Q1BR24"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BR24"
FT                   /protein_id="ABF77931.1"
FT                   /translation="MEKALHRISSMNAALPDISLTDAAPGRRPLEWVGMQGIDLPVVVA
FT                   EPGCRRDVHARADVQVDLPAPQVKGIHMSRLYGLLDGLADGEALSPAGLQRMLRAMVDS
FT                   HRDCETRSARVRLRFDLLARRTALVTEGLAGWKAYPVRLDATLAGDAFALRAQVTVVYS
FT                   STCPCSAALSRHWIEQAFLTAFGHEARVEPTAVAAWLKRHAMAATPHSQRSEAVVSVAL
FT                   PADGTTLGLLDLIDRVEQALGTPVQTAVKRADEQAFAVLNGGNLMFVEDAARRVQAALE
FT                   DRHASPRVRVRHLESLHPHDAVAWAAPLREGADAC"
FT   gene            58707..59285
FT                   /locus_tag="Bcen_3036"
FT   CDS_pept        58707..59285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3036"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase-like
FT                   protein"
FT                   /note="KEGG: bur:Bcep18194_B0318
FT                   6-pyruvoyl-tetrahydropterin synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3036"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77932"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN3"
FT                   /protein_id="ABF77932.1"
FT                   /translation="MLIRKLFRFENAHVVRGCSTRRCSHSIHGHSYRVELLLEAHALDH
FT                   GQMIYDFGLLKGDVRDLIDAFDHAVTLWSDDDPRYVESMRRHSERWVRLPVSPSAEQFS
FT                   RVFFRLVDAALCGTRMSNGEADVRLHSVIVHETETGYAQCFRDDAFNPRMGRIDLDAIV
FT                   FAPAIVAQWRDPGLFERLKRGHTLSRQKS"
FT   gene            59285..59845
FT                   /locus_tag="Bcen_3037"
FT   CDS_pept        59285..59845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3037"
FT                   /product="Carbonic anhydrases/acetyltransferases isoleucine
FT                   patch superfamily-like protein"
FT                   /note="KEGG: bur:Bcep18194_B0319 carbonic
FT                   anhydrases/acetyltransferase isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3037"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77933"
FT                   /db_xref="GOA:A0A0H2XTC0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC0"
FT                   /protein_id="ABF77933.1"
FT                   /translation="MIRKNPRGDLPHIHPNAFVDPTAILCGRVIVEENVFIGPYAVIRA
FT                   DETDADGQIAPIVIGAHSNIQDGVVIHSKSGASVTIGRHTSIAHRAIVHGPCMVGDGVF
FT                   VGFNSVLFNCTIDDGCVVRYNAVVDGCHLPPGFHVRSTERIGPETDLAALPQVTADASE
FT                   FSEDVARTNNALVLGYKQIQNEF"
FT   gene            59849..61219
FT                   /locus_tag="Bcen_3038"
FT   CDS_pept        59849..61219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3038"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.5"
FT                   /note="KEGG: bur:Bcep18194_B0320 dihydroorotase
FT                   multifunctional complex type TIGRFAM: dihydroorotase,
FT                   multifunctional complex type; PFAM: amidohydrolase;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3038"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77934"
FT                   /db_xref="GOA:A0A0H2XUQ6"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ6"
FT                   /protein_id="ABF77934.1"
FT                   /translation="MGERLRQEAGDRSTRRHADLLVHGGTVMTPNGAERIDVACMGGRV
FT                   VALGALHGTWSADVLLDARGLHVLPGVVDSQVHFREPGLTHKETIEAGTRGAVLGGVTT
FT                   IFEMPNTHPLTLDEQDLSAKLDLARGRAWCDYAFYIGGSAVNAERLPVLERLPGCAGVK
FT                   VFMGSSFGDLLADDETVLRRILRHGRRRMAVHAEDEARLRERKSIAEASGDVRDHPRWR
FT                   DAESALAATRRIVGLAAETGRRLHVLHVSTADEMALLARHRRRVTVEVTPHHLSLHAPD
FT                   CYERLGTFAQMNPPVRERHHRDALWQAVSDGVVDVIGSDHAPHTRDEKRRPYPQSPSGM
FT                   TGVQTLLPLMLDHVQAGRLSVERLVDLTSAGPARVFGIEGKGRIAAGYDADFSIVDLRA
FT                   RRIIRDEWIASVSGWTPYDGRAVTGWPVHTVVRGQVVVRDEALNGQPAGEAVTFLDP"
FT   gene            complement(61216..61680)
FT                   /locus_tag="Bcen_3039"
FT   CDS_pept        complement(61216..61680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3039"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   bur:Bcep18194_B0321 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3039"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77935"
FT                   /db_xref="GOA:A0A0H2XSN6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSN6"
FT                   /protein_id="ABF77935.1"
FT                   /translation="MPIKLDAIDRRILRALQQNSNQTNADIAQQAGLSPTPCLRRVHLL
FT                   EEQGVIDAYVALLNPAAVELRFTAFVRVTLERQDKTTVERFAREMEHAPEVLECHLMAG
FT                   SYDYLLRVIAKDLDNYQRFQMETLTQIEGVRNIETEIPLKRIKQTVRLPI"
FT   gene            61849..62475
FT                   /locus_tag="Bcen_3040"
FT   CDS_pept        61849..62475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3040"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0322 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77936"
FT                   /db_xref="GOA:A0A0H2XTV3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV3"
FT                   /protein_id="ABF77936.1"
FT                   /translation="MSHVAWLPFMATSLLIILTPGQDMVLVMSRTLSGGTRAGLVTAAG
FT                   VSVGLLVHTMLATLGLGALLQASEWLFTALKVVGALYLLYLGITLLRSSGELTLAGDGT
FT                   APASRLRTFAQGALSNVSNPKVALFYLAFLPQFVPAGAPHPMLSLFVLGATFAGLTFLV
FT                   KGPVALFAGLLSASIRRNPRILTRMHRVSGVVLLALGVKLALERR"
FT   gene            complement(62508..63356)
FT                   /locus_tag="Bcen_3041"
FT   CDS_pept        complement(62508..63356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3041"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif; KEGG:
FT                   bur:Bcep18194_B0324 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3041"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77937"
FT                   /db_xref="GOA:A0A0H2XUN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN7"
FT                   /protein_id="ABF77937.1"
FT                   /translation="MNSTAALHAPSPSAGRASGIGPLLRTWRQRRRLSQMALALDADVS
FT                   ARHLSFVESGRAQPSREMVLHLAERLDVPLRERNALLVAAGFAPLFRERPFSDPQLDAA
FT                   RHAVEAVLRGHEPYPALAVDRHWTLLAANRMLGTLVAQADPALLQPPVNVLRLSLHPDG
FT                   LASQIVNWHEWRAHILHRLQRQIDASGDRTLHALRDELAAYPAPAGQPDDSHTRTDFAD
FT                   IAVPLRLRTASGELTFFSTTTVFGTPVDVTLSELAIEAFFPANPETVEAMRALADALPV
FT                   A"
FT   gene            63494..64513
FT                   /locus_tag="Bcen_3042"
FT   CDS_pept        63494..64513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3042"
FT                   /product="uncharacterized membrane-anchored protein"
FT                   /note="KEGG: bur:Bcep18194_B0325 uncharacterized
FT                   membrane-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3042"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77938"
FT                   /db_xref="GOA:A0A0H2XTC4"
FT                   /db_xref="InterPro:IPR018682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC4"
FT                   /protein_id="ABF77938.1"
FT                   /translation="MPGPDAAHIDNKAFQGNPTMKKLAVRLACVATLALAATSGHAQTE
FT                   AAQVEMRAAAAAANEAVVKGPTDIDVKHEAVLKLKAGESFVPAAEAGRYLRSMGNSIDE
FT                   AKLVGLVLPDDPDADWISVVSFEPSGYIRDDDAKDWKPDELLKSLQAGTEENNPARKER
FT                   GLPETEVVGWAKAPAYDAATHRLVWSAIIRDKGAAPNAANDGVNYRTLVLGRDGYLSLT
FT                   MASTLADLPKYQPSADALLSNIRFNDGKRYADFNQSTDHVAEYGLAALIVGVGAKKLGL
FT                   LALIGAFAVKFFKIGAVALLAGGAALKRFFGRKPKAAAAPAVADATAASDTAATERKE"
FT   sig_peptide     63494..63622
FT                   /locus_tag="Bcen_3042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.861 at
FT                   residue 43"
FT   gene            64510..65235
FT                   /locus_tag="Bcen_3043"
FT   CDS_pept        64510..65235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3043"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: bur:Bcep18194_B0326
FT                   peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77939"
FT                   /db_xref="GOA:A0A0H2XUR0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR0"
FT                   /protein_id="ABF77939.1"
FT                   /translation="MTKLLLLIFGGLKLGKVLVSAGTMLASIAVYALFYGWRFAAGFVA
FT                   LLLVHEAGHYVAAQRRGLDVGLPTFIPFVGAWIQLKEMPHDAETEAYVGLAGPFVGTLG
FT                   ALACYAAARHTDSNLLLALSYTGFFLNLFNMIPLSPFDGGRITAVLSPRIWLVGVPVLI
FT                   ALFVYRPSPLLIVMAILALPQLKRAWRYDPDAPENRVYYATSIETKTTYALCYVGLLAF
FT                   LALMTSGVHDMLRAVHAST"
FT   sig_peptide     64510..64608
FT                   /locus_tag="Bcen_3043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.717) with cleavage site probability 0.657 at
FT                   residue 33"
FT   gene            complement(65302..66696)
FT                   /locus_tag="Bcen_3044"
FT   CDS_pept        complement(65302..66696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3044"
FT                   /product="D-galactonate transporter"
FT                   /note="TIGRFAM: D-galactonate transporter; PFAM: General
FT                   substrate transporter; KEGG: bur:Bcep18194_B0327
FT                   D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3044"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77940"
FT                   /db_xref="GOA:A0A0H2XSP1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSP1"
FT                   /protein_id="ABF77940.1"
FT                   /translation="MSNQTSPRDLPLDLARTARRTAVRYWILAMLFVVTTLNYADRATL
FT                   SITGTPIRKAFGIDPVTMGYIFSAFSWAYVLAQLPSGWLLDRFGARRVYAASIFLWSAF
FT                   TLLQSTIGLGGSAAFAVAALFAMRFAVGIAEAPAFPANAKVVASWFPTAERGTASAIFN
FT                   AAQYFAAVVFSPLMAWLTHAYGWHQVYLWLGLAGIALAFLWLRVVKDPADHPAVNRAEL
FT                   DHIEQGGGLVRSTGGATGARGSGGGASEGSRVAGWYYVRQLLSNRMLIGVYLGQYCVNV
FT                   LTYFFLTWFPIYLVQARGMSLLKAGFMTSLPAICGFLGGVLGGMLSDALIRRGVSLTLA
FT                   RKIPIVGGMLLSMVIIGCNYVDSEALVIMLMAVSFFGKGIGSLGWAVVADTAPKEAIGL
FT                   SGSLFNMFGNTAGIVAPIAIGYLVGASGSFNGALVFVGLNALVTVFSYLVIVKDIKRVE
FT                   LRHRDA"
FT   gene            66944..68521
FT                   /locus_tag="Bcen_3045"
FT   CDS_pept        66944..68521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3045"
FT                   /product="2,5-dioxopentanoate dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.-"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0328 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3045"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77941"
FT                   /db_xref="GOA:A0A0H2XTY6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTY6"
FT                   /protein_id="ABF77941.1"
FT                   /translation="MQLTGEMLIGAEAVAGSAGTLHAFDPTKGAPIEAPAFGVATQADV
FT                   DRACELARDAFDAYRTQPLAARAAFLEAIADEIVALGDALIERAHAETGLPVARLQGER
FT                   GRTVGQLRLFARVVRDGRFLAASIDPAQPARTPLPRSDLRLQKIALGPVAVFGASNFPL
FT                   AFSVAGGDTASALAAGCPVIVKAHEAHLGTSELVGRAIRAAVAKTGMPAGVFSLLVGPG
FT                   RVIGAALVSHPAVQAVGFTGSRQGGMALVQLANARPQPIPVYAEMSSINPVVLFPAALA
FT                   ARGDAIATGFVDSLTLGVGQFCTNPGLVLAIDGPDLDRFETVAAQALAKKPAGVMLTRG
FT                   IADAYRNGRGKLAELPGVREIGAGEAAQTDCQAGGALYEVGAQAFLGEPAFSHEVFGPA
FT                   SLIVRCRDLDEVARVLDALEGQLTATLQMDADDKPLARRLLPILERKAGRLLVNGYPTG
FT                   VEVCDAMVHGGPFPATSNPAVTSVGATAIERFLRPVCYQDFPDDLLPEGLREGNPLAIP
FT                   RLRDGKAE"
FT   gene            complement(68649..69020)
FT                   /locus_tag="Bcen_3046"
FT   CDS_pept        complement(68649..69020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3046"
FT                   /product="PilT protein-like protein"
FT                   /note="PFAM: PilT protein-like; KEGG: bur:Bcep18194_B0329
FT                   PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3046"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77942"
FT                   /db_xref="GOA:A0A0H2XUS5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUS5"
FT                   /protein_id="ABF77942.1"
FT                   /translation="MILVDTSVWIDHLRAGDATLTALLEAERVLIHPFIVGELALGSMR
FT                   HRETVLDALRDLPAATLATDDEVQRMIDAVPLHGLGIGYVDAHLLASARLTSDSRLWTR
FT                   DRRLLAAAERLQLVARPAH"
FT   gene            complement(69017..69214)
FT                   /locus_tag="Bcen_3047"
FT   CDS_pept        complement(69017..69214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3047"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77943"
FT                   /db_xref="InterPro:IPR019239"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTG0"
FT                   /protein_id="ABF77943.1"
FT                   /translation="MRTTLSLDDALLAKAQQLTGVTEKSALVREALRALIARESARRLA
FT                   RLGGTEPDLESVPRRPSEPA"
FT   gene            69400..69954
FT                   /locus_tag="Bcen_3048"
FT   CDS_pept        69400..69954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT0"
FT                   /protein_id="ABF77944.1"
FT                   /translation="MNISKRGDHLFAAGLWKAIGDVAKSVRTQIGETSEGRVLADALFA
FT                   LQRELGGSEFDVTINQGRPVAGSDPHSVIFGRAVERFKQDMEAVVFALKHRRSIDGPNG
FT                   AERADALTQANTHLATAKQYAMFTVGRFFDAVVDRDVLEQIVGAESPARGRPLAARKGI
FT                   DETQRTLTGVRQRIIGAIAQM"
FT   gene            complement(70069..70983)
FT                   /locus_tag="Bcen_3049"
FT   CDS_pept        complement(70069..70983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3049"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bur:Bcep18194_B0332 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3049"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77945"
FT                   /db_xref="GOA:A0A0H2XSS1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSS1"
FT                   /protein_id="ABF77945.1"
FT                   /translation="MTSPQELKQIISHGLLSFPLTDFDADGSFRPSTYAERLEWLAPYG
FT                   ASALFAAGGTGEFFSLTQREYSDVIRVATETCKGKVPILAGAGGATRVAIEYAQEAERL
FT                   GASGVLLMPHYLTEASQEGIADHVEQVCRALKIGVVVYNRANSKLNADMLERLADRCPN
FT                   LIGFKDGVGEIESMVTIRRRLGDRFAYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPK
FT                   TAMAFYEAIAKDDHATVGRLIDEFFLPYLKIRNRRAGYAVSIVKAGAKLVGHDAGPVRA
FT                   PLVDLTDEEAAELDVLIKKMGPQ"
FT   gene            71213..72766
FT                   /locus_tag="Bcen_3050"
FT   CDS_pept        71213..72766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3050"
FT                   /product="galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate
FT                   hydrolase-like; KEGG: bur:Bcep18194_B0333 galactarate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3050"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77946"
FT                   /db_xref="GOA:A0A0H2XTZ1"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTZ1"
FT                   /protein_id="ABF77946.1"
FT                   /translation="MTASPLYIRVHPDDNVAIVVNDGGLPAGATFADGLTLGEGVPQGH
FT                   KVALVDLAAGDPVIRYNVVIGYALTDLRRGSWVNERTMRMPEPPGLDDLPLATRAAPPL
FT                   EPLEGYTFEGFRNADGSVGTRNILAITTTVQCVSGVVEHAVKRIKDELLPRYPNVDDVV
FT                   GLEHTYGCGVAIDAPDADIPIRTLRNISLNPNFGGEVMTVSLGCEKLQPERLLPPGAIP
FT                   VTADGATDNGGVVCLQDAAHVGFNSMIDSIMTMAESHLERLNRRRRETCPASDLVVGVQ
FT                   CGGSDAFSGLTANPAVGFAADLLVRAGATIMFSEVTEVRDGVAQLTSRAANEEVAREII
FT                   REMDWYDRYLERGRVDRSANTTPGNKKGGLSNIVEKAMGSIVKSGSAPIAGVVRPGDRA
FT                   RQKGLLYAATPASDFICGTLQLAAGMNLHIFTTGRGTPYGLAQVPVIKVATRSDLARRW
FT                   HDLMDLDAGQIATGAATIEDTGWALFRLMLDVASGKRRTWAEQWKLANALTLFNPAPVT
FT                   "
FT   gene            complement(72852..73334)
FT                   /locus_tag="Bcen_3051"
FT   CDS_pept        complement(72852..73334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3051"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   cps:CPS_4919 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77947"
FT                   /db_xref="GOA:A0A0H2XUS8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUS8"
FT                   /protein_id="ABF77947.1"
FT                   /translation="MNSIAAPLDDFDLRILARLQHDNQITNQALAAEIGLSPPACLRRV
FT                   KRLRDERYIQQDVAVVDPNKVGLPLTMLVLVQVERERVDLLDEFKRFLKSLPEVMQCYV
FT                   VTGRADFVLMIAMRDIDHYEEFSTRVFRQHHNIRHFETMVVMSRVKVGLSLPIGIE"
FT   gene            73461..74591
FT                   /locus_tag="Bcen_3052"
FT   CDS_pept        73461..74591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3052"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   eba:ebA3175 putative amino acid ABC transporter; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3052"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77948"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTG7"
FT                   /protein_id="ABF77948.1"
FT                   /translation="MRSRHLLLALAPLVLAVSAFGADTVVVGFAGALTGAQAHFGEDSA
FT                   RGIRLAIDEINAGHPSVAGHPVTFALDAQDDQADPKVATTVAQRFVDTHVSAVIGHQNS
FT                   GTSIAVARLYATANIAELTPSATNPEFTRLGYRTTFRLLANDDFLGQAVARYAVEQLHA
FT                   RRIGVVDDRTAYGQGIADVFVGGLGASGATVVAREYTTDKAFDFGAPLTLLKGKAPDAI
FT                   FFGGMDTQGGPMLKQMRKLRIAAPLLGGDGLCTHEILKLAGDALDGNLVCADGGRSLAK
FT                   MPGGPAFAARFTQKYGAPVQLYAPYAYDAMMAVYHAVMLAQSTDPAKIVDALHRVDFQG
FT                   VTGRIAFDARGELRNPAATISTFKGGNKVTLSEVVK"
FT   sig_peptide     73461..73526
FT                   /locus_tag="Bcen_3052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            74588..76078
FT                   /locus_tag="Bcen_3053"
FT   CDS_pept        74588..76078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3053"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: formylmethionine deformylase; KEGG:
FT                   mlo:mlr1594 branched-chain amino acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3053"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77949"
FT                   /db_xref="GOA:A0A0H2XUT6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT6"
FT                   /protein_id="ABF77949.1"
FT                   /translation="MNTRILPVGTASLRDVARPVDDVGTPAVREAASALRAALRAFRDE
FT                   HGFGRAVAAPQIGIGQRMIALALDGWPDVIVNPEIVWRSDARMTLWDDCMCFPDLFVRV
FT                   ERHASVSVRYTTLDGEPHQRDALSPDVSELMQHEIDHLDGKLSFDRATGPNAVVHRSVF
FT                   DADRASFAAQVDYTPNVPRETRSAHHGIPSVEAPAFPQGAAYMNGRFIPIADARVSVLD
FT                   WGFLHSDVTYDTVHVWNGRFFRLDKHIERFRRSLARLRLNVPLTDDALRDILVECVRRS
FT                   GLRHAYVEMLCTRGVSPTFSRDPRDAVNQFIAFAVPYGSVANERQLREGLHLHVIDDVR
FT                   RIPPESVDPQIKNYHWLDLVAGLLKGYDAGAESVLLKCTDGSIAEGPGFNVFVVRDGRL
FT                   RTPERGVLHGITRQTVFELATAMGIDAQAARIDDAQLRDADEVFITSTAGGIMPVTRLN
FT                   DATIGDGRPGPMTRRLFDAYWAKHGDPAWSLAVDYADG"
FT   gene            76213..76605
FT                   /locus_tag="Bcen_3054"
FT   CDS_pept        76213..76605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77950"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSS6"
FT                   /protein_id="ABF77950.1"
FT                   /translation="MNTAQTASSVHADLIDRYFDAWNEPDAARRRELIDATYASDAAYR
FT                   DPLMAGDGHAGIDTMIAAVQQRFPAYRFRRTTDVDAFGQHLRFSWALVSPDGAAIVKGS
FT                   DFGTVDASGRLASVTGFIDEMPAAAS"
FT   gene            76618..77139
FT                   /locus_tag="Bcen_3055"
FT   CDS_pept        76618..77139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3055"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG:
FT                   bur:Bcep18194_B0335 RbsD or FucU transport associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3055"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77951"
FT                   /db_xref="GOA:A0A0H2XTZ5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTZ5"
FT                   /protein_id="ABF77951.1"
FT                   /translation="MHHGRRDRVTLCDSFLIPETTDMLKNLDPLLHADILHTLRAMGHG
FT                   DEIAICDANFPAESVAEHTVVGRALRVDGADSARVVRAVLSVLPLDTFVDTPAWRMEVV
FT                   GDAAAVPPVQREVQAEIDRAEGRAVPLTGVERFAFYERAQQAYAVIVTGETRGYGCFIF
FT                   KKGVLLSDAG"
FT   gene            77327..77764
FT                   /locus_tag="Bcen_3056"
FT   CDS_pept        77327..77764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3056"
FT                   /product="DoxX"
FT                   /note="PFAM: DoxX; KEGG: bur:Bcep18194_B0336 DoxX family
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3056"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77952"
FT                   /db_xref="GOA:A0A0H2XUT2"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT2"
FT                   /protein_id="ABF77952.1"
FT                   /translation="MTRTVDSGVIFFARLALAALFLWGGIMKLLGYSDFIAYLHGMNVP
FT                   YQQVVGPIVVAIEGLGGLLLIVGYKVRPLALLMAVYTIATAMVGHNFWDATNAAVQHDM
FT                   VIHFWKNVAIAGGFLLLFVTGAGGASIDALRRPSSSYGVLR"
FT   gene            complement(77868..79244)
FT                   /locus_tag="Bcen_3057"
FT   CDS_pept        complement(77868..79244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3057"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0337 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3057"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77953"
FT                   /db_xref="GOA:A0A0H2XTH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTH2"
FT                   /protein_id="ABF77953.1"
FT                   /translation="MPKSGPWRRSTNNYIRKPIVLTMQASELSGVPRAAERALTRSDYK
FT                   TLGLAALGGALEFYDFIIFVFFAPAIGQLFFPHDIPDWLRQLQTFGIFAAGYLARPLGG
FT                   VIMAHFGDLFGRKRMFTLSVLMMSVPTLLMGLLPTYDTIGILAPVLLLLFRVLQGAAVG
FT                   GEVPGAWVFVSEHVPSRHIGYACGTLTAGLTAGILLGSLVAAGINSRYSAAEVGAFAWR
FT                   IPFLLGGVLGLFSVYLRRWLHETPVFAEMKAKKALAAEIPLKAVLRDHGRAVIVSMLLT
FT                   WMLSAAIVVVILMTPALLQKQFHLTPATTLFANSIATLCLTAGCITAGSLAGWIGAKRV
FT                   LAIGGIGLAACYYLLFVQVAADASTLPLYYGIAGFMVGTIGAVPFVMVKSFPAVVRFSG
FT                   ISFSYNVAYAIFGGLTPVIVSLMMKSNPLAPVVYVAAICVLGAIAVQFSKDAKDVKGTH
FT                   "
FT   gene            complement(79500..80678)
FT                   /locus_tag="Bcen_3058"
FT   CDS_pept        complement(79500..80678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3058"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B0339 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77954"
FT                   /db_xref="GOA:A0A0H2XUU1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU1"
FT                   /protein_id="ABF77954.1"
FT                   /translation="MPAAAQPRHQGEVKVKLKVSHVALAAACALSGAHAVAADVVKIGF
FT                   AAPLTGPQSNYGTDMQKGVQLAIADFNATHPTIGGKPVTFQLDSQDDQADPRTGTTVAQ
FT                   RLIDDNVRGIIGHFNSGTSIPASDLYDRAGLPQISMATSPQYTARGYKTTYRLLTSDAQ
FT                   AGRIVGTYAVKTLRFKRIAIIDDRTAYGQGIADEFAKAVEAAGGTIVKRDFTNDKALDF
FT                   SAILTNLKGVNPDAVFYGGGDAQSSPMIRKMRQLGMKSAFVTGEMSRSPTFLKVGGDAA
FT                   EGAIVYMGGLPKEKMPGFSGYAARYKARFNEDVITYSPYSYDGTIALLTAMKDANSTDP
FT                   KVYTPYLGKVSIKGVSAPSIAYDPKGDLKDAPVTIYKVERGAFKPVDTIAGN"
FT   sig_peptide     complement(80565..80678)
FT                   /locus_tag="Bcen_3058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.694 at
FT                   residue 38"
FT   gene            complement(80862..81113)
FT                   /locus_tag="Bcen_3059"
FT   CDS_pept        complement(80862..81113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3059"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77955"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XST0"
FT                   /protein_id="ABF77955.1"
FT                   /translation="MHATASQYLRGRRPFRFRHGRRSASTHRHHAPGLAILKMPAPRVL
FT                   AGLRIRHDDFGIYQGNRRYADIVAGHASNAQDACIFAP"
FT   gene            81256..82050
FT                   /locus_tag="Bcen_3060"
FT   CDS_pept        81256..82050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3060"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0341 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77956"
FT                   /db_xref="GOA:A0A0H2XU00"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU00"
FT                   /protein_id="ABF77956.1"
FT                   /translation="MTTLLAVPPMSLSDTLRDPPDNADFGAMLAHFRLLEPVFDALPDV
FT                   AFFVKDASGRYALVNRTLAMRCGYKDKRDLLGKTADEVFPRRFGRSYFEQDMATINAGQ
FT                   QLMDQLELHLYPGRQPGWCLTCKEPLRDAAGGVVGLAGISRDLKAHEGSHPAYSRLADV
FT                   VQHIQDHYVQPLNLKQLAQMAGMSVAQLERYFHKVFHLTPRQVLLKTRLDAATALLVTH
FT                   DKVTDVAALCGYTDHSAFTRQFKATVGVTPTEYRLMLQERAG"
FT   gene            complement(82136..82399)
FT                   /locus_tag="Bcen_3061"
FT   CDS_pept        complement(82136..82399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3061"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77957"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT5"
FT                   /protein_id="ABF77957.1"
FT                   /translation="MSAVEAPAGRPAAPPAKKTMLRRLLSHHEIATLLVLLHAPIGANA
FT                   KPELPALQEAGLVEMVKLDPDTAPSFRLTEDGTAVLKGLGYR"
FT   gene            complement(82682..84574)
FT                   /locus_tag="Bcen_3062"
FT   CDS_pept        complement(82682..84574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3062"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B0343
FT                   4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77958"
FT                   /db_xref="GOA:A0A0H2XTH9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTH9"
FT                   /protein_id="ABF77958.1"
FT                   /translation="MQRSIATVSLSGTLAEKLAAVQAAGFDGVEIFENDLVYFDGSPAD
FT                   VRRMAADLGLDIVLFQPFRDFEGVSPAQLARNLDRIKRKFDVMHALGTDRILVCSSVAA
FT                   DTIADDGLLVDQLGVLAEAARQAGVVAAYEALAWGRVVKRYGHAWKLVNAVNSPHLGLA
FT                   LDSFHTLSLDDSPDGIADIPGDRIAFVQIADAPKLVMDVLEWSRHYRSFPGQGDFDLAR
FT                   FTARVIESGYTGPLSLEIFNDGFRAAPTALTAADGHRSLLYLEDLTRARLAQEGRAPAA
FT                   SQPLFAPPAPPAHVGFQFIEFAVDAQAAATVGEWLGRMRFRLAGRHRSKDVTLFQHGAA
FT                   SIVLNAERDSFADAFFQQHGLSLCASAFRVDDANVAFERAAGFGYAPFSGRVGPNERVL
FT                   PSVKAPDGSLEYFVDEAPDTPTLYESDFVLTDIDGPTEVGPLTGIDHVCLALPADALDT
FT                   WILFFKTAFGFEAERSWLVPDPYGLMRSRAVRSADGSVRIALNASVDRHTAVAESLDRY
FT                   HGTGLNHVAFRTDDIVKTVAAFAADGVPFLRIPANYYDDLAARYALPDELIDTLSAHHL
FT                   LYDRDEHGGEFLHAYTELVDNRFSLEIVERRGGYDGYGAANAAVRLAAQAQRRK"
FT   gene            84832..85287
FT                   /locus_tag="Bcen_3063"
FT   CDS_pept        84832..85287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3063"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: bur:Bcep18194_B0344 3-dehydroquinate
FT                   dehydratase TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3063"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77959"
FT                   /db_xref="GOA:A0A0H2XUU5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU5"
FT                   /protein_id="ABF77959.1"
FT                   /translation="MSKHKVLVLNGPNLNLLGTREPHIYGAETLADLEQRCRTAAEGLG
FT                   LEIEFRQSNAEHQLIDWLHAARHDTHGIVINPAAYTHTSVALADALSAIAKPVIEVHIS
FT                   NVHRREAFRHHSYISAIAEAVICGCGTEGYVFALQRLATLFAQGAAR"
FT   gene            85284..86138
FT                   /locus_tag="Bcen_3064"
FT   CDS_pept        85284..86138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3064"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0345 shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77960"
FT                   /db_xref="GOA:A0A0H2XST5"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XST5"
FT                   /protein_id="ABF77960.1"
FT                   /translation="MSRPSFLIGLIGQGIGGSLSPAMHEEEGFRQGFGYVYRRIDLDVL
FT                   GVTADALPQLLDAAQRMGYNGLNITHPCKQRVIEHLDALSDDARALGAVNTVLFKDGKR
FT                   IGHNTDWSGFAKSFSRGLPGASLERVVQLGAGGAGAAVAHAALQMGAAELTIFDVDGTR
FT                   ATALAGELQQRFPAARVTPGSDLAAAMRAATGLIHCTPTGMVKHPGLPLPADLLHAGMW
FT                   VADIVYFPLETELIHAARAAGCATLPGGGMAVYQAVDAFELFTGRTPDAERMFSHFQSL
FT                   VAR"
FT   gene            86172..87515
FT                   /locus_tag="Bcen_3065"
FT   CDS_pept        86172..87515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3065"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0346 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3065"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77961"
FT                   /db_xref="GOA:A0A0H2XU03"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU03"
FT                   /protein_id="ABF77961.1"
FT                   /translation="MQHTTHTSAAPAQAAGTVRRTSARYKILALLAIGTMINYLDRTVL
FT                   GVAAPQLTKELGINAAVMGIMFSAFSWTYVAMQVPGGLFLDRFGSKVTYYWSMTLWSLC
FT                   TFLQGFVPGVATLLACRLGLGVTEAPCFPTNSRVVATWFPQNERAMATGTYTVGEYIGL
FT                   AFFSPVLFALMGAFGWRSLFWVVGAVGIAFGLIWWKFYHEPRNHPGANAEELAYIEAGG
FT                   GLVHGARKSGDKGDKPAQAQFSWSMVGQLVKKRQLAGICLGQFAGNSTLVFFLTWFPTY
FT                   LATERHMGWLKIGFFAVMPFIAASVGVMFGGIFSDWLLRRGKSANLARKLPIIAGLLLA
FT                   STIILANYVQSNEAVIAIMSVAFFAQGMAALGWTLVSDIAPDGLLGVTGGIFNFAANLA
FT                   GIITPLVVGFIVASTGSFVGALVFIGVIALVGALSYIFVVGDIKRIEL"
FT   gene            complement(87619..88728)
FT                   /locus_tag="Bcen_3066"
FT   CDS_pept        complement(87619..88728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3066"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate--pyruvate
FT                   transaminase; PFAM: aminotransferase, class V; KEGG:
FT                   bur:Bcep18194_B0347 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3066"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77962"
FT                   /db_xref="GOA:Q1BQZ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQZ3"
FT                   /protein_id="ABF77962.1"
FT                   /translation="MPAPILLTPGPLTTSATTRHAMQHDWGSWDAAFNQLTASVCADLV
FT                   AIAHGGDEYVCVPMQGSGTFSVEAALGTLVPRDGVVLVPDNGAYCARILKILGRLGIDA
FT                   IALPFGEDAAVDAAAVEAAFAREPRITHVALVHLETSAGILNPLDAIAAACRRHGKRLI
FT                   VDAMSSFGALPIALADSGIDALISASGKCLEGVPGMGFAIVRRDALDASEGNSPSLALD
FT                   LHDQYAYLRKTGQWRFTPPTHVIAALRAALDQYLAEGGQPARGARYADNCRTLVESMRA
FT                   LGFVPFLDASVQAPVIVTFHAPDHPAYDFRRFYDAVRGAGFILYPGKLTRLETFRVGCI
FT                   GAIDAGDIRRAVAAIGAAVESLGIAMQPA"
FT   gene            88989..90080
FT                   /locus_tag="Bcen_3067"
FT   CDS_pept        88989..90080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3067"
FT                   /product="ABC transporter periplasmic binding protein, thiB
FT                   subfamily"
FT                   /note="TIGRFAM: ABC transporter periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: bur:Bcep18194_B0348 thiamine ABC
FT                   transporter periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77963"
FT                   /db_xref="GOA:A0A0H2XUT8"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR017637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT8"
FT                   /protein_id="ABF77963.1"
FT                   /translation="MTLQKPSRAAAGAFRKLALAACAAGLLQGAAMPAHAANAVVLYTA
FT                   DGLENLYRDVLPAFEKKEGVKVNIVTAGSGEVVNRANIEKNSPKADVIVTLPPFIQQAG
FT                   QMGLLQPYQSVNYKNVPAIAKAEDGTWATFVNNYFSFAINPDVVKNQPKTFADLLSPSY
FT                   AGKVAYSNPATAGDGMAVLILTTSLMGEDKAFDYLAKLSQSVKFHTKGTGYLNVLLSRN
FT                   EISVANGDLQMDLDDAEHGALSVKPIFLAAKAGDQPTTFQLPYGIGLIKSGPNQDAGRK
FT                   LIDYLMSTEVQSKVPDMYGIPGRTDVPLAGKNGEAVKKAIAGVKLIPVDWTQVMAKKPE
FT                   WIERWKKDVIGSSGKQLDVVKPK"
FT   sig_peptide     88989..89099
FT                   /locus_tag="Bcen_3067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 37"
FT   gene            90115..91218
FT                   /locus_tag="Bcen_3068"
FT   CDS_pept        90115..91218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3068"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0349 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3068"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77964"
FT                   /db_xref="GOA:A0A0H2XTI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017662"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTI5"
FT                   /protein_id="ABF77964.1"
FT                   /translation="MNPVDTTLTHPGAFGAAEPHATLRSGAPGGVQIEHLSVRYGARTV
FT                   LEDLSLSIGAGEFLTVLGKSGCGKTTLLRFIAGFVKADGLTGTLTVAGRDLTHAPPHKR
FT                   NLGLLFQNYALFPHLSVFENVAFGLRARGMASSEVTRRVADALKLVQLGDAGHHLPAQL
FT                   SGGMQQRVALARALVIEPDVLLLDEPLSALDANLRASVRSELKALHERLPNLTVVCVTH
FT                   DRDDALVLSDRALLMRDGHIAQLGTPQQLYDAPRDGYVARYLGPANLLPPHVIFPLGDP
FT                   RHEVRGKVACVRPERLTVMPPAAGGLHGTVSSVEWQGADLSIAVVIDAAPDEPVRVTMQ
FT                   RGRGVAPERGARVSLHCEADDVVLIEP"
FT   gene            91238..92116
FT                   /locus_tag="Bcen_3069"
FT   CDS_pept        91238..92116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3069"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0350 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3069"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77965"
FT                   /db_xref="GOA:A0A0H2XUU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017636"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU9"
FT                   /protein_id="ABF77965.1"
FT                   /translation="MLASAAAHAAAARRRRRIGDLHLAALAIVVLGPLVVYPLVRLVLL
FT                   SVTGDHGLSFAAYRTFFGNPDTRNVLLTTLGVLFASAGTASVLGVLLAALLFFRPFPGA
FT                   SLVTRFLELYVAFPSFLVAFTLIFLYGSQGSISIALQHLFHLENPPLDFLFGIGGVILA
FT                   QTVFYTPFVVRPTLASFATLDLRLIEAARSLGAPGWMLARRVVLPIAWPGIAAGTVLCF
FT                   LLTLNEFGILLVLGSARLVTLPVAIYSSATVDLDLPTASAGAVVMLSLSLALYAVYRRV
FT                   NRRATGGNDVR"
FT   gene            92106..92966
FT                   /locus_tag="Bcen_3070"
FT   CDS_pept        92106..92966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3070"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0351 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3070"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77966"
FT                   /db_xref="GOA:A0A0H2XSU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017661"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSU0"
FT                   /protein_id="ABF77966.1"
FT                   /translation="MSAEFRIGQAVPRHPLGWTDALLKHASRAALALAAFACFWLFVLP
FT                   VVVVALSSVSTQWSGTILPAGYSLRWFERLGSPEYDALLTSLEIGFGVSALGTILGLWL
FT                   ALALEGRDRRGLGALVDALVMVPNGVPSVVLGLAVLIAYHQKPLDLSSSAAIVVLVQLA
FT                   LILPFCYRCAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPALRASLALGFALS
FT                   LGELGATLTVYPPGFATVPIVVIGQVERGYYLPASALSLLMLGASLAALLLIAARVPRG
FT                   KRAAS"
FT   gene            92963..94273
FT                   /locus_tag="Bcen_3071"
FT   CDS_pept        92963..94273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3071"
FT                   /product="Phosphonoacetate hydrolase"
FT                   /note="TIGRFAM: Phosphonoacetate hydrolase; PFAM: type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; KEGG:
FT                   bur:Bcep18194_B0352 type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3071"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77967"
FT                   /db_xref="GOA:A0A0H2XU07"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU07"
FT                   /protein_id="ABF77967.1"
FT                   /translation="MNAAFALRLPGEQPAAGKGSSDLAGRSIDVNGRRYRLPVDPTVVI
FT                   CVDGCEYDYLECAVEAGVAPFIGRTIAEGTAWRADCVVPTFTNPNNLSIVCGVPPSVHG
FT                   ICGNYFWDPAADGGRGAEVMMNDPAYLRAGTLLAAASDAGARVAVVTAKDKLRRLLGWQ
FT                   LNGICFSAEKAAQANLAENGIVDVLDWVGLPSPDVYSAALSEFVFAAGVRLAQTRQVDL
FT                   MYLSTTDYVQHKCEPGSAGANAFYAMMDGYLAQLDALGWAIGLTADHGMNAKHDPATGR
FT                   PNVIYLQDAFDGWYGTQAARVILPITDPYVVHHGALGSFATIYLAPGVDRAEAMWRVGG
FT                   LDGVELVLDNAEAAARFELPADRIGDLVVIGRRDMTLGTREREHDLSGLTVPLRSHGGV
FT                   SEQEVPLLFNRRIERDDPARRPRNFDVFDFVLNRIAT"
FT   gene            94273..95724
FT                   /locus_tag="Bcen_3072"
FT   CDS_pept        94273..95724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3072"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0353 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3072"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77968"
FT                   /db_xref="GOA:A0A0H2XUU3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU3"
FT                   /protein_id="ABF77968.1"
FT                   /translation="MAHPRQDHPSFRAEALRWCGTHAMRERTLDVTDPYTGTRVGTAPL
FT                   ASVDDVRAAFDYAMAYRPTLTRYARSQILERAAALLRERTEEASDLITLESGLSKQDSR
FT                   YEIGRVADVLKFAAAEALRDDAQSFSCDLTPHGKARRVFSQRQPLDGVIVAITPFNHPM
FT                   NQVAHKIAPAIATNNRVIVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGNPAEIADE
FT                   LVTHPHASLITFTGGVAIGKAIAARAGYRRIVLELGGNDPLIVLADADLDRAASLAVLG
FT                   SYRNSGQRCTAVKRMLVQRSIAPAFTELLVEKTRAWKYGDPFDPANEMGTVIDETAARL
FT                   FEVRVNEAVAQGARLLTGNVRRGALYAPTVLDNVDPSMTIVREETFGPVSPVIAFDTIE
FT                   DAIRISNGTAFGLSSGVCTDSTAAVVRFVNELKVGTVNVWEVPGYRIELSPFGGIKDSG
FT                   LGYKEGVQEAMKSFTNLKTFSLPWE"
FT   gene            95729..96283
FT                   /locus_tag="Bcen_3073"
FT   CDS_pept        95729..96283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3073"
FT                   /product="HD phosphohydrolase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B0354 HD phosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3073"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77969"
FT                   /db_xref="GOA:A0A0H2XTJ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR017670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTJ2"
FT                   /protein_id="ABF77969.1"
FT                   /translation="MALTVEEIHGLYREHGHVAYSGEPVTQLEHALQSGLLAEESGVDE
FT                   ALVAAAFLHDLGHLLNRQGDTPSARGIDDLHQYYVLPFLRPLFSDAVLEPIRLHVDAKR
FT                   CLCRTDAGYFESLSPDSVRSLALQGGVFSEEETAAFLRRPFAEDALRLRRWDDTAKEEG
FT                   KATPDLDHYMEIVARQVRARS"
FT   gene            96796..98321
FT                   /locus_tag="Bcen_R0071"
FT   rRNA            96796..98321
FT                   /locus_tag="Bcen_R0071"
FT                   /product="16S ribosomal RNA"
FT   gene            98385..98461
FT                   /locus_tag="Bcen_R0072"
FT                   /note="tRNA-Ile1"
FT   tRNA            98385..98461
FT                   /locus_tag="Bcen_R0072"
FT                   /product="tRNA-Ile"
FT   gene            98500..98575
FT                   /locus_tag="Bcen_R0073"
FT                   /note="tRNA-Ala3"
FT   tRNA            98500..98575
FT                   /locus_tag="Bcen_R0073"
FT                   /product="tRNA-Ala"
FT   gene            98852..101732
FT                   /locus_tag="Bcen_R0074"
FT   rRNA            98852..101732
FT                   /locus_tag="Bcen_R0074"
FT                   /product="23S ribosomal RNA"
FT   gene            101887..101999
FT                   /locus_tag="Bcen_R0075"
FT   rRNA            101887..101999
FT                   /locus_tag="Bcen_R0075"
FT                   /product="5S ribosomal RNA"
FT   gene            102612..104036
FT                   /locus_tag="Bcen_3074"
FT   CDS_pept        102612..104036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3074"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0355 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3074"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77970"
FT                   /db_xref="GOA:A0A0H2XUV2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUV2"
FT                   /protein_id="ABF77970.1"
FT                   /translation="MTDSPAQSGRTTDFLPYLVAATFFMEYLDTTVIATALPQMAHSFG
FT                   VGPNALSLGMTAYMLALAVFIPISGWIADRYGSRTVFASAIVVFTGASVLCGLSEGVMS
FT                   FTAARLLQGVGGAMMVPVGRMIVVRSTEKAKLMRAIATITWPGIVAPVVGPPIGGFITT
FT                   YASWRWIFLLNVPFGLAALVCTWLIVRNTRADEQRPLDWVGFVLAGGALTCLLIGTEAA
FT                   GQQDVDFTRAGVLVGASVLFGIAAWLYARRCAHPLLDFTTLKVPTFSVTVITGSITRMA
FT                   INAVPYLLPLLFQIGFGLSPFQSGLLLLASALGNLGMKAGTSWILDRYGFRRVALVDVT
FT                   IVGIFMIACGWLTASTPLAITLLLVFVYGLTRSMQFTTLATLAYADIPSHQTSAASTLW
FT                   SAAQQMTIGMGIAFGALSLRLAALVRGDAAGMHYVLADFRWAFIAAGVLALLTLPGYAR
FT                   LASDAGDRLRANMARG"
FT   gene            complement(104290..105051)
FT                   /locus_tag="Bcen_3075"
FT   CDS_pept        complement(104290..105051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3075"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77971"
FT                   /db_xref="GOA:A0A0H2XSU3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSU3"
FT                   /protein_id="ABF77971.1"
FT                   /translation="MPRGTPVNIVDLQPAVESLDIAQRVDALDWPSVDAELDRFGCARV
FT                   PGLMSASECDALASLYPRDALYRSRVVMARHGFGRGEYKYFAYPLPAIIAELRATMYPH
FT                   LAPIANRWNQALGIDVRYPKDHATFLDRCHAAGQTRPTPLILQYGADDYNCLHQDLYGE
FT                   HVFPLQVAILLSAPGRDFTGGEFVLTEQRPRMQSRAEVVPLTQGDAVIFAVHGRPVQGT
FT                   RGIYRVNLRHGVSRIRSGHRYTVGIIFHDAQ"
FT   gene            complement(105370..106962)
FT                   /locus_tag="Bcen_3076"
FT   CDS_pept        complement(105370..106962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3076"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG:
FT                   bur:Bcep18194_B0357 phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3076"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77972"
FT                   /db_xref="GOA:A0A0H2XU11"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU11"
FT                   /protein_id="ABF77972.1"
FT                   /translation="MNQPASSAPNNPGSVARTRQVGYAAFLLVLVLGAVYIATHLVADL
FT                   APVREGTLFPYLLLGAALLIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGMWN
FT                   FLGVMVSSGAVAFGILQLLPVELILQVGSGSGFAMVFALLIAAIVWNLATWYFGLPSSS
FT                   SHTLIGSIIGVGLMNQLMHGPSGTSGVDWGQALGVGKSLLLSPIVGFLCASLLLLALKA
FT                   LVRIPELYKEPPKDQPPPFWIRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTA
FT                   YALNKAVTPTESQTFVAVANQAAATFGKYTNGVAPSANPRADVEHYVQHRELTPAVLPA
FT                   VAQLSTSLATAVGASGSMAAVPQRDVDNVRNTMYLVSEAIRLMEKSGQPAFATDDKLAI
FT                   DNYRKQLDHATKFIPTWVKVAVAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAE
FT                   LVAMLTIGAADMYGLPVSTTHVLSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIA
FT                   LAAGLYWLFRSLA"
FT   gene            complement(107127..107717)
FT                   /locus_tag="Bcen_3077"
FT   CDS_pept        complement(107127..107717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3077"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   bur:Bcep18194_B0358 phosphoglycerate/bisphosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3077"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77973"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU6"
FT                   /protein_id="ABF77973.1"
FT                   /translation="MNLHASLRLIAHASTRAMRTGTFPDDDPLDAHGLAEAAALRGRWT
FT                   AAAGSLVLCSPARCARQTADALGLHADIDDALRDIDYGHWRGKRLHDLARDLPDELAAW
FT                   LGTPSASPHHGESFDAAAHRIGTWLNVLPPDRDVIAITHAPIVRAAIAHMLRIAPEAAA
FT                   RLDVAPLSCTTFVASPAGWTLATTDDDPRDTGA"
FT   gene            107940..108149
FT                   /locus_tag="Bcen_3078"
FT   CDS_pept        107940..108149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3078"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77974"
FT                   /db_xref="GOA:A0A0H2XTJ7"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTJ7"
FT                   /protein_id="ABF77974.1"
FT                   /translation="MSEAVLKPAVVPAPIPVRELLPWAVFVGLILLLALYFVGAEQGAT
FT                   SLVPGMLVHEFVHDGRHLLGFPCH"
FT   gene            108163..108885
FT                   /locus_tag="Bcen_3079"
FT   CDS_pept        108163..108885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3079"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77975"
FT                   /db_xref="GOA:A0A0H2XUV5"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUV5"
FT                   /protein_id="ABF77975.1"
FT                   /translation="MVGKLLMRGMLAGIAAGLLTFGFARIVGEPQVDQAIAFEEKTTAA
FT                   QGEAPEPELVSRHTQAGLGLLTGVVTYGAAFGGLFSLVFAYAYGRGSRLPARPLAAWLA
FT                   LAAFVALVIVPNLKYPANPPSVGDPDTIGYRTGLFFLMIAISVATMVFAVGVRRHLLAK
FT                   LGQWNASIVAGLVFVAIIAAVQVGLPSVSELPADFPAALLWKFRVAAIGMQVIMWTTIG
FT                   LLFGAWVERGERAGMRAA"
FT   sig_peptide     108163..108246
FT                   /locus_tag="Bcen_3079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.826) with cleavage site probability 0.383 at
FT                   residue 28"
FT   gene            complement(108909..109817)
FT                   /locus_tag="Bcen_3080"
FT   CDS_pept        complement(108909..109817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3080"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0361 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77976"
FT                   /db_xref="GOA:A0A0H2XSU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSU5"
FT                   /protein_id="ABF77976.1"
FT                   /translation="MLERFHLVVIREVERQGSLTAAANALHLTQSALSHTVRKIEQQLG
FT                   TPIWDREGRGLRLTQGGQYLLKLANRLLPQFELAEERMKQYAKGERGTLRIGMECHPCY
FT                   QWLLKVVSPYLSRWPDVDVDVKQRFQFGGIGALFGYDIDVLVTPDPLNKPGLRFDPVFD
FT                   YEQVLVVADSHRFANVDHVTPEQLTDEVLITYPVETDRLDIYNQFLSPAGIVPRRHKSI
FT                   ETTDIMLQMVASGRGVAALPRWLADEYADRMPVVPVKLGKKGIAKQIFLGIREADAAID
FT                   YLAAFVALARESTWSAPRMLR"
FT   gene            109945..112239
FT                   /locus_tag="Bcen_3081"
FT   CDS_pept        109945..112239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3081"
FT                   /product="methionine synthase (B12-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /note="TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase, vitamin-B12
FT                   independent; KEGG: bur:Bcep18194_B0362
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3081"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77977"
FT                   /db_xref="GOA:Q1BQX8"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQX8"
FT                   /protein_id="ABF77977.1"
FT                   /translation="MVTTHNLGFPRIGAKRELKFGLERYWKGESSRDELKALGAELRRR
FT                   HWHDQRDLDLAPLGDFAFYDQVLDMSFTLGNLPKRVQDFHGDALDNYFRVARGRSAQSA
FT                   EEHAACCGGVAAGEMTKWFDTNYHYIVPEFHADTNFSLDPSRLLQQLAEANAQGVNAKP
FT                   VILGPVTYLWLGKAKDVSDRLALLPKLLPVYGALLDTLTAQGVEWVQIDEPILVTELDA
FT                   EWRQAFRTAYAALETRRIKLLLATYFGQLQDNLTLAASLPVDGLHIDAINARDEVDALV
FT                   RELPAERVLSVGAINGRNIWKTDLNAALDWLEPLAKQLGDRLWLAPSCSLLHVPVDLAS
FT                   EEKLDAEIRSWLAFALQKLDELKVLATALNEGRDKVADALAANAAAIDSRRRSPRVNNP
FT                   VVKAAIARIDAQLGNRASPYTQRASKQSARLNLPAFPTTTIGSFPQTAEIRQARSRFRA
FT                   GALDEAGYRTAMRAEIERSVREQESLELDVLVHGEAERNDMVEYFGEQLDGYAFSQFGW
FT                   VQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTRKPMKGMLTGPVTILNWSFVRDD
FT                   QPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEAALREGLPLRRAQWSEYLKWAVESFR
FT                   ITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAFDTFKYPNE
FT                   IGPGVYDIHSPNIPTQDHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMV
FT                   AAAKTLRNQVQ"
FT   gene            complement(112368..113693)
FT                   /locus_tag="Bcen_3082"
FT   CDS_pept        complement(112368..113693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3082"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0365 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3082"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77978"
FT                   /db_xref="GOA:A0A0H2XU14"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU14"
FT                   /protein_id="ABF77978.1"
FT                   /translation="MGTSVKQPKRAALASFVGTTIEWYDFYSYATAAAIVFGPLFFPGE
FT                   NRFISLLASFGSFAVGFFARPLGGVMFGYLGDRFGRKRSLLATLMLMAVSTVAIGLLPT
FT                   HAQAGVIAPILLVLMRVLQGIAVGGEWGGAVLLAGEHAPEGKRTFFASFAQLGSASGLI
FT                   LSMLAFGAVSTLSKDDMMSWGWRVPFLASSVLLIVGFVIRASVSESPEFEEVRKSGNIA
FT                   QKPLREALKVWPLLLLAIGANVYGIAGVYFSNIFMISYATQFLSLDRSMVLHCMTIVAV
FT                   LQFVVQLAAAFLAQRFGTTRVLLITGAWAMIVPFVMLPLVHLGTPVSITVGVGLATLAE
FT                   SGYYSVVAGFVSGIFVARIRYTAISIAYQVCGALAGGLTPLVATIIAQNTAPQWWPLAI
FT                   QYASAAVLSSLCVWLISRRVSIDDAGAPGKTDDALPRGTRTA"
FT   gene            complement(113749..114813)
FT                   /locus_tag="Bcen_3083"
FT   CDS_pept        complement(113749..114813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3083"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="TIGRFAM: agmatinase, putative; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   bur:Bcep18194_B0366 putative agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3083"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77979"
FT                   /db_xref="GOA:A0A0H2XUV1"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUV1"
FT                   /protein_id="ABF77979.1"
FT                   /translation="MFTSISSHSSFPAERVKLCARPRRMIRQPHIGRDDPMNDHTHFQP
FT                   LGGNEMPRCGGIATMMRLPHVSSAEGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVL
FT                   LRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKPITLGGDH
FT                   TIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQ
FT                   IGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAPLMEEVRARIGDTPVYITFDIDGI
FT                   DPAYAPGTGTPEIAGLTVPQALEIIRGAMGLNIVGCDLVEVAPPYDPFGTTALLGANLA
FT                   YELLCVLPGVAYRD"
FT   gene            114840..115757
FT                   /locus_tag="Bcen_3084"
FT   CDS_pept        114840..115757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3084"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0367 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3084"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77980"
FT                   /db_xref="GOA:A0A0H2XTK0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTK0"
FT                   /protein_id="ABF77980.1"
FT                   /translation="MNVLGNLSTLDLRLIRVFLAVTDAGGVSAAQAVLNVGQSTISAQL
FT                   SSLETRLGYRLCERGRSGFRLTPKGERFHAMSRKLLAALDEFGMAARHMDRQLVGTLNI
FT                   GLIGHTPVSQNARIAEAIAAFRTRDEAVRFSISVRAPGDLEEKLLSNEIQIAVGYFWHR
FT                   VPTLHYTPLFIERQIAYCGRGHPLFDGAGTLTPADVAGFEWAWRSYPLPEAQMSTTPDR
FT                   VTATADNMEAVALLILSGHHLGYLPQHFAAPYVAQGLLAPLNPDRLHYEVTFHMVVARD
FT                   GRGDPVVEAFLEDLERAHQSSDVV"
FT   gene            complement(115821..116285)
FT                   /locus_tag="Bcen_3085"
FT   CDS_pept        complement(115821..116285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3085"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   bur:Bcep18194_B0368 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3085"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77981"
FT                   /db_xref="GOA:A0A0H2XUV9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUV9"
FT                   /protein_id="ABF77981.1"
FT                   /translation="MIDLDKTDRAILAAVQRDGRLPIARLAESVGLSETPCARRLKRLE
FT                   NDGYIERYRAQLSRQALGFGVVAFVLVRFATHDRKVADRFEREVLGIERILACHNVAGT
FT                   ADYLLQVVARDLDDYGTFLRDSLRMLPGVTSIESALSLREVKHDAGLPVP"
FT   gene            116420..117040
FT                   /locus_tag="Bcen_3086"
FT   CDS_pept        116420..117040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3086"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0369 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77982"
FT                   /db_xref="GOA:A0A0H2XSV0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSV0"
FT                   /protein_id="ABF77982.1"
FT                   /translation="MISTHLLLIYLAALAAIYAVPGPDMALVLQTSIGRGVRPGMAAAA
FT                   GLSLARTVHVTLSACGVAALIRSAPWLYEVIRYGGALYLAYVAIQVFRSPVFALGDGDA
FT                   PAGALRQSFVKGLLTNLLNPKALLFCSVLLPQFVRPEVGPVVWQMFELGALLVAAGVCF
FT                   DLACVFGASRIAAWMRAHPLAQTVQRWTFSAALIGFALRLSMD"
FT   sig_peptide     116420..116500
FT                   /locus_tag="Bcen_3086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.668 at
FT                   residue 27"
FT   gene            117328..118917
FT                   /locus_tag="Bcen_3087"
FT   CDS_pept        117328..118917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3087"
FT                   /product="kumamolisin, Serine peptidase, MEROPS family S53"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: bur:Bcep18194_B0370 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3087"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77983"
FT                   /db_xref="GOA:A0A0H2XU17"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU17"
FT                   /protein_id="ABF77983.1"
FT                   /translation="MARHLQADREPRIVAESKCLGQCDPAERIHVTIMLRRQEEGQLDA
FT                   LVHQLATGDARAKPVSRDAFAQRFSANPDDIRKTEDFAHRHQLTVDRVDPVESVVVLSG
FT                   TIAQFEAAFSVKLERFEHRSIGQYRGRSGPIVLPDDIGDAVTAVLGLDSRPQARPHFRF
FT                   RPPFKPARGAAAVTFTPIQLASLYDFPAGDGAGQCIAIIELGGGYRAADIQQYFRGLGI
FT                   TTPPKLVDVNVGTGRNAPTGEPNGPDGEVALDIEIAGAIAPAAKIAVYFAPNSDAGFIQ
FT                   AVNAAVTDKTNQPSVISISWGGPEAIWQAQSAQAFNRVLQAAAAQGITVCAASGDSGSG
FT                   DGLQDGADHVDFPASSSYVLGCGGTQLDALPGQGIRSEVTWNDEASGGGAGGGGVSALF
FT                   DLPAWQQGLKVARADGSTTPLAKRGVPDVAGDASPQTGYEVSVAGTPAVMGGTSAVAPL
FT                   WAALIARINAANGASAGWINPVLYKHPGALRDITKGSNGTYAAASGWDACTGLGSPNGA
FT                   QLATILARKPSS"
FT   gene            118991..120667
FT                   /locus_tag="Bcen_3088"
FT   CDS_pept        118991..120667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3088"
FT                   /product="peptidase S10, serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10, serine carboxypeptidase; KEGG:
FT                   bur:Bcep18194_B0371 peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3088"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77984"
FT                   /db_xref="GOA:A0A0H2XUV3"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUV3"
FT                   /protein_id="ABF77984.1"
FT                   /translation="MDIDSASSGGVYPLHHGDHNSHGVPPTINPVALSHGRDQPFFDPV
FT                   AYGNGPDDSVTDTTEAAAITHHTILIDGKRIAYTATVGHLVTVDPSSSQPAAKIFYVAF
FT                   TADGAKEETRPVTFFYNGGPGSSSVFVLLGSFAPKRIKTSMPGFTPPAPYQIEDNPDSM
FT                   IDHSDLVFINPVGTGYSAAVAPNKNRDFWGVDQDADSLKQFIKRYLTKNNRWNSPKYLF
FT                   GESYGTARSCVLAYKLHEDGVDLNGVTLQSSILDYRQAGNPVGTLPTAAADAWYHKKLG
FT                   IKPAPADLGAFVEEVAQFARTDYLTALRAVPHANPATVQKLSAYTGIDTATLQSWGLDI
FT                   AGYDTRGNSLFLTTLLHAQGLALGSYDGRVTGISSGIAGKIDPNSGGNDPTMTAVTGVY
FT                   TAMWNSYLNEQLKFTSNSAFTDLNDQAFKNWDFSHIDPTGAQQGIDAQGNVILYTAGDL
FT                   AAVMALNVDLKVLSANGFYDFVTPFYQTVIDLQQMPLEDQKVRQNLSARFYPSGHMVYL
FT                   DGGSRTALKRDLATMYDATVSDTGARMRIRALQAKKTGGNA"
FT   gene            complement(120743..121591)
FT                   /locus_tag="Bcen_3089"
FT   CDS_pept        complement(120743..121591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3089"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD+ synthase; KEGG:
FT                   bur:Bcep18194_B0372 NAD+ synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3089"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77985"
FT                   /db_xref="GOA:Q1BQX0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQX0"
FT                   /protein_id="ABF77985.1"
FT                   /translation="MTSADYASRQRAIIAELNVAPHFDAEAEIARRIDFLAQYLRSTGL
FT                   RTYVLGISGGVDSSTAGRLAQLSVERLRADGYDARFIAMRLPNGVQNDEEDAQRALAFV
FT                   RADEVLTVDVKPAADAMLRSLVASGHAFETPAQQDFVHGNIKARERMIAQYAVAGARRG
FT                   IVIGTDHAAESLMGFFTKFGDGGADILPLAGLSKRRVRGVARALGGEELIVMKVPTADL
FT                   EELRPLRPDEHAYGVTYDEIDDFLEGKPVADRVYETVLRFYDGSRHKRALPYTMFDWPA
FT                   A"
FT   gene            complement(121773..122744)
FT                   /locus_tag="Bcen_3090"
FT   CDS_pept        complement(121773..122744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3090"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B0373 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3090"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77986"
FT                   /db_xref="GOA:A0A0H2XTK5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTK5"
FT                   /protein_id="ABF77986.1"
FT                   /translation="MPHGMSAGFDKTPAPLRPILADFPVLSGRVAARHACLPRSSPPPS
FT                   SRSGPPASSSPGRSSPTPIRTCSCSRASRARPRCSPWWRSSRAPWPARREWPRHLIAGA
FT                   LLQGVYLGASYWAVAQGLNAGVMALLGALQPLATAVLAVPLFNERLPARGWLGMALGLA
FT                   GVALVLAPKVTGGVAPPSGAAPAWLVVTVSVLAVGLITAGSLYQKGKLAQSDLRTAVAV
FT                   QNFGAAIVAAVFVVLLHETRWIGAPALWVSLVWGVVFLSGGAVTMLMWMLRRGNAARAT
FT                   SLLFLAPPLAALQGYGLFGETLAPIQLAGFALALVGVVLARR"
FT   gene            complement(122845..123030)
FT                   /locus_tag="Bcen_3091"
FT   CDS_pept        complement(122845..123030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3091"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW3"
FT                   /protein_id="ABF77987.1"
FT                   /translation="MYRKGSVIEIQFPPERLNDAAGDPYWIDLTLDEARRLYEQLAARF
FT                   ATDARANQPLDTFSID"
FT   gene            123260..124018
FT                   /locus_tag="Bcen_3092"
FT   CDS_pept        123260..124018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3092"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; KEGG:
FT                   bur:Bcep18194_B0375 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3092"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77988"
FT                   /db_xref="GOA:A0A0H2XSV1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSV1"
FT                   /protein_id="ABF77988.1"
FT                   /translation="MLAEQRHQYILSELGRSGALSVAELVRSLDVSRETVRRDLNALAA
FT                   RGLLVMTHGGALAADRREPSLSEREAANADAKRTIGRRAAEFVPDDASVLIDSGSTPHA
FT                   VALALADRHRLSIYTNDWRTAFVLARRNGNRVTLLGGELSDDEDATFGLDTIHQLAQYH
FT                   VDFAFVGAGGITPDGECTDYSRLAAEVRSRMIAAAGTAIIVADHSKFGRVTPVRINGAA
FT                   AARYLVTERAPDKAVRRALTARGVELLVCD"
FT   gene            124124..125920
FT                   /locus_tag="Bcen_3093"
FT   CDS_pept        124124..125920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3093"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bur:Bcep18194_B0376 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3093"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77989"
FT                   /db_xref="GOA:A0A0H2XU20"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU20"
FT                   /protein_id="ABF77989.1"
FT                   /translation="MTVSVRSYLSPTLVLLAFDWPDAASRSDFLGFAIRRTPGFWSADG
FT                   KTRAPDSWLPNRLTFDGPAADTQGDAPTDQAPIQKFMWWDARIDPQDRGASFRYDVYPV
FT                   VGTPANLQMLDAQAGVCDVVLPAHIEDGIGTWFNRAVVSSQAFAKQVAALGLAPNEAPS
FT                   AAQALKLRTWLANDMEQVFAQMLDPASRAASAVYHLTDTLWALPAFQAFGRKHGEASLA
FT                   IVYDAHTTARKGKPPLPSPNQPAVDALQGLATLAPRDRTHIMHDKFIVTDAPSNPAPAR
FT                   VLTGSANFTTEGLTEQANVLHAFDSPALAALYNERAHALAGNPSIAETARLSPGWSAPM
FT                   TIGSAQVRVAYSPEPAGQRTEIDTIVAAIAAAKHSVSFCLFMPTDAALRDACFAAGDRG
FT                   LMMFGLVNRINVGSATKADAAQQAGQTLDAATLANLELYHRSRDNHDVIDASYFSPATV
FT                   PQGFEPELRLFPGEPAPAFPPVVIHHKFIVIDAEGANPVVYTGSANMSRNSEQYNDENL
FT                   LEIRDRRIAAIYLAEFLRLYEHYRARALAINTKRQHGTGTDAGAHARLALAPDSSWAKK
FT                   YYVAGSPEEKARIALASTAPTD"
FT   gene            complement(125985..126698)
FT                   /locus_tag="Bcen_3094"
FT   CDS_pept        complement(125985..126698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3094"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_B0377 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77990"
FT                   /db_xref="GOA:A0A0H2XUV6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUV6"
FT                   /protein_id="ABF77990.1"
FT                   /translation="MPFPSRREPQQSHMKAGSKAATSDPRALASDARRKYDPEQTKRNI
FT                   LDVATQEFSAMGLAGARVDAIAERTNTTKRMLYYYFESKEGLYEAVLEKVYGDIRALEQ
FT                   ELHVGDMEPREGMRRLVEFTFDYHDKHRDFVRLVSIENIHGAKYVEQLKSFKNRNVSII
FT                   KTLEELVERGAASGVFRKDIDAFDLHLLISSFCFHRVANRYTFGAAFGRDPSAPRLRAR
FT                   HRDTIADAVLRYVAA"
FT   gene            complement(126786..128054)
FT                   /locus_tag="Bcen_3095"
FT   CDS_pept        complement(126786..128054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3095"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B0378 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3095"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77991"
FT                   /db_xref="GOA:A0A0H2XTK8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTK8"
FT                   /protein_id="ABF77991.1"
FT                   /translation="MQNFYEATVTRQPYPQLTGTIDTQVCIVGGGLAGLCTALGLVERG
FT                   VTDVVVLDSERVGFGASGRNGGFVFGGYSLDNADLLRTLGRDEGRRLYRLTVDAVDLIR
FT                   ARIARYGIDCDIVDQGVMLANWFDDPSRLDSVRTLMKNELGVEWEPVPTGALRERLKTQ
FT                   RYYGGLFEPNAFHFHPLKYVLGVAAAASRGGARVYERSAALGIARDGAGYVVRTGQGAV
FT                   RAKDVVFAGGGYARGVSPRIERAVLPIATYVIATEPLGTRLPDAIDAPYAIYDTRFAFD
FT                   YYRPLKDTRILWGGRISVLDRGPDAIARLLRRDLLRVYPQLEGVKIDYAWGGLMSYARH
FT                   KMPQIGRDADGVWHAIAFGGHGMAPTTVAGEALAAALAEGRPVPDGFAAFGLTRTFGLA
FT                   GLAAAQLTYTAYQARDALASCRR"
FT   gene            complement(128188..129768)
FT                   /locus_tag="Bcen_3096"
FT   CDS_pept        complement(128188..129768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3096"
FT                   /product="lysine:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B0379 amino acid transporter; TC 2.A.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77992"
FT                   /db_xref="GOA:A0A0H2XUW6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW6"
FT                   /protein_id="ABF77992.1"
FT                   /translation="MHSDARPDSSRPSASPPAKPSLHRALQARHLRMIAIGGSIGTGLF
FT                   VASGASISQAGPGGAMLAYMLIGLMVYFLMTSLGEMAAFMPVSGSFATYGAKFVDEGFG
FT                   FALGWNYWYSWAVTLAVELVAAQLVMHYWFPHVPGVWWSALFLTLIFALNALSVRGFGE
FT                   AEYWFALIKVLTVLAFVGVGLLMIFGIMQGGPSAGWGNFTIGDAPFVGGWATMLGVAMI
FT                   AGFSFQGTEMIGVAAGESENPRTTIPRAVSQIFWRILLFYVFAIFVIGVLVPYTDPSLL
FT                   KSDVTDIGVSPFTLVFRHAGLAFAAGVMNAVILTAVLSAGNSGMYASTRMLYNLAVEGR
FT                   APKLFAKLSPGGVPRNALYATTAVGALCFLTSLYGDKTVYLWLLNTSGMAGFITWLGIA
FT                   VSHYRFRKGFLKQGYRLDQLPYRSKWFPFGPLFAFALCAVVALGQDYQAFLADKIDWAG
FT                   VAATYIGLPFFLAIWLGYALVRKCRLVRYEDMEIAPWIERNATHEAAQKADASYPAYVA
FT                   RPVNPTPGA"
FT   gene            130400..131911
FT                   /locus_tag="Bcen_3097"
FT   CDS_pept        130400..131911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3097"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0380 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3097"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77993"
FT                   /db_xref="GOA:A0A0H2XSV5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSV5"
FT                   /protein_id="ABF77993.1"
FT                   /translation="MQFNDILAALDIDLAQWKGNALTARSPLDGATLATLAVDTPAGAE
FT                   RKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAELGRLVTLEAGKITSEGLGEVQ
FT                   EMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPIGVCGVISAFNFPVAVWAWNAAL
FT                   AFVCGDSVVWKPSEKTPLTAIACHVLLQKALREFDKTHPGVAPAELSQLVLGMRDVGEV
FT                   LTASKKVPVVSATGSVRMGQEVAKVLSQRLARGILELGGNNGMIVAPSADLDLVVRAVT
FT                   FAAVGTAGQRCTTLRRLIVHRSLVEQLLPRIEKAYASVKVGNPLEEGTLVGPLVDRASF
FT                   DAMQKALADAREQGGEVKGGERVDVGHADAYYVRPAIVRMPKQSAVVERETFAPILYVM
FT                   VYDNFDDAIDVHNAVPQGLSSAIFTNDMREAEQFMSAAGSDCGIVNVNIGTSGAEIGGA
FT                   FGGEKETGGGRESGSDAWKAYMRRATNTINYSRQLPLAQGVKFDV"
FT   gene            131994..132323
FT                   /locus_tag="Bcen_3098"
FT   CDS_pept        131994..132323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3098"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XS24"
FT                   /protein_id="ABF77994.1"
FT                   /translation="MRPAWAHSCGCKSRHKLVTANEVKRNCMRATECGEEAWSVNREPM
FT                   DKNCIEGAAVQGERATHREALVTKAKQRKCGGCAMKECALTWGDLALCLKGRRRRAGAR
FT                   SQQRS"
FT   gene            132394..133761
FT                   /locus_tag="Bcen_3099"
FT   CDS_pept        132394..133761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3099"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: sme:SMb21167 putative reverse
FT                   transcriptasematurase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3099"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77995"
FT                   /db_xref="GOA:A0A0H2XU41"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU41"
FT                   /protein_id="ABF77995.1"
FT                   /translation="MSMRQAMRQMPVRAGRAGSIRGEAASMPVSDEGCCPRHESGDTGS
FT                   PLLMAALTRENLKQAFKRVRANKGAAGVDGLNIDQTSRHLVTAWPAIREQLLKGTYRPS
FT                   PVRRVTIPKPDGGERELGIPTVTDRLIQQALLQVLQPVLDPGFSEHSYGFRPGRRAHDA
FT                   VLAAQSYVQSGRRIVVDVDLEKFFDRVNHDILIDRLQKRIGDASVIWLIRAYLNSGIMD
FT                   GGVVQQREQGTPQGGPLSPLLANVLLDEVDKELERRGHCFARYADDANVYVRSRRAGER
FT                   VMALLRRLYGQLRLKVNETKSAVASVFGRKFLGYSLWVASGGVIKRKVAARSLLAFKRR
FT                   IRELTGRSGGRSMKDVVERLRPYVLGWKAYFRMAQTPRVWLDLDKWMRHRLRVIQLKHW
FT                   RRGPTIYRELRALGAPSAVAQQVAANSCRWWRNSGKLLNSVLTLAYFDRLGVPRLS"
FT   gene            complement(133905..136367)
FT                   /locus_tag="Bcen_3100"
FT   CDS_pept        complement(133905..136367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3100"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bur:Bcep18194_B0381 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3100"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77996"
FT                   /db_xref="GOA:A0A0H2XTL2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTL2"
FT                   /protein_id="ABF77996.1"
FT                   /translation="MSIQRLSTYARRIALIALLQFAAIATASAFPAAASAPVASGVGAA
FT                   APAISLPDAIAQLKQMQAELDRIKQQTSTASNSKELDALDDSAQELSTDVAKLQSDLTP
FT                   QRAQVQAQLDVLGPAPAEGAAPEAPAVAKQRAALDARKTQIDAALKQAADQKTSLTNLT
FT                   EQFAKLHRSLLKNQLAFRSGSIFSAQFWLPLFHLSPDDRQRLEDFDDELFDMLRSSWVP
FT                   GQRAITTVLLIAAFAAWLGGRRLIERGLAWIALNRLPPTRLRRSALALSTALSTFLATA
FT                   IAIQILYLAVARHYELTPSLTDLWDQFAKLAATCALIAGLGRALLCTKHPSWRLPALAD
FT                   PVALAMKPFPSILAGLLLVSGTLESINRIVDTSLSVTLFGRGIVSLVVALTVGASLLRA
FT                   NRARSALAAAGEAPEQRSTLAGLIHAGVTLAIVASLIALLIGYITVARFITYELVWFEI
FT                   VLCATYILIQLTRDASESLFSSSLSTGQQIKHLFALEDRHLDQARTVLSGFGTSLLMLI
FT                   AAIALVTGGFGTTPGDLLDSAVAMIGSQRLQSLNIMPDRILNAVIGFAIGFYLLRSLRR
FT                   WLDGEFMPALGMDTGMRVSLITLFTNVGYVLLVLMTLGLLGVRWNNLAWIVSALSVGIG
FT                   FGLQEIVKNFVSGLILLTERPVKVGDMVSIAGVEGDIRRINVRATEIQLSDRSTVIVPN
FT                   SQLISQNVRNVTMGNSTQGVATLVLTFPLNTDPEQVRDLLLDAYREHPAILDKPAPSVT
FT                   FSQLAPDGITLSVTGYVSSPRIASSTKSDLLFEILKQLRAAGITLSSPQMLVVQNMPAN
FT                   DGPTPHES"
FT   sig_peptide     complement(136263..136367)
FT                   /locus_tag="Bcen_3100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.849 at
FT                   residue 35"
FT   gene            136824..138242
FT                   /locus_tag="Bcen_3101"
FT   CDS_pept        136824..138242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3101"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0382 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3101"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77997"
FT                   /db_xref="GOA:A0A0H2XUW8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW8"
FT                   /protein_id="ABF77997.1"
FT                   /translation="MASTDSLPQAQAPSPSIDPGSISARLDRLPPTRSVWKLVVLLSLG
FT                   FFFELYDLLYSGYVAPGLVKSGILSATTHGLFGTTGVASFIAALFSGLFIGTIACGFLA
FT                   DRFGRRAIFTWSLLWYTAANVVMAFQDTATGLNFWRFVVGLGLGVEMVTIGTYISELVP
FT                   KQIRGRAFACEQAVGFVAVPVVAFLAYLLVPHAPLGLDGWRWVVLIGAHGALFVWWIRR
FT                   ELPESPRWLAQQGRVDEADRIMRALEAKVEAEYGRPLPPPAPAEPVPPRGSFRDMWVPP
FT                   YRSRTIMMTIFNVFQTVGFYGFANWVPTLLIKQGITITSSLMYSSVIALAAPIGPLIGL
FT                   VIADRFERKSVIVAMAAAIVVCGLLFSQTTVGAFLIVLGIGLTLASNIMSYSFHAYQAE
FT                   LFPTSIRARAVGFVYSWSRFSAIFSSFVIAAVLRGFGTFGVFAFIAGAMVVVMAAIGWM
FT                   GPRTKGIALETISK"
FT   gene            138640..139965
FT                   /locus_tag="Bcen_3102"
FT   CDS_pept        138640..139965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3102"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77998"
FT                   /db_xref="GOA:A0A0H2XSV8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSV8"
FT                   /protein_id="ABF77998.1"
FT                   /translation="MRRTCRWLARKMRRSQQHHAAAGSADGFEPMILSHLARRFAQPRC
FT                   LNRAIAAYVGLAAAVSISVVAERPAFAASDAPSSAVQSSSVASPASAASRTHPASSAHA
FT                   VSGASAAAPTSGASHANHANHAEFASAASGASAASSASAASAASAAAPASAASGTPASE
FT                   AEPPPPTPPRRHPPLSAEEAQNVTARALDMRKRFTQEVTRRLNVPASEQRAYGDRLQKA
FT                   LADADLGDLAGEYVAMVDRAPNVQALFIYFRATPANAWLMIGASPVGTGLPGQYDHFLT
FT                   PLGVFHHSPDTMDFRAEGTTNENGIRGYGHRDMRIYDFGWVDGERGWGKGGVSPMRFQM
FT                   HATDPDRLEALLGVRHSKGCVRIPASLNTFLDQHGLLDDDYQARVEAGKSLWVLRRDRD
FT                   ITPIAGRYLVVIDSARKTRPAWSPLPGRGAWSKLPKGGDTAD"
FT   gene            140127..141239
FT                   /locus_tag="Bcen_3103"
FT   CDS_pept        140127..141239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3103"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B0385 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3103"
FT                   /db_xref="EnsemblGenomes-Tr:ABF77999"
FT                   /db_xref="GOA:A0A0H2XU29"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU29"
FT                   /protein_id="ABF77999.1"
FT                   /translation="MKTLYKLAPLAMLGAFATHAGAQSSITLYGLISAGVGFATNQGGK
FT                   NAWQALSGTNQNPRWGLKGKEDLGQGLSAVFQLENGFNVMTGTAAQNGREFGRMAYVGL
FT                   ADRTYGALTLGRQYDAIHDYIGPVIIASNGVNIGDNDNGYNDIRVQHSVKYVSPVYYGL
FT                   KFTALYGFSNTTGFANNSAYSFGLGYERGPLRWSVVYAQYNHPYSATNQDGAIANDYAS
FT                   PLLIFSKSAMSPAAYASRQRIAGTGGFYTIGRAQFAAMFTDVRYDYLDNSHLHLQNLGV
FT                   NVVYTMTPQLFLGAAYAFTNGKYDVIDKRPKWHQVNLQADYFLSKRTDVALTVIAQQAA
FT                   GDADHAQIFAYARSTGTRQMMATLGVRHVF"
FT   sig_peptide     140127..140195
FT                   /locus_tag="Bcen_3103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.787 at
FT                   residue 23"
FT   gene            141250..142302
FT                   /locus_tag="Bcen_3104"
FT   CDS_pept        141250..142302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3104"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: Inosine/uridine-preferring nucleoside hydrolase;
FT                   KEGG: bur:Bcep18194_B0386 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3104"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78000"
FT                   /db_xref="GOA:A0A0H2XUW1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW1"
FT                   /protein_id="ABF78000.1"
FT                   /translation="MTHPIASRRTFLKLSAALAGTALLPETGAFAAGGDAARRTVIIDT
FT                   DPGQDDAIAILFALGAQDRLDVRALTAVAGNVPLDLTERNARIIRDWAGRTNALPVYAG
FT                   CPRPLVRELVTAANVHGKTGLEGVELHAPRAPLAAGHAVSYLVDTLSRAAPNSVTLCAL
FT                   GPLTNIATALVEAPQIRAALREIVLMGGAFFERGNITPAAEFNVYVDPQAAEVVFGSGV
FT                   PIVVLPRDVAVKAPITPARVAPFRALGNRCGAIVADIMEAELAYNKKRRGVEDAPMYDP
FT                   TAVGYLVDPTLFGGRKVNVVVETTGQWTLGETVVDWNGRSGRAANATWINEVDADRFYA
FT                   ALVERIAKLP"
FT   sig_peptide     141250..141345
FT                   /locus_tag="Bcen_3104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.981 at
FT                   residue 32"
FT   gene            complement(142337..143314)
FT                   /locus_tag="Bcen_3105"
FT   CDS_pept        complement(142337..143314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3105"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0387 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3105"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78001"
FT                   /db_xref="GOA:A0A0H2XTL7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTL7"
FT                   /protein_id="ABF78001.1"
FT                   /translation="MSCVGSCSAVLYCRVPHPDRYYPMSDRSSLLPALTLRQVQHFVVL
FT                   AHARSFTQAALALSLTQPALTASIRQIEFLLGGRLFARSAHRLTLTTAGEAVLPLAERL
FT                   LNQARGTFDDMTRLIGERIQTVRIAFIPSVAGRLLPALNALRGTHPTLRFTLTDLPNSA
FT                   LVEAVRDGVADLGIGVREPDGDDGTLRYQQLFEDEIVIVVRHDDPLARAKSVTWAKLVD
FT                   RELAVFVRGSVSESLHRTGGAEKLRLNVTYRMEYTEPLYALARNGLATAVLPSLYTMHL
FT                   HDPELVALRVDKPRVTRAISLISLAADDRGPHVRACREWIAKQI"
FT   gene            143340..144689
FT                   /locus_tag="Bcen_3106"
FT   CDS_pept        143340..144689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3106"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bur:Bcep18194_B0388 xanthine/uracil/vitamin C transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78002"
FT                   /db_xref="GOA:A0A0H2XUX1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX1"
FT                   /protein_id="ABF78002.1"
FT                   /translation="MSATDTMPARTPANWLERRFALAARGTSVRTETIAGVTSFLAAAY
FT                   LLVVIPSLLATGGMERGAATTATIVVFVLFTTLMGLYANLPFLVGPGIGGSVIIGVTLA
FT                   TTEHVGWQTGLGIACVSGVLFFLLTILGARGVVVRLIPVQIKLGLGASIGLFVTMLGLR
FT                   NAGMVVANAKTNAFALGDFSRPGALVALIGLAVAIVLQARKVPGAILIAILVAAAAGVP
FT                   LGVTHLPASFMSLPHSIAPIAFKLDIGSALSLAAAPYLFAFFAAEFFSTLGTALAVGAK
FT                   ANLLDEQGNLPNINRPFLVDSLAATLGPVFGIPALTALIESAAGVEAGGRSGLSSLAAA
FT                   VLFAAMLLFVPVALAIPKEATAPALILIGLSMFATIRHTHFDDFTDALPVMSMVLLTLM
FT                   SNSFGTGIAGGLLCYVLVKLLAGRWRDVSWGLVVLAIPLGYYFWTVVKPH"
FT   gene            144735..145835
FT                   /locus_tag="Bcen_3107"
FT   CDS_pept        144735..145835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3107"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: bur:Bcep18194_B0389 adenosine deaminase
FT                   TIGRFAM: adenosine deaminase; PFAM: adenosine/AMP
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78003"
FT                   /db_xref="GOA:A0A0H2XSW1"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSW1"
FT                   /protein_id="ABF78003.1"
FT                   /translation="MKGTPGNVPAARTGIEITPAHRAFFRALPKVELHCHLLGAVRHDT
FT                   FVALAERSGAPIERAEIDGFYARGEKPVGVLHVLRALDKYLLTQPDDLRRIAYEYLEDA
FT                   AAHNVRHAEFFWNPTGTVRVSGIAYPDAQAAIVTAIRDAARDFGIGARLIPSIDREQDP
FT                   DEAVAIVEWMKANRADEVAGLGIDYRENDRPPELFWKAYRNARAAGFRTTAHAGEFGMP
FT                   WRNVETAVDLLQVDRVDHGYTIVDNPELCARYAERGIVFTVVPTNSYYLRTLPPEQWAE
FT                   LHPMRKMPGLGLKIHPNTDDPTLHKVNPSEAWELMFSHFGFTVADLKQFMLNGIDGAWV
FT                   DDATKAAWRAAWAPEFDALAATLAAG"
FT   gene            complement(145870..148101)
FT                   /locus_tag="Bcen_3108"
FT   CDS_pept        complement(145870..148101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3108"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: glycosyl transferase, family 51; KEGG:
FT                   bur:Bcep18194_B0392 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3108"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78004"
FT                   /db_xref="GOA:A0A0H2XU34"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU34"
FT                   /protein_id="ABF78004.1"
FT                   /translation="MNHFVPFLRDAWLRCRARVTPLAAACRTRVRALGAGMLHRLRHPT
FT                   RRGVALTLAAIPVLGLLVLLAFVPFTPSIGDIRKARIDRPARVLSADGQLIAEFRPVNR
FT                   EWVPLKQISPHMIDALIATEDHRFYAHHGIDWRRTLAAGLHTFSGDRQGGSTITQQLAR
FT                   NLYPDEVGRAPTLTRKVKELITAFKIEAVYSKDEILETYLNTVPFLYNAYGVEMAARTY
FT                   FGKSADQLDLTESATLVGMLKGNSYYNPVLNPERAVQRRNVVLGRMAQMGMLSPQQFAK
FT                   LQRQPLRVDFEPQTSQPGLAPHFAVQLRKWLIAWADRNNYDLYSDGLVVRTTLDARLQD
FT                   MATQALTRQTERLQAIADGAWRGPSGCGLRNDLFRGFMRQTPEYRQARDTGLADVVALK
FT                   QLGANREFVRALCERKTQVQAGFVAIDPRNGAIRAWVGSPDFGSEPFDHVVQARRQPGS
FT                   TFKPFVYGAAFADGMRPSDTFVDGPVAIPIDGRAVWWPTDAEPPTGAPMTLRDGLALSR
FT                   NRITAQVMQREGAAKVAQLARAMGVRDSPLDAVPSLALGTSPVTLKEMVSAYGTIANRG
FT                   VYVAPQMITRIEDRDGKVLAAFGSAPPERALSAPAALTLVDAMRGVVDYGTGADIRSRY
FT                   GIRIDVAGKTGTTQDNTDGWFILMHPQLVAGAWVGFDDGSVTLRSDYWGAGAHSALPIV
FT                   GSFYDAALRARAIDPHVQFSPDFRPRSAPAPKRRAPQHSGLFDWLRFFR"
FT   gene            complement(148226..149734)
FT                   /locus_tag="Bcen_3109"
FT   CDS_pept        complement(148226..149734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3109"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0395 transcriptional regulator, GntR family
FT                   with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3109"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78005"
FT                   /db_xref="GOA:A0A0H2XUW4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW4"
FT                   /protein_id="ABF78005.1"
FT                   /translation="MARTARIVEIPSLGVLDRAAGDLSRQLAQALRDAVRRGDVRPGDT
FT                   LPSTRLLAASLHVARGTVVDAYAQLIAEGFLESRGGAGTRVANALAEPSPGNTSESPTP
FT                   RVDPARHALPEPAAAFARLAREFSPLPAMPFAISVPLGLTAPDDIWRRLGNRLRARGAG
FT                   APSGYADPQGALPLREAIADYVRRSRSVRCDAGQVVITSGTQQGLHLASQVLLGANDRA
FT                   WVENPAYRGITALLESTGRRDAMVRVPVDADGLDVDAGIRVAPDARAAFVTPSHQYPLG
FT                   MPLSMARRNALLAWARTHRAWIVEDDYDSELRYEGYPFPSLQGLAPDRVIYLGTFSKIL
FT                   FPSLRLGYVIAPDDLVPAFCGARVLMDRHAPTADQHVLAAFIAEGHLDRHIRRVRGVYA
FT                   EQRAALIDTLGARLPRERAWVQPGDQGMHVVLWLAAGIDDLDVVARAAQAGVAVRAVSP
FT                   MFAPGTARPGLVLGFGGFGRAQMEAAAQRLADVVSSVESRPRAR"
FT   gene            149858..150496
FT                   /locus_tag="Bcen_3110"
FT   CDS_pept        149858..150496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3110"
FT                   /product="negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   bur:Bcep18194_B0396 negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3110"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78006"
FT                   /db_xref="GOA:A0A0H2XTM2"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTM2"
FT                   /protein_id="ABF78006.1"
FT                   /translation="MYVPADFNEPNPDALRELIVQHPFGSLITRGKNGLDANHIPFELM
FT                   PDDGGLGELHAHVARANPVWQDVADGDEVLVIFRAGDAYISPNWYPSKHVAHRQVPTWN
FT                   YRVVHAHGRITVRDDEKFVRGVVARLTRTHEASQPVPWKMGDAPPDYIDTMLQAIVGLQ
FT                   IEITRLVGKRKLGQNKAEADIRGAGEALVADGKLVIGEAMLAEADAKRE"
FT   gene            complement(150549..151130)
FT                   /locus_tag="Bcen_3111"
FT   CDS_pept        complement(150549..151130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3111"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin; KEGG: bur:Bcep18194_B0397
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78007"
FT                   /db_xref="GOA:A0A0H2XUX5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX5"
FT                   /protein_id="ABF78007.1"
FT                   /translation="MLPRLKTAALVIALAATAGLAAFAGTRDDAGVQASPAGMTAPAFT
FT                   GIDRWHNSAPLTLDQLRGKVVLVDFWTYSCINCIHTIPYVNDWYRKYRDQGLVVVGVHT
FT                   PEYPFERDAGNVADAIRRFDIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVYTRY
FT                   GEGGYDKTEAAIRGALTQAGEGMKSATRTQ"
FT   sig_peptide     complement(151056..151130)
FT                   /locus_tag="Bcen_3111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            151366..152106
FT                   /locus_tag="Bcen_3112"
FT   CDS_pept        151366..152106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3112"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_B0398 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78008"
FT                   /db_xref="GOA:A0A0H2XSW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSW5"
FT                   /protein_id="ABF78008.1"
FT                   /translation="MDKIDHVLIVDDDRAIRELIADYLEKNGMRVSLAANGREMRNALD
FT                   DGAPDLIVLDLMLPGEDGLTLCRDLRAGKFRTVPVLMLTARGEETDRIIGLEMGADDYL
FT                   AKPFAVRELLARIRSVLRRARMLPPGMQVTETAALLAFGEWQLDTTGRHLLDTEGTLVA
FT                   LSGAEYRLLRVFLDNPQRVLTRDQLLNLTQGRQSDPFDRSIDLLVSRLRQRLRDGAREP
FT                   RYIKTLRNEGYVFSSAVTAVDGTP"
FT   gene            152103..153425
FT                   /locus_tag="Bcen_3113"
FT   CDS_pept        152103..153425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3113"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bur:Bcep18194_B0399 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78009"
FT                   /db_xref="GOA:A0A0H2XU39"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU39"
FT                   /protein_id="ABF78009.1"
FT                   /translation="MSARAPWHWPRSLFARLALILCVGLALAQTLSFWLTVTERDQATT
FT                   NLMMGYIEREVASSVALLDHLPPAERTAWLPRLARRSYAFILGPGQTGTPPEARLSARV
FT                   ERSISDGIGGDYPLTANSIPGDREHLQVHLRLTDGSPLTIDIHPMSTVPLSGWLPAVLV
FT                   VQLAVLAACCWLAVRLATRPLKQLAQAADALGPDLKGERLNEDGPSEVARAARAFNAMQ
FT                   DRIAQYMAERMQILASISHDLQTPITRMRLRVDVMDDDTQGAKLRQDLLEMEHLVKEGV
FT                   AYARTLHGTEEVARRIDLDALLDSIVYDYTDAGQDVALHSRAPLALVTRPKALRRIVGN
FT                   LVDNALKFAGAAEIDVQAAPDGGAVIAVLDRGPGIPDDQLDAVFEPFRRVETSRNRETG
FT                   GTGLGLAIAKQLALAMGGTLTLNNRADGGGLEARLTLRNAG"
FT   sig_peptide     152103..152189
FT                   /locus_tag="Bcen_3113"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.992 at
FT                   residue 29"
FT   gene            complement(153507..154118)
FT                   /locus_tag="Bcen_3114"
FT   CDS_pept        complement(153507..154118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3114"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_B0400 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3114"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78010"
FT                   /db_xref="GOA:A0A0H2XUW7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW7"
FT                   /protein_id="ABF78010.1"
FT                   /translation="MPVPSQLLFLPGASGSTAFWQPLAGMLTHPAERRIVAYPGFGDTP
FT                   RDPAVDDFDGLVRHVLATVDRPTAVIAQSMGGVIAMRAALDKPDLVTHLVLTVTSGGLD
FT                   MAGLGAQDWRAGFAEANPRLPDWFMTFRADLSQDIGRIAQPTLLLWGDDDPISPVAAGR
FT                   RLLEWLPDARLHVVPGGRHDLAAVHAQALAPLVDAHLQRV"
FT   gene            complement(154177..154911)
FT                   /locus_tag="Bcen_3115"
FT   CDS_pept        complement(154177..154911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3115"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   bur:Bcep18194_B0401 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3115"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78011"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTM8"
FT                   /protein_id="ABF78011.1"
FT                   /translation="MKIAALSDIHGNLAALDAVLDDVRRRGADVIVNLGDIVSGALHPA
FT                   ETADRLIALDLPTIKGNHERQLLTLDRDAMRLSDRWAHDTLRADHRAWIAALPERLTLD
FT                   GDVLMVHGTPASDLVYFLETVTPDGCRAATPDEVAQRAGDTAASLILCGHTHVPRTAKL
FT                   DDGRLIVNPGSVGLQAYADDLPHPHRIETGSPHARYAMVSRTAAGWSVEFHAVEYDWHT
FT                   AAAIAASRGRDDWTVALRTGRC"
FT   gene            complement(155022..155558)
FT                   /locus_tag="Bcen_3116"
FT   CDS_pept        complement(155022..155558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3116"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0402 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3116"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78012"
FT                   /db_xref="GOA:A0A0H2XUY0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY0"
FT                   /protein_id="ABF78012.1"
FT                   /translation="MKIATPPRAGFPGLSLRQLERADLDAWYAYLSNPDVFRHTSWNLR
FT                   SPDDLLPMFDNIESTDPDSIRRLAIVDTASGALAGTIGLHTVSTVNRSAEIAYDLAPSH
FT                   WGRGIASAVCDAVTAWAFTHGGFMRMQAVVLTSNAGSARVLQKCGYRYEGLLRAYKMVR
FT                   GTPGDFAMYARLATD"
FT   gene            complement(155571..156203)
FT                   /locus_tag="Bcen_3117"
FT   CDS_pept        complement(155571..156203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3117"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0403 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3117"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78013"
FT                   /db_xref="GOA:A0A0H2XSW8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSW8"
FT                   /protein_id="ABF78013.1"
FT                   /translation="MHETTLLIFAAVAFVGIATPGPTVLLALTNGSRYGVRRAAFGFAG
FT                   AMLSDFVLIVAVALGLGALLMASAFWFSVVKWLGAAYLAYVGIRLLTSKGALDVVVAQR
FT                   GTASGRNASIFAKSFLTAVTNPKGYLFFSAFLPQFLDPLAPLAPQYVVLAVTFALLDGA
FT                   VMFGYALLGARAVRLLKRSGALWLERTCGAMLLALAGSLALYRRHAA"
FT   sig_peptide     complement(156120..156203)
FT                   /locus_tag="Bcen_3117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.762 at
FT                   residue 28"
FT   gene            complement(156522..157574)
FT                   /locus_tag="Bcen_3118"
FT   CDS_pept        complement(156522..157574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3118"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: putative transposase, IS891/IS1136/IS1341;
FT                   KEGG: noc:Noc_1587 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78014"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU44"
FT                   /protein_id="ABF78014.1"
FT                   /translation="MILVYRYRVKSLNGLLNKQGRAVNYVWNFCNDTQKHALKWSKKWP
FT                   TGFDLNVLTTGSSKELGIHSGTINATCEQYAKSRSQCRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEGKIKDGSNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDRFGRRAAENLAKAQRARKHKRHIAKLHAKIANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAAKLARTRMAKSVYDASWSSFRNKLRYKAMAHGATF
FT                   EEVDESGSTQSCSACGSKDSTTRPKGIAGLRIREWACSRCGVEHDRDTNAALNILRCGR
FT                   ASPDVGILSL"
FT   gene            157592..158857
FT                   /locus_tag="Bcen_3119"
FT   CDS_pept        157592..158857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3119"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B0404 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3119"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78015"
FT                   /db_xref="GOA:A0A0H2XUX0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX0"
FT                   /protein_id="ABF78015.1"
FT                   /translation="MEEAACQQHSFPSRHQWRGFSEQLMNKQLIAAPLLLSLASVAAAQ
FT                   SSVTLYGIVDAGVTYRSNERVGSAGAYTGHSSVGLTTGNLSGSRWGIKGSEDLGGGMRA
FT                   LFVLENGFDITNGTSGQGGRQFGRQAFVGVGSDRYGTVTLGRQYTSLDDFVSPVGPSSF
FT                   IGGFGAHPGDIDDLDQTARVDSSIKYTSANYSGFTFGALYGFGGQPGSMKQRNTWSVGA
FT                   AYAAGPLRVGVGYERSDNSKKGATDPTAGKWQSTDDGLFNSSINEGYASAQSQQVIATG
FT                   ATYDFGPAVVGVNYSNVQYRGGAQSLFSGHATFNVAGVFTRWNVQPQTQLFAGYSYTRG
FT                   SDVDGIDNRAQYHNVTLGAVYDLSKRTSVYLLGAYQHASGTTLDALGRPVAATASVSDK
FT                   ANGHSSDSRSQAIVSLGLRQKF"
FT   gene            159482..161407
FT                   /locus_tag="Bcen_3120"
FT   CDS_pept        159482..161407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3120"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78016"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTN2"
FT                   /protein_id="ABF78016.1"
FT                   /translation="MSMKQIRAALLIMCMAMWAPASHAQAQYSTDWLANTYGTLASHVG
FT                   NGARSMWVAPEGVIYTASRWDENAGGVAIYQNGQLLGTIGIHDEFHGGAITGNSTSLFV
FT                   ALGYNRTFGSGSVGRYNRSTNQRDLRIPVSTWTGIQYADVITGLATGGNLLYVSDFYGN
FT                   RVRVYTTDGVWQRDIGVTGPGALALDAAGNLWVARKSAGVVAQFSPTGTAMNTLQMAAG
FT                   ARPASLYFDASMGRLMVGDEGPDMNIKLYGGLPGLPVQVGTFGVQGGYLDTTTGIKGQV
FT                   GDKRFTRVAALGKDAAGNLYVLNNAWGGGWDLGRNGSTDLHAYSPVGTLQWKLQALNFE
FT                   GIAAPDPVTDGTLFYSGNNIYTGTAGGTFVANTVDPFTYPKDPRLDMNDYQRGQHFGQL
FT                   VSVGGNRILVASGQNPGNFNFYYFNTASGYIAIPAGSLPGKPFNTTLQVTAGFDIDGNG
FT                   DVWAGLNGSNVITRYPMTGFDATGKPSWGKPVTTAVPSSVAPVTRIIYQADSDTMILAQ
FT                   GLAGNWDWTAMNGHIEVYHGWKNGNTSAPNPVINLTSANPKSIAAAGHYLFVGYVHTVP
FT                   NIDIYDLNTGALVTTLTNSNPSAMDVGNDVDSMYGVRAYLRSTGEYVITKDNYNGSSIV
FT                   VYRWRP"
FT   sig_peptide     159482..159556
FT                   /locus_tag="Bcen_3120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.889 at
FT                   residue 25"
FT   gene            complement(161421..163589)
FT                   /locus_tag="Bcen_3121"
FT   CDS_pept        complement(161421..163589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3121"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; KEGG: bur:Bcep18194_B0414
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78017"
FT                   /db_xref="GOA:A0A0H2XUY5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY5"
FT                   /protein_id="ABF78017.1"
FT                   /translation="MPSRRTPCRARTLHPWRMPLPALLTLCVASGAHAAGAEPVAPAPA
FT                   AAPAAEHELPAISINASAAVDPTIGYQPRTTNIAGGDARALKEIPQSVAVVSSSVMQDQ
FT                   QARSLDDVLGNISGVTQTNTLGGTRDAFIKRGFGSNNDGSVLVDGVRTPVLHSYLATID
FT                   RVEVLKGPASLLYGMQDPGGVINLVTRKPEDTFGGSISASRTNHGGSNAQFDLTGPLGK
FT                   PGQVAGGTLAFRLTGEYDTSRYWRSFGRERNALIAPALSWHDANTSIDVSYQYVDYTMP
FT                   FDRGTVLVNGQLDEALRYRRYEEAWSQSSGIQETLRTRIEHRFSDAWRVRATYGWGRDR
FT                   YDQFITRATAFNSRTGALTRSSDANLGRNDSDQIATLGLLGNVTLAGMQHAIYVGGEYE
FT                   RQRSFRGDTIRGKATTGFNLYDPVYGLLAPGGMANAKQSDSRSVVHAYSTIVQDSVKIT
FT                   DRLTAVGGLRWENWQQESGMGRPFVFADRSRGSVWLPQFGLAYALTPALTAYANVSRSF
FT                   KPNVASNVAAPLAPEYGRVLEAGLKFSLKPAITGTLAVYQIDKRNVAVTVGDLTSTIGT
FT                   ARSRGIELDVAGQITRHLSVIGSYAYTNANDRDSNTPLVNVARHTGSLFAVYDTAIANL
FT                   PGRWRFGGGARLVGARSGDTANSFTLPGYVSVDAFAAYETTIGKFPTRFQLNVKNLLDK
FT                   TYYPSSNSNLIVAVGEPRLVTLTTTVSF"
FT   sig_peptide     complement(163485..163589)
FT                   /locus_tag="Bcen_3121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.926 at
FT                   residue 35"
FT   gene            163990..164436
FT                   /locus_tag="Bcen_3122"
FT   CDS_pept        163990..164436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3122"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSX2"
FT                   /protein_id="ABF78018.1"
FT                   /translation="MKKISAPFTAAALAACALLAGVQQAARAASNAEPAIDAHYGAVIE
FT                   AYTQDMAAAKTKYDGKRLTFVGAVIRMGSDPGGTYFGALTADGEQFDTHFDVPDQDALK
FT                   PKFPGGEIKPFVTSSAFRFSCVNEGYIDAPVLPGLKLAHCRLAD"
FT   sig_peptide     163990..164076
FT                   /locus_tag="Bcen_3122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.667 at
FT                   residue 29"
FT   gene            complement(164615..165580)
FT                   /locus_tag="Bcen_3123"
FT   CDS_pept        complement(164615..165580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3123"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: bur:Bcep18194_B0419
FT                   ferredoxin/oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3123"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78019"
FT                   /db_xref="GOA:A0A0H2XU49"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU49"
FT                   /protein_id="ABF78019.1"
FT                   /translation="MSGATLTVRVARKWQEARDICGFELVSDDGSPLPRFDAGAHIDVH
FT                   LPGGLVRQYSLCNHPEQRDRYQIAVLREADGRGGSRAIHDEIRQGDTVRIGLPRNQFPL
FT                   APDAPHHLLLAGGIGVTPILAMAERLFSAGMPFDMHYCARSTDRMAFVERINAAGFHDR
FT                   VRFHVDDGDPAQRFDLAAVLAGAPDGTHLYVCGPRGFMDAVLNAAREREWSEARLHYEF
FT                   FGGAVVSSGADRAFQVQIASSGKVIDVPAECTVIAALAANGVDVLTSCEQGVCGTCLTR
FT                   VLEGEPDHRDTYLTDDEKAAGDQFMPCCSRSRTDLLVLDL"
FT   gene            complement(165577..166656)
FT                   /locus_tag="Bcen_3124"
FT   CDS_pept        complement(165577..166656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3124"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="PFAM: Rieske [2Fe-2S] region; KEGG:
FT                   bur:Bcep18194_B0420 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78020"
FT                   /db_xref="GOA:A0A0H2XUX2"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX2"
FT                   /protein_id="ABF78020.1"
FT                   /translation="MFLKNAWYVACTPDEIDGKPLGRKICNESMVLYRAADGQVAALED
FT                   FCPHRGAPLSLGFVRDGVLVCGYHGLEMGCNGKPAGMPGQRVGGFPSIRSFPAVERYGF
FT                   VWVWPGDASEADPAKLPALAWAEDPAWAHGGGLYHIRCDYRLMIDNLMDLTHETYVHAS
FT                   SIGQKEIDEAPPKTTSHGDEVVTSRFMENVMPPPFWRMALRGNGLADDIPVDRWQICRF
FT                   TPPSHVMIEVGVAHAGHGGYDAPPNKKASSIVVDFITPETDTSIWYFWGMARNFRPDDA
FT                   ALTAEIREGQGKIFAEDLEMLERQQRNLEQWPERTLLKLNIDAGGVLSRKVIDRLLAAE
FT                   HAASPQRPVIPVAQVKAAS"
FT   gene            166858..167346
FT                   /locus_tag="Bcen_3125"
FT   CDS_pept        166858..167346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3125"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG:
FT                   bur:Bcep18194_B0421 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3125"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78021"
FT                   /db_xref="GOA:A0A0H2XTN8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTN8"
FT                   /protein_id="ABF78021.1"
FT                   /translation="MEKTTPADLPAFPIDLYDEPGHLIRRAHQIAVAMFYEKLGRDVTP
FT                   VQYAVLRMLYENPGLDQVTLAQRVALDTSTTADLAVRLEAKGLIVREVLPRRQRRLLLT
FT                   PAGVELLTHLIPSVTELRAGLFDGMGEDDSQELMRLLRKFVHLNNEQSRAPLRVSEDS"
FT   gene            complement(167401..168147)
FT                   /locus_tag="Bcen_3126"
FT   CDS_pept        complement(167401..168147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3126"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_B0422 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78022"
FT                   /db_xref="GOA:A0A0H2XUY9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY9"
FT                   /protein_id="ABF78022.1"
FT                   /translation="MTAAPADTMTATAKADRADSSRAPAGRKSQQRVQDILRAGREVFA
FT                   EKGYEHATAAEIAQRVGVSEATVFSYFRGKRELCARVIADWYDEIIAAFEHGMPREASV
FT                   QQQFAFIVRTHLRLMLVNGTGLCALVLSEGRAKQHALSDELTALQRRYTAPLMDVLARG
FT                   QAAGQVRADLPLSLLRSMVFGPMEHVLWDAILGHRKLDTETTATQLIDMLWAAVQPPAP
FT                   EQAALVRFRNEVAEAVRRLEGEASRG"
FT   gene            168318..169499
FT                   /locus_tag="Bcen_3127"
FT   CDS_pept        168318..169499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3127"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   bur:Bcep18194_B0423 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78023"
FT                   /db_xref="GOA:A0A0H2XSX7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSX7"
FT                   /protein_id="ABF78023.1"
FT                   /translation="MINLPGVQFMLGEDIEMLRDAVATFAAKEITPRAAEVDRTDQFPM
FT                   DLWKKFGDLGVLGMTVSEEYGGANMGYTAHMVAMEEISRASASIGLSYGAHSNLCVNQI
FT                   HRNGTEAQKQKYLPKLVSGEHIGALAMSEPNAGSDVVSMKLRADKRGDRYVLNGTKMWI
FT                   TNGPDCDTLVVYAKTDIEAGPRGITAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFQD
FT                   VEVPEENILGQLNGGVKVLMSGLDYERAVLSGGPTGIMAACLDAVVPYIHDRKQFGQAI
FT                   GEFQLIQGKVADMYTTFQACRAYLYAVGRHLDSAGSDHIRQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEYPVGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETM"
FT   gene            169530..171137
FT                   /locus_tag="Bcen_3128"
FT   CDS_pept        169530..171137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3128"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG:
FT                   bur:Bcep18194_B0424 propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78024"
FT                   /db_xref="GOA:A0A0H2XU54"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU54"
FT                   /protein_id="ABF78024.1"
FT                   /translation="MPIIESKLNPRSEDFRANAAALEAVVADLRVKIEQLAQGGGQAAR
FT                   DKHLSRGKLLPRDRIAQLLDPGAPFLEFSQLAANGMYNDDAPGAGVITGIGRIAGRECV
FT                   IVCNDATVKGGTYYPVTVKKHVRAQEIAAENRLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFFNQATMSAAGIAQIAVVMGSCTAGGAYVPAMSDESIIVKDQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVADHLAQNDAHALSIARNIVGHLAPKIAPPLALREPKP
FT                   PRYDAKSLYGVIPVDTRKPFDVREVIARIVDDSEFDEFKARFGTTLVTGFAHIWGHPVG
FT                   IVANNGILFSESAVKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVT
FT                   AVSNAKVPKFTVIIGGSFGAGNYGMCGRAFGPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDGIEAKGGSWSAEEEDAFKQPIRDQYERQGHPYYASARLWDDGVIDPAQTRDVLGLGL
FT                   AASMNAPIDDTRFGVFRM"
FT   gene            171157..171942
FT                   /locus_tag="Bcen_3129"
FT   CDS_pept        171157..171942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3129"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bur:Bcep18194_B0425 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3129"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78025"
FT                   /db_xref="GOA:A0A0H2XUX6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX6"
FT                   /protein_id="ABF78025.1"
FT                   /translation="MRYETIKVSEAGRVATVTLARPDVRNAFNETTIAELTTAFEWLDA
FT                   HEGVRAIVLAAEGAAFCAGADLNWMKKMAGYSDDENRADARKLARMLEAIYRCGKPVIA
FT                   RVHGDAYAGGVGLVAAADIAIAADGVKFCLSEARLGLIPATIAPYVVRAMGERAARRYF
FT                   TTAEVFDSTRAASLGFIHDAVPADALDETVAKLAATLVANGPDAVKACKRLVADVAGRA
FT                   LDATLIEQTAEWIAKTRAGAEAREGIASFLEKRTPSWRE"
FT   gene            171979..173976
FT                   /locus_tag="Bcen_3130"
FT   CDS_pept        171979..173976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3130"
FT                   /product="3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: biotin/lipoyl attachment; KEGG:
FT                   bur:Bcep18194_B0426 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3130"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78026"
FT                   /db_xref="GOA:A0A0H2XTP3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTP3"
FT                   /protein_id="ABF78026.1"
FT                   /translation="MFDKILIANRGEIACRVAATCKRLGIASVAVYSDADANAKHVAAC
FT                   DEAVHIGGSVAADSYLRIERIIEAARATGAQAIHPGYGFLSENEDFAQACEAAGIVFIG
FT                   PPVDAIAAMGSKAAAKALMHAAAVPLVPGYHGDDQDAANLHREADQIGYPVLLKASAGG
FT                   GGKGMRVVERSEDFPAALASCQREAASSFGNDRVLIEKYLTRPRHVEVQVFGDTHGNTV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLHEDVRQAMGEAAVAAARAVGYVGAGTVEFIMTGE
FT                   AFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLKQEELRVQGHALEARLYA
FT                   ENPARGFLPSTGTLKHLRLPAGVEFDIGASVRVDSGVREGDAITPFYDPMIAKLIVHGA
FT                   DRAEALGLMLRALRACEVVGLHTNAAFLQRIVACEPFAIADLDTGLIERNHDALFAPQQ
FT                   PPRATLALACAALLARERAAAQESASPWSSLPDWRLNGGYRRTLEWHATDREADVTVTY
FT                   EDDGTGTRIAIGDAAAQPFAWTRGATPLDFDVTLGGVRSSGRVYADGDTFHVFTQGAAE
FT                   TFEWRNLLAHAGDAEQGGGRLTAPMPGKVIAVLVEPGQKVEAGTPLIVMEAMKMEHTIG
FT                   APSAGVVADVLYGVGDQVADGAQLLMMAEG"
FT   gene            complement(174492..175595)
FT                   /locus_tag="Bcen_3131"
FT   CDS_pept        complement(174492..175595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3131"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4; KEGG: gsu:GSU2597 ISGsu2,
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78027"
FT                   /db_xref="GOA:A0A0H2Y164"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y164"
FT                   /protein_id="ABF78027.1"
FT                   /translation="MRGMDEMQEPLFTTVKLEDFVPADHPLRPLRLLVNQALKRLNGLF
FT                   GTIYADSGRASIAPEKLLRALLLQVLYSVRSERMLMEQMRYNLLFRWFVGLAIEDAVWD
FT                   HSVFSKNRDRLLEHEVVEAFFTEVMSLADKQGLLSREHFSVDGTLIQAWASHKSFRPKD
FT                   GSDDPPAGGGRNVDTDWKGKRRSNDTHESSTDPDARLFRKGRQSGAILCYQGHILMENR
FT                   SGLVVGAVVSHADGFGERASALRLLDRVPGRHAKTLGADKGYDMRDFVRDCRARKVTPH
FT                   VARNDAHQGGSAIDGRTSRHAGYGISQVIRKRIEEHFGWGKTVGRIRQTAYRGIKRVDQ
FT                   HFKLTMLASNLTRMARILAAVLQGAAR"
FT   gene            175916..178030
FT                   /locus_tag="Bcen_3132"
FT   CDS_pept        175916..178030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3132"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: bur:Bcep18194_B0428 phosphoesterase TIGRFAM:
FT                   Twin-arginine translocation pathway signal; PFAM:
FT                   phosphoesterase; protein of unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78028"
FT                   /db_xref="GOA:A0A0H2XSY4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSY4"
FT                   /protein_id="ABF78028.1"
FT                   /translation="MATHSRRDFLKFSAGLAGATAATALLPESIRKALAIEPNTVTGTI
FT                   QDVQHIVVFMQENRSFDHYLGHLSGVRGYNDRFPVTLPNGKPVWFQPRQEDKSSVIAPF
FT                   RYDTTNPGVNAQCIGGLPHTWATTHGAIDNGRADQWAVQKSNMTMGYHVRDDIPFHYAL
FT                   ADAFTVCDNYFCSIPGNTHPNRMYLMTGMVDPLGTGGGPLLDNTDYIDNQFDKIQLPPF
FT                   SWTTYPERLEQAGISWQIYQQGTGFDNFTGNYGTNMLACFNNFVNAPAGSSLQTRGMST
FT                   RPITQLKADVQANTLPQVSWLLPPAAYSEHPKFTPLYGAYYLSTILDALTSNPDVWSKT
FT                   VLLIMYDENDGFFDHVVPPSAPTLPGSGMSTVDVSLERHNVVTATQAGTYTADNLPYGL
FT                   GPRVPMFVVSPWSKGGFVCSQVFDHTSVLQFIEKRFGVMETNISPWRRAICGDLTSALD
FT                   FSKSDATLPTLPNTQAYVAQADLQCSRASSQTAPASTAQQVVTAQEPGTRPARALPYEL
FT                   HVTGQLQAQGYALTFANTGTQGAHFWVYTGDPTAMPRRYTVEAGKQLTDTWALDANGNY
FT                   LVSVWGPNGYFRRFAGSAAADAAAKPEITPCYDTANGDVYVTIANAGTGPLTVTATDVA
FT                   YGGAARTLTVPAGQRIEAHWDLSCSSHWYDLQFAVAGNAGWTRRIAGHVETGKPSITDP
FT                   AAVAPTIAAI"
FT   sig_peptide     175916..175990
FT                   /locus_tag="Bcen_3132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.885) with cleavage site probability 0.426 at
FT                   residue 25"
FT   gene            complement(178118..179503)
FT                   /locus_tag="Bcen_3133"
FT   CDS_pept        complement(178118..179503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78029"
FT                   /db_xref="GOA:A0A0H2XU60"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU60"
FT                   /protein_id="ABF78029.1"
FT                   /translation="MAGRAEAHPADRVRASRRSERAMIVLSHFSQHAPASLENHRWYAQ
FT                   GHGYRHEIVDASGMPQALPLRPLHRYESLLHVLRGAQPDELVLLLSEDAAIIEPVALDR
FT                   LMTGRDMLLVDAFASPLPQVDVQIWRNTPDVRAIVMRLAQRCKLGSEPRLTSEAALFAE
FT                   LDTHRYMTPIDGLYAVMPSGPDLDPMWSREPTFAISLDDTPHDPERKGATPRFRDTLVA
FT                   YVNRCRAAGRPLFTFDHAAAAPDEAAERSTYNPGRPIALMMLYTPNIGSYARVAERNFR
FT                   RYCDAHGYTLYVHRDIPAEIGLNATGNWFKPWLLHAYLQHHEWVVWLDADVLIANQQQP
FT                   LAPLLEGRDWLLAQDIGQWAFNSGVMAFRRTERNDAMLRDLMTTIAALHDRSSVYASDG
FT                   DQLHFIRAMERDGQLQREGVTDLVSLNTPWLFRRADSYIVHYYGMWSAMRALMMAHDDG
FT                   LLP"
FT   gene            179845..180987
FT                   /locus_tag="Bcen_3134"
FT   CDS_pept        179845..180987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78030"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY2"
FT                   /protein_id="ABF78030.1"
FT                   /translation="MTSPVLTGLRIGITIGLRAPDESLWINGIKQNALFLAKLLMASPH
FT                   GYRVTLVNTTDVPLTDALPWDRNVFDTRAFADMKDALDVVIELGGQIDGEQTAYLKARG
FT                   VKLVSYCCGVEYINAMESMLFGRRLWDSLFINRGYDEVWAIPQIAPSSLPFLQSLRRCP
FT                   GRVVPFVWDPMFLTERARSLPEHGEYRPRSEPGKRLTVMEPNHDVVKFCVYPMLIIDEA
FT                   YRRDPDAICFTHVTNADRLAHDSPEFVMLMNYLDIVRAGKASFVGRFDTPLFLADLTDI
FT                   VVSHQWSNPLNYFYFDVCWQGYPLVHNASLAPDLGYYYPDNDVQQGADALLRALHTHDD
FT                   DWQGYARRQREILGRYTSANPALVAEYDALLANLIGATVA"
FT   gene            complement(181202..181576)
FT                   /locus_tag="Bcen_3135"
FT   CDS_pept        complement(181202..181576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78031"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTP8"
FT                   /protein_id="ABF78031.1"
FT                   /translation="MRDADSATGYTTQITKTINPNRLSFSSKQFYLNHPLPDLLVARSG
FT                   ISPIDQINTTPQSAVRIRHAGLKHRPSTHAVTCGKPAAARDSITAAFNFLVSNDIMKFR
FT                   NGIKPHLINNTNFNYMKIIN"
FT   gene            181775..182578
FT                   /locus_tag="Bcen_3136"
FT   CDS_pept        181775..182578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3136"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL; KEGG: bur:Bcep18194_B0433 diguanylate
FT                   phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78032"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUZ8"
FT                   /protein_id="ABF78032.1"
FT                   /translation="MNAVEARQEANRKTNRDEIDLVFGAPDDHRDLASVRSFVESRLGF
FT                   AHEPVCRADLSGGVLYQECLARLRWGERDALPPLAFLPRLEALGLMRWFDRLVVGRTID
FT                   ALRADPAAVYGCNVAAASAVVDDVWLAIFRRLEREPSVAARLVIEITETGPLNPVAGRS
FT                   FVNRFRQAGCRIAIDDFGVGFSALNNLVVGNPDIVKLDRSVLSLIKRNAIGRYQFRRLI
FT                   AFAHEGARHVVVEGVESETDRQIIVDAGVAWAQGIRFSWRSPAAA"
FT   gene            182575..183066
FT                   /locus_tag="Bcen_3137"
FT   CDS_pept        182575..183066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSY9"
FT                   /protein_id="ABF78033.1"
FT                   /translation="MSAEAGRAARRVRVAVGTNRKGDVGMAGTKAGGGTGTQATDVRDL
FT                   VALAELADMLWQLGAESTDAPIDVAPYLDGLTTVARRIQRMSPLDAGGRELAARHYYAG
FT                   VIAGACGDESAIARGVSDSLVRQSGGAGRPAARCFVLLARMGRRHGRAFAAQSGDRVLV
FT                   "
FT   gene            complement(183124..185097)
FT                   /locus_tag="Bcen_3138"
FT   CDS_pept        complement(183124..185097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3138"
FT                   /product="Methyltransferase FkbM"
FT                   /note="TIGRFAM: Methyltransferase FkbM; KEGG:
FT                   bur:Bcep18194_B0435 methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3138"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78034"
FT                   /db_xref="GOA:A0A0H2XU65"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU65"
FT                   /protein_id="ABF78034.1"
FT                   /translation="MNQTVRNFVVIDSIHGPFVINRHCALQAEALIKTGRPHIQGELDT
FT                   ILQVIDQLPDGAIAVDGGANAGLVCVPIAHRLRERGGRVYAFEPQRTLFHALGGTVALN
FT                   QLDNLHLLNMGLAAANGTMKVPDVDYGQDADFGQVSLVDAQASGGTPTPVVRLDSLGLP
FT                   RLDFLKLDIEGMEIDALRGARRLIETHLPWCWIEYWKVGEARIIDTFAGLDYTFYRIDG
FT                   LNMLCVPNPRWDRQRLFITGEPLAVGSTAERGTDSATAAPTDADAPETNWNRALDHESR
FT                   GEWGHAIDRWQHARGRGLDDDAIALQLASCYGFAGTPEAGLAALDHFGDPAALPDAARG
FT                   RIQLARSALLLRAGRRDEAARATIDSENVLTAAQFGLPTERLYQGQPLHGKRLLILSYG
FT                   GVGDQLQYARYLHALDALGCAGVTVIVPDALTGLLRETFPRIEFVGAHGAWVDTSQLAH
FT                   DYWCSFLMLAALFGYAPTPEGMPAPYLTCPPAHAAAWRERVSHDGHAPGTRRIGLNWRG
FT                   RDESDARFHRAASLRDFAPLARMHGYAAYCLNRDLSAQSEQSDLPVTFPHHAIGDFGDL
FT                   AALMLAMDAVVTTCTAHIHLAGALGVPAVLLLSPKADARWETGSRTALYPGIRIVRAAH
FT                   VGRWDDAIDRAMALVLGGFGKD"
FT   gene            complement(185122..186258)
FT                   /locus_tag="Bcen_3139"
FT   CDS_pept        complement(185122..186258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3139"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78035"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY7"
FT                   /protein_id="ABF78035.1"
FT                   /translation="MKLNVAITMNVQRDATQSIWYNGANQHCVYLYMLLKQSPLIGEVW
FT                   LAHDDGITEYPQALMMDAFGDALRPLSAVVHQTDLLIEMNAFIDPSHTDVMRQRGGKCV
FT                   SYRFGNDYVIAVETINFEKNDWRPNPHRVQFDEIWTNPQHMHTCAAYFQAVYRAPVIEL
FT                   PHIWSPYFIERSLDADPELKARFGYRNHGPAKRIAFFEPNLNVVKSAIVPMLAANACYV
FT                   EHPELVEHVYMTNTFDKKENVAFKHLALGLEMVRDGKATADVRAPFVAWAAHHTDIVVS
FT                   HHWENGLNYLLYDALYGNYPLVHNSPFLRDVGYYYPDFEIFDAARAIATAAQTHDARLD
FT                   DYAAAARRCLHQVDTLAEHNVRAYSSQIQHLFADRPLS"
FT   gene            complement(186292..186759)
FT                   /locus_tag="Bcen_3140"
FT   CDS_pept        complement(186292..186759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3140"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78036"
FT                   /db_xref="InterPro:IPR025091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTQ2"
FT                   /protein_id="ABF78036.1"
FT                   /translation="MNARSTLTRAKWLIGCAAASIAIGAHAQAAGESADTLLRDSDAVF
FT                   KQLDAGQYGAVWSDAAPFVKARFKQDQFAAQMQQARQSVGAVGHRGWAQVTRIRYERTT
FT                   GMPDGLYANVDYATTLTSGATMFEKLSFRLETDGRWHLTGYVPRQTQSAAQ"
FT   sig_peptide     complement(186676..186759)
FT                   /locus_tag="Bcen_3140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.492 at
FT                   residue 28"
FT   gene            complement(186786..187940)
FT                   /locus_tag="Bcen_3141"
FT   CDS_pept        complement(186786..187940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78037"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV04"
FT                   /protein_id="ABF78037.1"
FT                   /translation="MSDSNARQAPGEGKRLVVGVSLFVRGAGQSLWENGIFQNCLLLIL
FT                   LLRQSPLVADAVMVNGGEQVADPQMMLGEWNVPLLSMDEALERCDVLIEMSAQFGADYL
FT                   RAFRERGGKVVTMRVGNDYVIDIERAMFDKPSGFLFSGAPYDAVWTIPEFERSCLHYYQ
FT                   TGLRAPVTIVPHIWHPMLFDKARATLGAGLSFGYQPAKPRWRVTMFEPNICMVKTSIIP
FT                   MLVTEEAYRAKPEFLEFVRVCNTIHLKEHPTFVHFAKSLDIVNHGITTFESRYAVYEFM
FT                   AAYGDAVVSHTWENAQNYLYYELLYGDYPLIHNSPFLGKAGYFYPDFDCQAGGRALLQA
FT                   FAEHDANLDAYREQSKHVLDSVSIYNPENVAAYTDAIATLYRDA"
FT   gene            complement(187955..189100)
FT                   /locus_tag="Bcen_3142"
FT   CDS_pept        complement(187955..189100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3142"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78038"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSZ1"
FT                   /protein_id="ABF78038.1"
FT                   /translation="MTDINEAAAGGTRKQRPAVGISLFARDGQAIWENGIHQNIAFLAM
FT                   MLKRSDRVGPVYFLNGGDANALPAGLELDGLDIPLVKPADVTHELDVVIEMGAQLPVEW
FT                   LRHMKALGKKIAAFFCGHVYAGLCETPIFGKPSGHVFNGAPFDEVWLLPQYDKTAAPML
FT                   RTILRAPVHLMPHIWSPYFLERRVATLADEGATFGYQPGQRPWKLAMLEPNISVAKSCH
FT                   YPMLACDAFYRARPDAVQHMFVVNSMHMKEHPTFVHFANSLDLVRQHKATFEPRLDLPG
FT                   FMARHADAVVSHHWENGQNYLYYDVLYGGYPLIHNSTLIGDAGYYYPDFDSAAGGRALL
FT                   EAWLHHDERLDDYRAKAGRLLQSVSIDNPANLDAFVSRLVA"
FT   gene            complement(189501..190166)
FT                   /locus_tag="Bcen_3143"
FT   CDS_pept        complement(189501..190166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3143"
FT                   /product="OmpA/MotB"
FT                   /note="PFAM: OmpA/MotB; KEGG: bur:Bcep18194_B0440 outer
FT                   membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78039"
FT                   /db_xref="GOA:A0A0H2XU70"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU70"
FT                   /protein_id="ABF78039.1"
FT                   /translation="MNKLALALALSATALAACSTASGPTFSASELQPRDGVRTFQVDCH
FT                   GLLSGPQTCMKAARKICGDEPVRAVDSARALRDKSDPATLVFQCGAAPAEAASAATPAP
FT                   AAVIERVNLSGDALFATDHATLAPTARESLDRLLSERADRTYSQVTVTGFTDSVGSDDY
FT                   NLALSKRRAESVAAYLKAHGLKTDSITVSGRGKADPVASNATPEGRASNRRVEIRLQH"
FT   sig_peptide     complement(190083..190166)
FT                   /locus_tag="Bcen_3143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.769 at
FT                   residue 28"
FT   gene            complement(190287..198473)
FT                   /locus_tag="Bcen_3144"
FT   CDS_pept        complement(190287..198473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3144"
FT                   /product="hemagluttinin motif protein"
FT                   /note="PFAM: Haemagluttinin motif; KEGG:
FT                   bur:Bcep18194_B0441 outer membrane protein,
FT                   haemagluttinin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3144"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78040"
FT                   /db_xref="GOA:A0A0H2XUZ2"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUZ2"
FT                   /protein_id="ABF78040.1"
FT                   /translation="MNRTYRSIWNEALGAWVAASEHDSARGKPNKSAVVVAAVAALAIS
FT                   LPGLAEANTLNTQQTCFTGSNGAVGRVNPGGTQNQAGDGSGTYSVVAGCNSNGNGWTGV
FT                   TVYGSFAQATGNGAVATGMQSSAGLWGVAAGLETTASGAAATALGFGSTASALNSVAIG
FT                   GAGGDGTTPLSQANSTLASGAGSIAIGSNATKGAQSAASDGIAIGGQSSVASTATSGIA
FT                   VGRGATVNGAYGIAQGDGVVSGATGRNVAIGSSGTTANGATAAGGAVAIGRGQVATGDG
FT                   AVAIGDPNSATGTGALAIGANDTSNGSGAIALGNSNSASGTGSVALGNSSTATNSAVAI
FT                   GSSASATGTNGAIAIGNAATANGTGAIALGNVGSFAAKSLATGTDALALGNGSTASGSA
FT                   GAVAVGAAAVASGSYGTALGSNSTASVANSVALGYNALTTSAATATSGGTTTVSNATIG
FT                   GQTFGNFAGSNSAGSVVSVGQSGSERRIQNVAAGLVTATSTDAINGSQLYSVASTTTSS
FT                   ITSLSTSASTGLSSANSSISSLSTSTSTGLSSATSSIGSLSTGLSSTNSSVTSLSTSAS
FT                   TGLSSANSSITSLSTSTSTGLSSATSSIGSLSTGLSSTNSSVTSLSTSASTGLSSANSS
FT                   ISSLSTSTSTGLSSATSSIGSLSTGLSSTNSSVTSLSTSASTGLSSANSSITSLSTSTS
FT                   TGLSSATSSIGSLSTGLSSTNSSVTSLSTSASTGLSSANSSITSLSTSTSTGLSSATSS
FT                   IGSLSTGLSSTNSSVTSLSTSASTGLSSANSSITSLSTSTSTGLSSATSSIGSLSTGLS
FT                   STNSSVTSLSTSASTGLSSANSSITSLSTSTSTGLSSATSSIGSLSTGLSSTNSSVTSL
FT                   STSASTGLSSANSSITSLSTSTSTGLSSATSSIGSLSTGLSSVTTKTNNLGTSTASALG
FT                   GGSTYDPATGTVSAPAYTTYNANGTTSTANSVGSAINNINSQGIKYFHANSSGADSTAT
FT                   GADAVAIGSGAVASTINSVAVGLGAVVSTDNSVALGAGSKTVAATPTSSATVDGVTFSG
FT                   FAGANPVGVVSVGDAGKERQVTNVAAGQVTSTSTDAINGSQLYSVAQQVGTATSAISSL
FT                   STSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTS
FT                   TGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSS
FT                   ANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSI
FT                   TSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLST
FT                   STSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTG
FT                   LSSATSSIGSLSTGLSSTNSSVTSLSTSASTGLSSANSSITSLSTSTSTGLSSANSSIT
FT                   SLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTS
FT                   TSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGL
FT                   SSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANS
FT                   SITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSIDSL
FT                   STSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTS
FT                   TGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSS
FT                   ANSSIDSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSI
FT                   TSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLST
FT                   STSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTG
FT                   LSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSANSSITSLSTSTSTGLSSAN
FT                   SSITSLSTSTSTGLSSATSSIGSLSTGLSSTNSSVTSLSTSASTGLSSANSSISSLSTS
FT                   TSTGLSSATSSITSLSTSTSTGISSLSTGLSSTDSTILSLSTSTSTGIGSLSTGLSSTN
FT                   SSVSSLSTSTSTAINAAKTHYYSVNDNGVQQANYANDGATGTNALAAGVNASAAGASSV
FT                   AVGDGSNAQTAGAVAIGQNASATGGKAVSIGSGNTASGDGAVAIGDPNVATGTGAVAMG
FT                   ANNTATGDGAVSLGNQNTATGASALALGSSNQATADNTIALGSQATAGATGAQAYGSAA
FT                   KATAADALAFGTNAQANVANSIALGANSVTAAAVGTSSATIGGVTYPFAGGSPVGVVSV
FT                   GAPGQERQITNVAAGRISATSTDAINGSQLNATNNAINTLSTSTASNVASLSTGINSLS
FT                   TGLSTTNSNVASLSTSTSTAINSLSTGLSTTNNNVNSLSTSTSTGIGSLSTGLSTTNSN
FT                   VASLSTGVTNINNQLNQLSTTLNNNTTRAANNNGVAADLNGKGNDLPVVTAGSNSVAIG
FT                   AGSNDGGRSNVVSVGSDTQQRQITNVAPGTQGTDAVNVNQLTQVQTTLSTALSGQQAQI
FT                   NSLGSQLQQTDQMAKQGIAAVGAMASIPQLDRDANFGMGVGTSTFLGQKAMAVNMQARI
FT                   TENLKASINGGFSGGQKVIGAGMLYQWK"
FT   gene            complement(199436..200338)
FT                   /locus_tag="Bcen_3145"
FT   CDS_pept        complement(199436..200338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3145"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78041"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTQ6"
FT                   /protein_id="ABF78041.1"
FT                   /translation="MTDTLQEEHAAADHAMRNWTFERQGPVRISSDAHKQMFCRMLLDT
FT                   HNPYKPAVIDWPALQPAELRRLTSLPIWDIAVQTEGRASIRVATYAATVDDPLLRRALE
FT                   MDGGEEARHKVVLSKLVEAYGIRLAPEPAYPAPTDPEWSWMMTGFSECIDSFFAFGLFR
FT                   SAQRSGYFPPELVETFEPVIQEEGRHILFFVNWYAWYWRTMPWWRRPWFFARVAAVWVQ
FT                   LIRDRMSIARGIDADGAARDANFPATGTADIGDALNPRELIELCLVENDRRMAGYDKRL
FT                   LRPMFVPRMARFALRFLKK"
FT   gene            200868..201353
FT                   /locus_tag="Bcen_3146"
FT   CDS_pept        200868..201353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3146"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: mag:amb1130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78042"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV09"
FT                   /protein_id="ABF78042.1"
FT                   /translation="MSVATKPQATNAVDKSVAAKWSAPLAKAGWTSFPNIIFERQQALG
FT                   LTPLDINILIHLAGYWWRPGEHARPSKGTLARAIGVAPRTIQKRIAAMEAAGFIKRIYR
FT                   TTSVGDNDTNEYDLSGLIKAAKPFAEEKIAERERRQKEQTDRLTRKKPLAIVKGGKA"
FT   gene            complement(201709..202755)
FT                   /locus_tag="Bcen_3147"
FT   CDS_pept        complement(201709..202755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3147"
FT                   /product="AAA ATPase, central region"
FT                   /note="PFAM: AAA ATPase, central region; SMART: ATPase;
FT                   KEGG: bur:Bcep18194_A6396 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78043"
FT                   /db_xref="GOA:A0A0H2XSZ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XSZ5"
FT                   /protein_id="ABF78043.1"
FT                   /translation="MASEPTQSPVHSESKLTAKPIANKPSRRPRARRVQIFSPDALEQA
FT                   NAALDGADASQQQCARPLLEKAGSNDGCRKLPDIQKALKRLDVARGSFANLSEPIGKLM
FT                   VDLVLASAVRSREFRVRPILLMGEPGVGKTHFASKLAEALAVPMRKWSAGSAQASFQLV
FT                   GGDSGWRQARPGAIFEVLAKGDSAAPVLILDEVDKIGSSSNYPVVPVLLDLLEADTAGA
FT                   FYDAFFRMEFDASRIIIVLTANDLDRVPLPLLSRVEVFDIPTPDPEQRMQIILAKIDHL
FT                   QRSTGKHIQLEEGGATGLAERTDLDLRKLHRIVIDAFAVALATGKCIATLALPPSAKRQ
FT                   PIGFTCHG"
FT   gene            203578..203985
FT                   /locus_tag="Bcen_3148"
FT   CDS_pept        203578..203985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3148"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: Helix-turn-helix type 3; KEGG: sme:SMc02783
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78044"
FT                   /db_xref="GOA:A0A0H2XU75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU75"
FT                   /protein_id="ABF78044.1"
FT                   /translation="MLVARTQISFADYLTAIRRRSGQRQKTVAHRSGMDPSYLASLETG
FT                   RRNPPSSEVINRLLDAIDATEEERRQLHRLAFAHGLQSYVDHRAPPDWPQEGSEILAAV
FT                   PMLSATQLRCLSSILKAVADSDAPVTTEEPM"
FT   gene            204169..205176
FT                   /locus_tag="Bcen_3149"
FT   CDS_pept        204169..205176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUZ6"
FT                   /protein_id="ABF78045.1"
FT                   /translation="MPFAARRRPASRDHDSAEWGDLNSLPADKKNKQPARSIISVVPHR
FT                   IVGGFDLPDRAPYALEWESYLERVCYATLAMSQDVEWMASQPDELQYVLDGVPRRYYPD
FT                   LFVRCGSGEYYVEVKPLAILVRDDNLCRYTEIARKLRIKGKNLVFLTDEQILSKKERVE
FT                   NVMLMRRYISGVLDEQRSSTVVQRLSDGALSISELTECCEVSIREIYTMVARRYLTIDW
FT                   DQTVTLRSSVTTPTSDNKGLAFETLINSGRFYPLLAQLAMGHRPQDQRMLELAKIDGQR
FT                   GRTSEGPSIVGGFPSEKSKSRIYEPDDVLRNSSSRRTARNRTRSSSNLQRKRRA"
FT   gene            205176..207164
FT                   /locus_tag="Bcen_3150"
FT   CDS_pept        205176..207164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3150"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   ppr:PBPRA0979 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78046"
FT                   /db_xref="GOA:A0A0H2XTR1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTR1"
FT                   /protein_id="ABF78046.1"
FT                   /translation="MRNFIIAKGLVIKWKGAVYEYISRATGTFYFRDVLTQAVIQVAEV
FT                   EFWGEFRSRKLCIVEATSTPTHLLYEERGSDGGENNDKNITQLAERWQEDADRKAFYMG
FT                   ELNRRGITCGQRTQMRAVLREIAKKLGDLEKPPAASTVGKWMSKFEGSGRDIASVVSGF
FT                   ATKSRRKSTGPDHEDIIQTSIDDHYLLPTRPSRTSSYRWYRWSLEAENRERLSDSLDPL
FT                   VPISYRTYVRRIDERPKYEVDVARFGAQVAKRRYTMIEGHLPASHPLDYAESDHTPLNL
FT                   FVIDDESYLPLGKPWLSAMKDRFSGVVLGLYLTFSPPSLQSTFGLLRHSLEGHHLATLK
FT                   WPDIENPWLSSGLAATYVSDRGSDYRSLRYRMAIRSLGAEYQYCEVRTPWHKASIERFF
FT                   GTVETTFLESLPGKTFRCLANRMDYDSSGTAVIRFSVLVYLLHKWAADFHNVFPNSRSG
FT                   ARPIDLWNEGIITAPPSLPANLDQLEVVLGNVASSHLSNVGLRYENMTYSDSYLRDLMK
FT                   DLGPGAVVKFSVPDNDLGVAYVLDPRSNKNIPIPNTRPDYANGLSLFQHKWMKKICREK
FT                   YKKSSIDGLVSVKAEINARVRDELAAKNTRSKTTLARLAGINSQATLSGEGRTILDPLA
FT                   PSRARSDSTTEVVSSISDIRRPRWDVI"
FT   gene            207209..208147
FT                   /locus_tag="Bcen_3151"
FT   CDS_pept        207209..208147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VPA1394 putative transposition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3151"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78047"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV14"
FT                   /protein_id="ABF78047.1"
FT                   /translation="MDVIERDRTLFEPPFVFNKEVKKSPHEVRMEALARSPLERAKYVE
FT                   TMLIRTAEFEQAQATIESLMQRSEALSCPGGLCIIGDGGTGKSFISEYFVRRYPIEETA
FT                   LRTFCPVLAMQFFATPTPRKLVADLLTALGYRFVRDDIPLKKLTPILLKALIECSVKII
FT                   MIDEAHHLIPSSGSRRNKERLGGELGDVAKNLYDKCKLPFVWSGRPSLGDLFDADKQFK
FT                   SRWPGTIRLVEYKYDDTWKILLDVIDEALPMERKSGLEEATRAGSIHQITRGNFRILKS
FT                   YLSECVRLACADGRQFITPDHFESARYALSL"
FT   gene            208232..209173
FT                   /locus_tag="Bcen_3152"
FT   CDS_pept        208232..209173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3152"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78048"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT00"
FT                   /protein_id="ABF78048.1"
FT                   /translation="MLRISEVNLGWSAQHLLQAVFGSKSRFTFEKAGALADFCRSDPAS
FT                   VCELSGYWRLRDGIDESMIGEWWIPRRPHVVRSCSALCPVCLDETPYSKAIWDVALVSC
FT                   CPCHRTMLVDRCPQCGLLVSIRRNKVCQCRCGHDYRSIKPVLVSCDAVEIARDIQNDIW
FT                   RNAGSDLLSEIDVVNKISAQTNLLSTLQYFWFFGATFPTLVAGIPTRGQSTMSKIRAIS
FT                   VCDEAVKIMRDWPGSFFYRLDRLHRTRSRRDAEMVDRVLRAVWAQIVALTSRGDVIDMR
FT                   GAFVAYVRSYVAKKARNNSLKICLNQKELPFG"
FT   gene            209274..210059
FT                   /locus_tag="Bcen_3153"
FT   CDS_pept        209274..210059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78049"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU80"
FT                   /protein_id="ABF78049.1"
FT                   /translation="MPDEALSGWIHRVCMHHGIKPGSLMRRWGFEAPTSALDFYPIGRP
FT                   ILLRIASTTMCNMEDLDEATYLDHTILGKSRFSCLTNDFSESRPIYRYCPSCLKGDEVS
FT                   HFKISWRFAYNFICEIHRCPLFDACVYCGRRVDLTWKFPCRPGQVAIWETSFCYHCTTP
FT                   LHTAPSNPICDEIANQMIVFQRWFHERVRRGGVSDLGIPELAPMFVGRYLRSIPSERSS
FT                   IVHYVGLDMDKLFGRDWRDLAQQIPCMYSSGRVVPEEEA"
FT   gene            complement(210172..210474)
FT                   /locus_tag="Bcen_3154"
FT   CDS_pept        complement(210172..210474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3154"
FT                   /product="histone-like nucleoid-structuring protein H-NS"
FT                   /note="PFAM: histone-like nucleoid-structuring protein
FT                   H-NS; KEGG: bur:Bcep18194_C7449 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3154"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78050"
FT                   /db_xref="GOA:A0A0H2XV00"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV00"
FT                   /protein_id="ABF78050.1"
FT                   /translation="MASYKELKAQMDALAEKTEAARIAEFQAIVDDIRSKVSEYGINEK
FT                   DIFGGRRGRPVAQTAKVPVEAKYRDPKTGATWSGRGRAPAWIKDVKNRNRFLIQE"
FT   gene            210785..212671
FT                   /locus_tag="Bcen_3155"
FT   CDS_pept        210785..212671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3155"
FT                   /product="KAP P-loop"
FT                   /note="PFAM: KAP P-loop; KEGG: xcb:XC_2443 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78051"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTR6"
FT                   /protein_id="ABF78051.1"
FT                   /translation="MWHDIEAEVDLLNFGVVARAAADLIRQAGGAPLTIGVSGGWGTGK
FT                   STLVKLTKADLETGAAKGAPESRAYVVMEFNAWLYQGYEDARQALLQSVSDRLLEEAQG
FT                   RKTFVDKALDFAKRVRLLKVARITAPMLAHAGVGSVAGGPLGAFIGAATGFVKGLSDEA
FT                   KREEQLTALKDAYAALKPELKELIAERQEDSLLKEIHALRETFAKLLADMGVTLVVFVD
FT                   DLDRCLPHTAIATLEAMRLLLHVKNTAFVIAADESMIRGAVRAHFAGVDIESGLVTSYF
FT                   DKLIQVPLKVPRLGVNEVKVYLALLMAELAVRQGQLTPKVQAQGQDALLQLLKTAWGKG
FT                   IARDDLAKVYGSEAKSISNSLDIADQLAPLLVSASDIAGNPRLIKRFLNNLMIRLTIAK
FT                   AMNMPIAIEQLVKVQLLERVASPAAFEFFVKAVASSLNGEAEFLEALEVAAQADDEYVA
FT                   PHPSWSTSFYQQWVRLSPRLAGSDLRALLHLSRDRSLGLAAYDELSEEAKRLLEATMEA
FT                   KEVSNVLVTQLMALSQADVSRILTRVIRKARDGQWDTVDLLRCLNCTEAHPELGGQFVQ
FT                   ALEEIPPAQRPVAILPKLKNKPWAALLLADWRDDLESTEPVKKYLKTFKGGN"
FT   gene            212671..213492
FT                   /locus_tag="Bcen_3156"
FT   CDS_pept        212671..213492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_2442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3156"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV19"
FT                   /protein_id="ABF78052.1"
FT                   /translation="MGTSTSSRGPGPNVSLDPPWLDDVLEGLGGDTVPATDDEPVPPEG
FT                   ALGTAQPARFAEARRELKKFIKSGNTDSLRDALGHYSRKGSGGASAASTRMRAATRAGA
FT                   ELFSFLNAVSQGSSVEARQWVHDLQSGSPTADDVVDAIVRELSPPGGSADEEALRGSMA
FT                   SALTELVLDNPGIDLMHLQTPDIWELMKNYLALEVTHRLCFDLGPLLESAKVDPAIAVQ
FT                   REREMRIFIKLEIGEHLDLLRGTNPNPTRSNLDAVFQETLKMTFELFEAGL"
FT   gene            213489..214775
FT                   /locus_tag="Bcen_3157"
FT   CDS_pept        213489..214775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78053"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT05"
FT                   /protein_id="ABF78053.1"
FT                   /translation="MTRVFCGPKDCIPTEREFGVDYVSMYEHDGLADVSTVGTALIKDI
FT                   VAAGVAPSARSWDFLTLALAVNAADNVLERAQSPDGWTRQIELEVVLYEPEPYQALTAK
FT                   IEEALRFLTGDFWTLTFTDGGYPPPRPKMPTIFNADCVCLLSGGLDSLVGALDLTEEGR
FT                   HPLLVSQTAKGDKETQSRFAIGLGGNDRHLQWNQNIRPKVEDIEGSTRGRSIGFFAFAA
FT                   VAADHLATTITALPRPVEVFVPENGLISLNIPLNPGRVGSLSTKTTHPVFMARLQALWD
FT                   ELGIRAVLRLPYAAMTKGEMMAECRASTVLADVASEATSCGRFVRNGYKHCGRCVPCLV
FT                   RRASFIRANLRDDTTYVYPSLRGAQLENEPNDIGAVAVAVLKVEQSGVRLFTAGQLSFA
FT                   EPSLRREFEGVVQRGLAELGVLLRQEQIL"
FT   gene            214772..215506
FT                   /locus_tag="Bcen_3158"
FT   CDS_pept        214772..215506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3158"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   atc:AGR_pAT_25 putative Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78054"
FT                   /db_xref="GOA:A0A0H2XU86"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU86"
FT                   /protein_id="ABF78054.1"
FT                   /translation="MIDFHSHLDLYPDGLKLAQEVNRRNEFTLVVTTSPRAYRATSNVF
FT                   LGLKNIKVGIGLHPEVAAAKQGELGDLIEGISRARFVGEIGMDGSPRFRGSLSVQERVF
FT                   RAALAECGRYQGKAMSIHSRGAARRVVELLATTKHAGVPVLHWFSGGFAELETAVRIGC
FT                   WFSVGPTMLEGEKGRALVARMPLHRVLPETDGPFTSVGGIQLQPWDAWSVRAPLAAIWG
FT                   MQEDEVGEQMKQNLQHLLRLSG"
FT   gene            215598..216410
FT                   /locus_tag="Bcen_3159"
FT   CDS_pept        215598..216410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sas:SAS0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78055"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV05"
FT                   /protein_id="ABF78055.1"
FT                   /translation="MTVAFNYKRTAKRFGDARDLATFMNLVDRWTRGIPTLGYRMSLFR
FT                   GQEDESWLLKPGIARPQYANRVRPGTEKSMLREFKQRGIPHLESTVELADADWLAIAQH
FT                   HAMPTRLLDWTGSALAALWFAIKRPAIKGDDGSPKAAAVWLLAATDADMIDLDERSNPL
FT                   EITETKLLKPRHVSRRIAAQDGWFSVHRGVEDGLGMKYVSLDTNVHFKMRLSYIRIPPD
FT                   AFGPMRAQLQTAGINRGVLFPDLDGVAGRIADAILYPDDQPTPGAGNL"
FT   gene            217020..217970
FT                   /locus_tag="Bcen_3160"
FT   CDS_pept        217020..217970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3160"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   sme:SMb20215 putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78056"
FT                   /db_xref="GOA:A0A0H2XTS1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTS1"
FT                   /protein_id="ABF78056.1"
FT                   /translation="MRQVGLILEDGFQLMGLAALAAFELANAELGDDGYLLTLLSEHGG
FT                   TVHSSMNAGIETVPVDIVPDTLMVAGELVPKSVSAGLCAYVARAGSEARRVAGVCTGAF
FT                   VLAQAGLLDGRTATTHWAHARDLQLRFPKVRVDDDRIFIRDGNIWTSAGMSSAIDLTLA
FT                   LLEDDHGSALSRSIARKLVVYHRRPGGQSQFSAMLELEPRSDRIKRALTYARENLRNPL
FT                   SIEELAEAASLSPRQFSRVFREETGQSPAKAVERLRLEAARVMLEDGRHPLDIVARDTG
FT                   FVDRDRMRRAFLRNYGQAPTSLKRDPKPMEDGTVT"
FT   gene            218052..218867
FT                   /locus_tag="Bcen_3161"
FT   CDS_pept        218052..218867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3161"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mlo:mll1328
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78057"
FT                   /db_xref="GOA:A0A0H2XV23"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV23"
FT                   /protein_id="ABF78057.1"
FT                   /translation="MGDTSRIGWLNTRRGKLATMQDGPDGGVPLVLLQRFRGTMDDWDP
FT                   AFIKVLSADRRVIRFDSAGIGRSEGRVPETIAEMAVVVAEVVEELGLGQVDVLGWSLGG
FT                   VVAQQLALDAPHLIRRLIVAGSSPGGITDGPQPHPRVPQVMSHSVNDAADFLFLFYPES
FT                   ETSVAAGKASLNRIAEQSHVGPAVTAEAFMAQIKAISTWPGVLHRAKELRMPVLVANGA
FT                   HDVMLPAYRSYVLSQQAPDAKLILYPDAGHAFLFQEIDDFAAQIDLFLE"
FT   gene            219057..219815
FT                   /locus_tag="Bcen_3162"
FT   CDS_pept        219057..219815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3162"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pfo:Pfl_2715 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78058"
FT                   /db_xref="GOA:A0A0H2XT08"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT08"
FT                   /protein_id="ABF78058.1"
FT                   /translation="MQMTGNTIFITGGTSGIGRALAEQFHALGNKVIIAGRRKALLDEV
FT                   TTANPGMEGVALDISDAADIDRVAAQLIRDYPSLNVLINNAGIMPFDDPSGRIDDSVSR
FT                   QILDTNLLGPIRLTSALIEHLKAQPRATIIHNTSVLAYVPIATNAVYSASKAALHSYAL
FT                   SQRFMLKGTSVSVQEIAPPWVDTDLIKKSGDPRAMPLDAFIAETMKGLATEEPEVFVEA
FT                   IRALRDNPGLGEHALIDGFNAEIAANPIPV"
FT   sig_peptide     219057..219125
FT                   /locus_tag="Bcen_3162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.661) with cleavage site probability 0.660 at
FT                   residue 23"
FT   gene            219847..221076
FT                   /locus_tag="Bcen_3163"
FT   CDS_pept        219847..221076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr7376 putative integral membrane transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78059"
FT                   /db_xref="GOA:A0A0H2XU88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU88"
FT                   /protein_id="ABF78059.1"
FT                   /translation="MRTHINETRVMNVSLAVNSRAALMPAGFLALGTFAIGTEGFMIAP
FT                   LLPVMAKDFGLPVPTVAVLVIVFTLVLALSSPISTVATGRMARKWVLLAAMSLFAIGNV
FT                   TAAVSASFALLIGARVLMAIAAGLYVPAANGLAGVIVPPSMRGRALAIVSAGQTLAIAL
FT                   GLPLGGMIGHAFGWRATFLLVGAMSVIAIAGIFAGIARDAGEGVAVASLRERVSVIRQA
FT                   PIQRLLGVSLFWSIGAFAAYPYIAEYLDAVLAFGPNAITATVSLWGLSAAAGVMTGGVF
FT                   NDRFGANRVVHGSLMLLGLSFLALAIASRLPPQVALVPVLVAVAVWGFTVWSYFPAQMS
FT                   RLIAAGAPAQAPVALALNTSTMYFGFSVGSTLGAAVLSSGAVWGIGAVAALAELIALAL
FT                   NAVLSRNARA"
FT   sig_peptide     219847..219954
FT                   /locus_tag="Bcen_3163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.721) with cleavage site probability 0.352 at
FT                   residue 36"
FT   gene            221196..221735
FT                   /locus_tag="Bcen_3164"
FT   CDS_pept        221196..221735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3164"
FT                   /product="Alkylhydroperoxidase AhpD core"
FT                   /note="TIGRFAM: Alkylhydroperoxidase AhpD core; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG:
FT                   bur:Bcep18194_C7058 alkylhydroperoxidase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3164"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78060"
FT                   /db_xref="GOA:A0A0H2XV10"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV10"
FT                   /protein_id="ABF78060.1"
FT                   /translation="MTARINTPAAAAATGATADVFATIRKAVGMVPNAYAAIGALNTPA
FT                   LQAILSADAVLSKGSLSAQDCETIKLVVSAISGCDYCVAAHSLASKASGIAVDAVRAIR
FT                   ALEPTGDARRDALIRFIRVLQESRGTIASEELEAFRSAGYSDESVVDVALAIALITFTN
FT                   VFNRVNNTVVDFPALK"
FT   sig_peptide     221196..221252
FT                   /locus_tag="Bcen_3164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.604 at
FT                   residue 19"
FT   gene            221957..222238
FT                   /locus_tag="Bcen_3165"
FT   CDS_pept        221957..222238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3165"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78061"
FT                   /db_xref="GOA:A0A0H2XTS7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTS7"
FT                   /protein_id="ABF78061.1"
FT                   /translation="MMSEAAPLNYQVMLMIGIAMQVQVASTFPISGCVHLDARRSRSFV
FT                   GRRPMSATEIVIGNVVISPRDTSVAPGYCVSFVEGGLTSPDWRLDWAW"
FT   gene            complement(222318..223256)
FT                   /locus_tag="Bcen_3166"
FT   CDS_pept        complement(222318..223256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3166"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   pfo:Pfl_2717 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3166"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78062"
FT                   /db_xref="GOA:A0A0H2XV28"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV28"
FT                   /protein_id="ABF78062.1"
FT                   /translation="MAIGTQAVFEIANVVAKEQIYHLTNVSVAGGPVRSSLGLSVLTEP
FT                   ANTAAAADTWMIGGVINPGTRTSSAAELQFIKEIGSSARRVAGLCTGAFILGEAGLLNG
FT                   RRATTHWAYADELQRRLPLAQVVRDWIFITDGPIWTSAGLTAAMDLALGMVEEDIGPEF
FT                   ANSVARALVMNQRRSGRQSQQSELLALAPKSDRIQLALEYARANLAEPLRVSDLARAAH
FT                   ISTRQFARIFLAETGESPANAIKRLRLEAARVLIERGRHTLDTIARETGFRDRNHLREA
FT                   FVRSYGLTPQAVRRSVRNSIEDQPEELSEAA"
FT   gene            223758..224327
FT                   /locus_tag="Bcen_3167"
FT   CDS_pept        223758..224327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0087 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78063"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT11"
FT                   /protein_id="ABF78063.1"
FT                   /translation="MSRHASNTRDSRVRYRAGNRVGCNAGLINRDIGTMRDDEIAIASA
FT                   ADAELKRDCSRLRDDAPIGALSGLKAVLGLPLSVLQGSARSLRDLDFSITLPGPSYTVL
FT                   CCWSQKNEVQQKLFQSTEQIDPAVVSTGMKVRSEGVQRVRTHGREWGGASGYLIVRLPR
FT                   QSRIGIKHLLAPECSFDASTCRRMNC"
FT   gene            224684..225403
FT                   /locus_tag="Bcen_3168"
FT   CDS_pept        224684..225403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT1784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU93"
FT                   /protein_id="ABF78064.1"
FT                   /translation="MNKVAQSIIDAHGGIEQWRKFREVRADLIQGGALWGLKGQSGVLD
FT                   RTRVSVATDRQWASHAPFATVAARSEFTGDRIALLDDSGRVIEAQAQPRELFAGHTLET
FT                   PWNALQLAFFAGCAMWTYLNSPFLLAFDGVECEDVGPWSEQGERWRKIHVVYPATLEVF
FT                   SKVQAMYVGPDNLIRRLDYDVEIAGNTPGAHYVSDYVTVSGIRVPMRRRIYPRMPDGTS
FT                   ISEPLVVSIDLENIELL"
FT   gene            225849..228035
FT                   /locus_tag="Bcen_3169"
FT   CDS_pept        225849..228035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3169"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: reu:Reut_A1741 fungal/archaeal/bacterial haem
FT                   catalase/peroxidase TIGRFAM: catalase/peroxidase HPI; PFAM:
FT                   Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78065"
FT                   /db_xref="GOA:Q1BQP0"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQP0"
FT                   /protein_id="ABF78065.1"
FT                   /translation="MSNEGKCPFNHGKRNGTTNRDWWPNQLNLKILHQHSSEADPMDPG
FT                   FDYAEAFNSLDLAAVKADLRALMTASQDWWPADFGHYGPFFVRMAWHSAGTYRTGDGRG
FT                   GAGRGQQRFAPLNSWPDNVGLDKARRLIWPVKQKYGRKISWADLIVLTGNVALESMGFK
FT                   TFGFAGGREDSWEPDEDVYWGMESTWLDDKRYSGDRQLETPLAAVQMGLIYVNPEGPNG
FT                   NPDPLASARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGDASHVGPEPEAAPLEQM
FT                   GLGWKSSFGSGKAGDAIGSGLEVIWTSTPTQWSNNFFWNLFGYDWELTKSPAGAHQWQP
FT                   KGGAGADSVPDPFEPGKRRVPTMLTSDIALRADPTYEKISRRFFENPNEFAEAFARAWF
FT                   KLTHRDMGPRVRYLGPEVPSEELLWQDPIPMPDHPQVDEQDVSALKAKVLASGLSVSEL
FT                   VSTAWASASTFRGSDKRGGANGARVRLAPQKDWEVNQPAQLATVLEVLGALQVEFNRAA
FT                   TGGKQVSLADLIVIAGNAGVEQAAAAAGVEITVPFTPGRGDASAEQTDVDSMAVLEPIA
FT                   DGFRNYLKGAYTIPAEKLLIDKAQLLSLSAPEMTVLIGGLRVLGTNVGDSKHGVFTDRR
FT                   EVLTNDFFRNLLDMGTEWKPTSEANEAYEGRDRATGELKWLASRVDLVFGSHSQLRALS
FT                   EVYGSEDSQQKFVRDFVAAWTKVMNADRFDIKHN"
FT   gene            228138..228971
FT                   /locus_tag="Bcen_3170"
FT   CDS_pept        228138..228971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3170"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cpo; non-heme
FT                   chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3170"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78066"
FT                   /db_xref="GOA:A0A0H2XV15"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV15"
FT                   /protein_id="ABF78066.1"
FT                   /translation="MSYFKSGDDTEIFYKDWGHGTPVVFSHGWPLTSDAWDAQMLFFGR
FT                   RGYRVIAHDRRGHGRSAQPWDGNDMDTYADDLAALLDHLDVRGAMLVGHSTGGGEVAHY
FT                   IGRHGTARVAKVVLIGAVPPIMLKTEANPGGLPMEVFDGIREGVLKNRSQFYRDLAVPF
FT                   HNFNREGATVSQGTIDSFWSQGMMGSIKGQFDCIREFSEVDYTEDLRKINVPVLVLHGD
FT                   DDQIVPIDASARRTAAIAPNVTLKVYPGGSHGIAITHADQVNADLLAFFENTTRK"
FT   gene            229174..230268
FT                   /locus_tag="Bcen_3171"
FT   CDS_pept        229174..230268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3171"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: dar:Daro_3831
FT                   regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78067"
FT                   /db_xref="GOA:A0A0H2XTT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTT2"
FT                   /protein_id="ABF78067.1"
FT                   /translation="MEITLQAMSIFTYIVRVGSFTAAAKLLGISAGTASRLVRNLENHL
FT                   GVTLLQRSTRCVRLTTEGAQYFEHCERVLGEIEEVKAHLAGARDVARGRLSVDIDQEIA
FT                   HTVLPLIPEFRLTFPEVELRLEIGGDPGGLVEHGIDCAIAVGPLPDSSLRGRRIGDFNA
FT                   VTVASPAYLSRRGVPHELGDLDRHDIIHYSPRRFGPVRDFRYCVDGGEVSLKFPERISV
FT                   SDARSAVQYAVEGIGIAQVCGRMVVNEIANGRLVSLLAENRPTSLQIFALYVDQRYIPR
FT                   SIRAFIDWLEIQLRWRNANVIAPSMMEIGKSRALPSCWGTDASRGNTQFAAESEGAQHL
FT                   VFGRAKSDVHVELDLTALHAMLEI"
FT   gene            complement(230592..232280)
FT                   /locus_tag="Bcen_3172"
FT   CDS_pept        complement(230592..232280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3172"
FT                   /product="cyclic nucleotide-regulated FAD-dependent
FT                   pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   reu:Reut_B4454 thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78068"
FT                   /db_xref="GOA:A0A0H2XV34"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV34"
FT                   /protein_id="ABF78068.1"
FT                   /translation="MHVRSNDDGKQGDTNPLSSPVAIGDTDYQRERYPLLTEAEIHRIT
FT                   RFGEIREWNDGDQIFRVGEPGFGMFVILSGSIRVTRRDALNRQIIVKELGDHHFVAEVG
FT                   QISGARCLVDGDAAGNVRALQVTPARLRALMIAEAELGERIMRALILRRAGLVEGGSGI
FT                   IVVTESNSPILNALQNFLTRNSIPYTVVDSSDLEIARYVNQYPTDSADYPLVICPDGKV
FT                   LCAPTETELATALDLIPDFDEAEVFDVAIVGSGPAGLATAVYAASEGLAAVILDNHAPG
FT                   GQAGASARIENFFGFPAGISGYALTARAYIQAQKFGARVAIPVDVEALECDTSPFRLRL
FT                   GNNGTVRAHSVVIATGAAYRKPAIEGIERFQGRGVYYWASPVEAKLCAGKNVVLVGAGN
FT                   SAGQAAVYLASHAKHVSMLVRGPNLSDSMSRYLIDRIESMDNIDIHFNTQIASFRGEDE
FT                   LEEIEIAGSDGKRTSKKAEHVFLFIGAIPNTSWLDGCGVTVDTSGFVLTGSDVSAQAGE
FT                   HETSVRGVFCAGDVRHDSTKRVAAAVGDGAAVVSQLHKFLASLTA"
FT   gene            232891..233346
FT                   /locus_tag="Bcen_3173"
FT   CDS_pept        232891..233346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3173"
FT                   /product="(2Fe-2S)-binding protein"
FT                   /note="PFAM: ferredoxin; KEGG: bur:Bcep18194_B1603
FT                   (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78069"
FT                   /db_xref="GOA:A0A0H2XT16"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT16"
FT                   /protein_id="ABF78069.1"
FT                   /translation="MVNLNINGETRTVDAPDDMPLLWVLRDVVGLTGTKFGCGIAQCGA
FT                   CTVHLDGVAARSCVLPVAAVAGRKITTIEAVGATPAGHKVQQAWRELDVVQCGYCQSGQ
FT                   VMAATALIASNPNPSDADIDAAMAGNICRCGTYNRIRAAVKQAAKEA"
FT   gene            233348..235582
FT                   /locus_tag="Bcen_3174"
FT   CDS_pept        233348..235582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3174"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.3.99.16"
FT                   /note="KEGG: bur:Bcep18194_B1602 aldehyde oxidase TIGRFAM:
FT                   Twin-arginine translocation pathway signal; PFAM: aldehyde
FT                   oxidase and xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78070"
FT                   /db_xref="GOA:A0A0H2XU97"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU97"
FT                   /protein_id="ABF78070.1"
FT                   /translation="MSRGLIEAGKVAGQAAGAGVSRRSFLKLGMSLGAAAGGGLLLGFS
FT                   LPAAGDDARRSVIGGDAAEPAQPGVFAPSAFVQIDRAGKITLVMPKVEMGQGVYTALPM
FT                   LIAEELEVPLSSVTLDHAPPNEKLFTDPLLGGQLTGGSTSVRYAWEPMRRAGATARTLL
FT                   VSAAAKQWSVDPASCRAVNGEVQHPPSGRRASYGQLADAAAKLPVPKDVVLKKPADFKL
FT                   IGTPAKRLDSPEKVDGTAQFGLDVRLPGMLYAVIVNSPVFGGTVASVDDTAARKIPGVR
FT                   QVVRVDNAVAVVGDHTWAAKRGASALVVKWNEGAGAKVSTKDIVADLAQAAVSGKGAVA
FT                   RKEGDVGHAFANAKTRVDAVYEQPFLAHATMEPVNCTVHVRGDGCEIWVGTQVPTRAVD
FT                   TVQQLTGLSPDKIVVHNHLLGGGFGRRLETDMIDQAVKVGKQVNAPVKVIWTREEDIQH
FT                   DMYRPYYYDKISAGLDANGKPIAWQHRIVGSSLMARFAPPAFRNGIDPDAVEVSADLPY
FT                   DLPNQLVDYVRQEPRHVPTAFWRGVGPTRGTFVVESFIDELAAQTKTDPVQYRRALLGK
FT                   APRALNVLDVATKAAGWGPSLPKGQGRGVSVMYAFGTFFSMVVDVAVDNGEVQVKRVVC
FT                   AVDCGMSVNPNTIEAQVQGGIIFGITGALYGEITIEDGRVVQSNFTDYRMLRINETPPI
FT                   EVHLVKSGEAPGGIGEPGTAATAAALSNAIFAATGKRLRKLPVGDQLKTA"
FT   gene            235598..236896
FT                   /locus_tag="Bcen_3175"
FT   CDS_pept        235598..236896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3175"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG:
FT                   bur:Bcep18194_B1601 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78071"
FT                   /db_xref="GOA:A0A0H2XV20"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV20"
FT                   /protein_id="ABF78071.1"
FT                   /translation="MRNLALNTFRASLLALSAMLAGPAAQAAQTAPADSALVARGAYLA
FT                   KAGDCVACHTAPRGTPFAGGLKMVTPMGAIYTTNITPDPETGIGGYTEAEFAGALRKGV
FT                   AKDGHNLYPAMPYPSYAKLKDEDVKALYAYFMHGVEPVKQANRPSDIPWPLNMRWPLAL
FT                   WNMVFLDTTPYADKPAKDAMWNRGAYLVQGLGHCGSCHTPRGVGFQEKALDEGGAAFLS
FT                   GAPIDNWFASNLTGEPNTGLGRWNEAEVAQFLKTGANRHATAFGSMVSVINHSTQALTD
FT                   DDLAAISRYLKSLPAAGGTGAPPYRYDPKATQVALGRPAADPGAKVYNAYCLHCHGVDG
FT                   RGYAPLLAPLAGNPNVLEADASSLINVTLNGSDTLVIGGVPSAYPMPAFSNQLNDQQIA
FT                   DVLTFMRAGWNNGAPAVQAADVAKLRKETANNH"
FT   sig_peptide     235598..235681
FT                   /locus_tag="Bcen_3175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.932 at
FT                   residue 28"
FT   gene            complement(237573..238007)
FT                   /locus_tag="Bcen_3176"
FT   CDS_pept        complement(237573..238007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78072"
FT                   /db_xref="GOA:A0A0H2XTT6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTT6"
FT                   /protein_id="ABF78072.1"
FT                   /translation="MPYPNILSGMGMKTTKTVFRIYEIWLLIALTLFFCVESLLDAIYM
FT                   QNESELAPMIVARAIWLALIIGAFSRYVVAIRILAFACGISAITVGFSLPCLATISPVL
FT                   AGVLCVGVVIKASTGIYMLHQISNPDSFGAQSLDAHRTPH"
FT   gene            238280..238651
FT                   /locus_tag="Bcen_3177"
FT   CDS_pept        238280..238651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3177"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG:
FT                   bur:Bcep18194_B3042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3177"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78073"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV38"
FT                   /protein_id="ABF78073.1"
FT                   /translation="MKNTFTSILAITCLAFCVNASAERGPDTGYVPAVVTGTAHAANPR
FT                   KEQRAADRLLAKKVRRALSATPHLASSDITVLARHGIVTLIGHVDEEAQIQLAEASARQ
FT                   VVGVTSVTNNLNIGIETRN"
FT   sig_peptide     238280..238348
FT                   /locus_tag="Bcen_3177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.953 at
FT                   residue 23"
FT   gene            239203..240267
FT                   /locus_tag="Bcen_3178"
FT   CDS_pept        239203..240267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3178"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: bte:BTH_II2108
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78074"
FT                   /db_xref="GOA:A0A0H2XT20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT20"
FT                   /protein_id="ABF78074.1"
FT                   /translation="MFLHSRIQEKSMDRILQAMSIFTHIARVGSFTAAAEIAGMSAGSA
FT                   STLVRQLEAHLGVTLMQRSTRCIRLTAEGSQYFEHCERILSEICEMKEQLSGTGKIARG
FT                   HLTVDVDQEVAHAILPFVPEFKAAFPEVALRINVGGDPDGLIANGVDCAVVVGQLADSS
FT                   LRSRRVGSFHALTVASPSYLARHGIPRDPEGLRDHEIIHYTPRRFGPTREFRYMVGGEE
FT                   VRLKFPERISVNDAGSAIRYAVGGVGVVQVCERMVSEEISAGRLVSILEENSPPPQPIS
FT                   VLYSDRKHVPMSVRAFLDWIQEQLQRQGAEDSRVQISAQAESFDAPLRRVVGMSHMGAL
FT                   PIRHVGHDALVHRM"
FT   gene            240504..240902
FT                   /locus_tag="Bcen_3179"
FT   CDS_pept        240504..240902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3179"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: bja:blr0259
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78075"
FT                   /db_xref="GOA:A0A0H2XUA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUA3"
FT                   /protein_id="ABF78075.1"
FT                   /translation="MEVRNVALMANQSVVSIIDDDQSVRRATGSLVRSLGWEVRTYESG
FT                   EEFLSAERIADVACIISDVQMPGISGLEMYEMLLERGVAPPVIFITSFPSEATHRQAMK
FT                   LGAICVFSKPVDPVQIELRLDDIASPSA"
FT   gene            240942..242840
FT                   /locus_tag="Bcen_3180"
FT   CDS_pept        240942..242840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3180"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bja:blr4773 two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78076"
FT                   /db_xref="GOA:A0A0H2XV25"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV25"
FT                   /protein_id="ABF78076.1"
FT                   /translation="MDDDRRRSESSTISAGFASRSDANMGAAKFSDNEEDVLERRQRVV
FT                   YLIATLLAVCIFIADAFTPIDVAVAVLYVVVILLVASVASQAVTVVVAWSCVSMTVLGF
FT                   LLAQSDQTAISSLARCGLSVLAIVTVSALALRNQSNRLTLQKQIDLLNLTHDAVVVCGL
FT                   DGLISFWSRGAERLYGWSAAEAAGKAFHELTATESQLPAADLLSRAIEDGSWQGEFTRT
FT                   CKNRARIIISSRWTISRDKSGEPVAVLSTDSDVTQARFLEAELRQQKEELIATIDAIPS
FT                   MVWSTSNDGRIVYLNRRWSDYGVKVASDKDVWRDIIHAEDIGVLEAAWRQGISAGSSFE
FT                   VTVRVRLGNGDYRCMMIGAAPMRDANGEIVRWYGVNTDIEERRLAEQALERSRAELAHV
FT                   TRLTMLGELAASIAHEVTQPLAAIVTAGEAGMRWIKRSPPDFTEVQYALGQMTHDARRA
FT                   TQVIHQIRSMAQRRDPDMMSIDLVAVIEQSVDLVRRELQSHQAEVSLSFSQSVLWITGD
FT                   RVQIQQVVINLLMNAIQAMAVVTDRTRRLSVSVQRYEGDKTLIAIEDSGHGISEADASM
FT                   LFTPFFTTKKEGMGMGLSICRSIVEAHGGRIWAESRGNNGATMWFVLPINGGGVHE"
FT   gene            242833..243477
FT                   /locus_tag="Bcen_3181"
FT   CDS_pept        242833..243477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3181"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: pfo:Pfl_2459
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78077"
FT                   /db_xref="GOA:A0A0H2XTU1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTU1"
FT                   /protein_id="ABF78077.1"
FT                   /translation="MSEATPQVVKQSIAYVVDDDDSMRSALGMLLRSVGLRVELFSSAQ
FT                   EFLAFDKPDVSSCLILDVRLKGQSGLVLQEQIVAGDMGLPIIFITAHGDVAMSVKAMKN
FT                   GALDFLSKPFRDQEMLDAVEGALLKHEARRRTDGRVAEVRRRYESLTPREREVMGFVVR
FT                   GLLNKQIAAEMDLSEITVKIHRGNAMRKMEVRSLAELVLGAKLLGIAPADD"
FT   gene            complement(243629..244954)
FT                   /locus_tag="Bcen_3182"
FT   CDS_pept        complement(243629..244954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3182"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0475 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78078"
FT                   /db_xref="GOA:A0A0H2XV41"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV41"
FT                   /protein_id="ABF78078.1"
FT                   /translation="MELNATGISDSLPVITTVDAARADRIFKRLALRVLPIFMFAYLAS
FT                   YIDRVNVSFAKLQLSQDLGFTDAVFGFGAGTFALGYVLFEVPSNMLLQKVGAKRWLTRI
FT                   ILAWAIVSALTTLIATPKQFYVMRYLLGVTEAGLVPGVVYYISQSFPRFHRARILSIFY
FT                   TALPMAGLIGSPMSGFIMEYLDSLLSLAGWKWMLIIEAIPAFVAAIMCWKYLEDDVTQG
FT                   NHRSESDRNYLISALEEDKSIAASINQNNIFSSKIFWIFGIIYFLDVFGIYGYTLWAPT
FT                   IIKSLGVERNSLIGLLAALPNAVAVIVMIIAGRKADSRRERRLLVAALFLMAAAGLTLA
FT                   LVWHGTLWLSIAALCIANAGLLSIPPIFWGMPTAVLSPRNAASGIAWISAIGNIGGFFG
FT                   PYVVGLLKQSSGSFVPAIYCIIACLLFGLILTLLLPKHLVNR"
FT   gene            246132..247430
FT                   /locus_tag="Bcen_3183"
FT   CDS_pept        246132..247430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3183"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: lpp:lpp0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78079"
FT                   /db_xref="GOA:A0A0H2XT24"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT24"
FT                   /protein_id="ABF78079.1"
FT                   /translation="MDMARQGRRVALIERGMIGGSCINVACIPSKTLIQNARQVHGWRE
FT                   AAGDASIMADMANVSENVRGVVDGMIKINRAAFEKSGLDLITGTGRFIAPRTISVRTED
FT                   GSEAIYEGENVYINTGTVAQIPNVPGLRDAQPLTHVEALRLDELPEHIVVIGGGYIGLE
FT                   MSQAFRRLGSAVTLIHDAPRVAMREDEDVSREIQQALEADGIKLELQSRIANVRGTSGQ
FT                   QVTIELADGRVVEGSHLLVTTGRKPQTDAIGLDLAGVEVDGRGIIKVDEKLATTAPRTW
FT                   AIGEIAGTPMFTHASFDDYRVLKAGIEGRSVSTANRTIPYALFIDPELGRVGLNEADAR
FT                   AEGILVRVAKLPMAAVPRARTNGNTRGFMKALIHPETDRILGFTMVGAGAGDVTTAVQM
FT                   AMLGGLSYRAVRDSIIAHPLLSEGLNLLFATLD"
FT   gene            complement(247711..248268)
FT                   /locus_tag="Bcen_3184"
FT   CDS_pept        complement(247711..248268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78080"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUA8"
FT                   /protein_id="ABF78080.1"
FT                   /translation="MTVFITIFSSMPIRQTFPKSDRVTGLSADTPYEGREIVGWPIEVY
FT                   SGGAVCRSGQHPAGRGRYLTTPTSGHLKSLFLALMANPETSAYRRDLLYRFLNVLKIHI
FT                   DGEATTLLEAVNLYQREMRHTGRPINHPKLIGTTLLVKGLEYDHAVILDADALDAKELY
FT                   VAMTRGSRSLTIIGSGRYLPAR"
FT   gene            complement(248326..248952)
FT                   /locus_tag="Bcen_3185"
FT   CDS_pept        complement(248326..248952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78081"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV30"
FT                   /protein_id="ABF78081.1"
FT                   /translation="MFDPMLPNREMFIQDPAGYSLSGWSRWAMLAAAHGADVDPTNAPS
FT                   SDDLKSPILWLTQAEAMAQAAVTLVKQQPNFDNMPTELRGICDSQYCAVALMLVGYSLE
FT                   VCLKAMIILRAGVAAYSEAERDHKHHELHRLANFIDDLSPKELATLELLTHFVYWAGRY
FT                   PDPGQKGIGKHDKIFQISEENRITAHDLFEVAAKVMFHVKKLVGA"
FT   gene            complement(249001..249888)
FT                   /locus_tag="Bcen_3186"
FT   CDS_pept        complement(249001..249888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3186"
FT                   /product="protein of unknown function DUF955"
FT                   /note="KEGG: nmu:NmulC_2781 protein of unknown function
FT                   DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78082"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTU6"
FT                   /protein_id="ABF78082.1"
FT                   /translation="MSEPTTPAAWGIQLSKLWTQSGQSFPVDVQVLALEVTKAKFSDPV
FT                   GVIKPHGVAGIDGMLSKRKSKGDWCISYDAAVTIPGRINFTLGHELGHYFLHRAMRDTF
FT                   TCGQLETMGYNEGESKKQESEANKFASFLLMPADDFRQQISGQPITVDLLGHCASRYDT
FT                   SFTATTLKWLDITDEAAMLVVARDDFICWSYPSARASKLGCYMPPGAPVPSASVERLAE
FT                   ANAARDRIVTVPAGVWHPSFEAEESLIVSDQFDLAIFLVRFVSPGHIEHAEDAPSDAAD
FT                   FLTERAKGLNWTRQ"
FT   gene            complement(249881..250204)
FT                   /locus_tag="Bcen_3187"
FT   CDS_pept        complement(249881..250204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3187"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif; KEGG: nmu:NmulC_2782
FT                   helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78083"
FT                   /db_xref="GOA:A0A0H2XV45"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV45"
FT                   /protein_id="ABF78083.1"
FT                   /translation="MATPLGEKIRAERKRLKLTLDALAEKTESSKSYIWELENRPVVRP
FT                   SADKISKIAAVLGVTVEFLLDDEKQEASQSDVDEAFFRRIGRLDATKRAQLEKFLKAID
FT                   DDE"
FT   gene            250418..250723
FT                   /locus_tag="Bcen_3188"
FT   CDS_pept        250418..250723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78084"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT27"
FT                   /protein_id="ABF78084.1"
FT                   /translation="MARTLKCVAKRMGGGAGHEHITHLWWQVWDGDRAVGESGVFTRDQ
FT                   MVSYIERQGNNSVWCPDRNPQRQGAWVHVNNNGRTKYVQTVADGRWTDNLLALPDR"
FT   gene            complement(251272..251490)
FT                   /locus_tag="Bcen_3189"
FT   CDS_pept        complement(251272..251490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78085"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUB3"
FT                   /protein_id="ABF78085.1"
FT                   /translation="MNRTIRYKGYEVAPAAARLPNGLFAANLTIERASGGPSPRSVSFD
FT                   AIDFFFEEEHALAYASRWGRLWVDTNA"
FT   gene            complement(251724..252581)
FT                   /locus_tag="Bcen_3190"
FT   CDS_pept        complement(251724..252581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3190"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bma:BMAA0563 NADPH-dependent FMN reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78086"
FT                   /db_xref="GOA:A0A0H2XV36"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV36"
FT                   /protein_id="ABF78086.1"
FT                   /translation="MEETSPSYRPWRTVSTKHFCYRSAGPRTRLPPPRGISIERKVVFR
FT                   VATGSLPSGFKPVLSRASQSQERPLTAFDQHRRPFVVGIGGTTRAASSTERALSFALRG
FT                   AQAAGARTRLFDGPFLHTLPHYAPEHKTLTDAQRELIDAVRQADAIIIATPGYHGGVSG
FT                   LVKNALDTLEELRADERPYLDGRAVGLIVTAYGWQAAGTVLTSLRSIVHALRGWPTPFG
FT                   ATVNTLETRFESADSCSDPKVVAQLETVGTQAAEFALAFASHRAASHAASVDALAPVLK
FT                   VANQ"
FT   gene            complement(252685..252990)
FT                   /locus_tag="Bcen_3191"
FT   CDS_pept        complement(252685..252990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3191"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: NIPSNAP; KEGG: bur:Bcep18194_B0447 protein of
FT                   unknown function DUF1099"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78087"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV1"
FT                   /protein_id="ABF78087.1"
FT                   /translation="MITCFLRYVVDPYKLVEFETYGKMWIPLVKQFGGTHHGYFLPSEG
FT                   ASNIALAMFSFPSLAEYERYRERSKDDPACQAAFRYAEETRCIVSYERSFFRPVFE"
FT   gene            253284..254072
FT                   /locus_tag="Bcen_3192"
FT   CDS_pept        253284..254072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3192"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0448 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3192"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78088"
FT                   /db_xref="GOA:A0A0H2XV51"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV51"
FT                   /protein_id="ABF78088.1"
FT                   /translation="MSIPWNAIADPTPAALPSRCVDRVIVRRFDPAIDSYAQLTPMLHR
FT                   AFARLGAMGLNCTCVDQDEDVTRRRAEAGECHVAVCGGRVVGTATLYATDPSSACSLYR
FT                   REGVASVRQVAVDPACQSRGIGALLMSFAEQWAALRGYALLALDTPHPAAHLLAFYGAQ
FT                   GFEVVDVMRFAGKRYDSAILCKRPVAHAVRRVSPVSRLAARVAAVRRVVLAWAPQIVAV
FT                   ARRESGVRRAGRFAARRAAGAASCRSSPWRPRQHGRFMAR"
FT   gene            complement(254244..255588)
FT                   /pseudo
FT                   /locus_tag="Bcen_3193"
FT   gene            complement(255585..259052)
FT                   /locus_tag="Bcen_3194"
FT   CDS_pept        complement(255585..259052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3194"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bur:Bcep18194_B0453 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78089"
FT                   /db_xref="GOA:A0A0H2XT30"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT30"
FT                   /protein_id="ABF78089.1"
FT                   /translation="MPVRLPAVLKPPRSGAIRDRRTITTVRGSKALNWAFAVIGFIVGG
FT                   IAALIGDFSAGSGSLLGAAVGFCIGHALRQRKQQNQRAAADAFAISATPPPTPLPLAER
FT                   VARLEATVDTLTRELDALRAQLAGAKAGAATSGDIAQTASAGASAVPLPAHVPTTPTPQ
FT                   PVAARADTPASISTPAPAAAPATAARTATASAHANTTASAPATSTRPAPPAPPAPREPG
FT                   FVERAFGAARDWLLGGNTVVRVGIIVLFFGVAFLLKYAADNDMLPIEFRLAGTALAAAA
FT                   LLAIGWRVRARRAAYGLVLQGGGVGILYLTIFAATKLYALLPVGAAFPLMVAVCALSAF
FT                   LAVRQNALPLAFMGSAGGFLAPILLSTGQGNHVALFSYYALLNAGIFAIAWFKAWRPLN
FT                   LLGFVFTFTIGSAWGVTAYRPALFASTEPFLILFFLMYVGIALLYAVKRELALRHYVDG
FT                   TLVFGTPIVATALQASLVKGMPFGLAWSAVALSAFYVAVAAWLARRRDRLGLLFESMLA
FT                   LAVIFATLAVPLAFSGPTTSAAWAIEGAAVVWLGVRQKRLLAFGFGLLMQVAAAGAFFT
FT                   SLLSPADATALPVLNSPYIAMLLIALAGLFTGWWLHGRGEARAWHAWMPEIGVAAAAWG
FT                   LLWWVSGGLHEILVHASRHVDLHADRFVMDTTALFAAGTAWLAHVVRRRLAWPLAEWPA
FT                   LALTPVLALLALRAFDAHEAPLSGMGAFAWPVAVGAGFALLWRQSRGTTGAAAVNGAAH
FT                   SVAAGILAPLHTLAFWTLCGLLSLEGFWRLRAFVPEGAWSWSAWAYGFGALLLLVSGPG
FT                   SRLRWPVAAFPRAYQVWGAAPLAALLWLWSLASTASDGDASPLFWLPLLNPLDVAQGLV
FT                   FVAFAVWLRRLKTLGVAWHPRVVDYLAIATVFLWFNALLLRTLHQRFHLGYDIDTVLSS
FT                   FGIQQVFMVGWSLFAFAGMWLTRRDGIARLCAFASLPLIVVMWAWTFYANFTQDGGSWA
FT                   RVPLFNPLDLVLAVVYALAASWFVRARKLGWTFGTHRVELLGAAGATGFLWLNAILLRT
FT                   LHHWAGVPYEFGAMAESTLVQASVSVYWTVCALAITIWATRRGLRPLWFVGAALLALTV
FT                   VKLFLFDLSHVTGIERIVSFIGIGVLLLLIGYFSPLPPKAAAQQDGRP"
FT   gene            259566..260735
FT                   /locus_tag="Bcen_3195"
FT   CDS_pept        259566..260735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3195"
FT                   /product="glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_B0455 ABC glycine
FT                   betaine/L-proline transporter, ATPase subunit TIGRFAM:
FT                   glycine betaine/L-proline transport ATP binding subunit;
FT                   PFAM: ABC transporter related; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78090"
FT                   /db_xref="GOA:A0A0H2XUB8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUB8"
FT                   /protein_id="ABF78090.1"
FT                   /translation="MDAPKVVVEGLCKVFGSNPQQALDMLAAGATKDDVLKRTGQVVGV
FT                   HNVSFDVQEGEIFVLMGLSGSGKSTLIRLVNRLVDPSAGKVLIDGLDVASARRSALTAL
FT                   RRKDMSMVFQSFALMPHRTVVSNAAFGLEVGGMGKKERERRAMEVLEQVGLAPFSHKLP
FT                   SELSGGMQQRVGLARALAVNPSLMIMDEAFSALDPLKRREMQDVLLQLQKEQRRTIMFV
FT                   SHDLEEALRIGNRIAIMEGGRLVQVGTPQDIIANPADDYVRAFFDGIDTSRYLTAGDLM
FT                   QTGAVPLVSKCDAANVAASLNGSAEYAFVLDAARKIRGFVTREALGQDTPSVRPIESIR
FT                   RDASLEHVVARVVASPNALPVVDDDGCYCGSVDRALILKAITRSRGSHV"
FT   gene            260728..261624
FT                   /locus_tag="Bcen_3196"
FT   CDS_pept        260728..261624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3196"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0456 ABC
FT                   glycine betaine/L-proline transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78091"
FT                   /db_xref="GOA:A0A0H2XV40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV40"
FT                   /protein_id="ABF78091.1"
FT                   /translation="MSEMIPLGTWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHGLQ
FT                   AIPMWLMMAIFIGVGLWRVGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLV
FT                   LGIPLGIWAAKSKWVAAIVRPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMP
FT                   PAVRLTSLGIRHVNREIVEAGQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMV
FT                   IIASMVGAGGLGNDVLASIQRLDIGLGFESGLSVVLLAIILDRITESFGRAPGTAKAPL
FT                   FSGLKQLFRVKAAPAQA"
FT   gene            261661..262728
FT                   /locus_tag="Bcen_3197"
FT   CDS_pept        261661..262728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3197"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0457 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78092"
FT                   /db_xref="GOA:A0A0H2XTV5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV5"
FT                   /protein_id="ABF78092.1"
FT                   /translation="MDNDFRGFGRGVGPLQPPRQETDVTSAVAVAPAACVSPVSSLAHF
FT                   GFLTLPNFSMIAFSSAVEVLRMANYVGRADHYKWSIYSLDGAPAHASNGIAVRPTQALD
FT                   YDNLPDVMIVCGGIRIRDVVDEGARDTLAALAERGLPLGGICTGAYALMSSGLLDGYRC
FT                   TVHWENLSALHSEFPRVGFADELFVVDRDRLTCTGGTAPLDLMLNLVGMRFGQQLAAQV
FT                   SEQFILERIRSSTDTQPIPVDARVGFSRAELIEVVRLMEANIEEPLSLEELARLVRLSQ
FT                   RHLQRMFKVYLNVSPTHYYLTLRLKRARDLLRTTDASIARVTTVCGFHSPCHFSKAYRA
FT                   QFGHAPSYERRLPGR"
FT   gene            262884..263780
FT                   /locus_tag="Bcen_3198"
FT   CDS_pept        262884..263780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3198"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bur:Bcep18194_B0458 ABC
FT                   proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78093"
FT                   /db_xref="GOA:A0A0H2XV58"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV58"
FT                   /protein_id="ABF78093.1"
FT                   /translation="MSAVYAADPPVCKNVRFADVGWSDIAATTGLASTMLQGLGYNPTK
FT                   TIASVPITFAGIKSKQIDVFLGYWSPTMDPIIQPFTKAGTIKVLATPNLTGAKYTLAVP
FT                   DYVYQGGLKSFADIQKYADKLNGKIYGIEPGNDGNALIKKMIDGNQFGLGKFKLVESSE
FT                   AGMLVEVNRAARDKQWIVFLGWEPHPMNVQMKIDYLTGGDDVFGPNYGEAKVLTATPPD
FT                   YAQRCPNVAKFVSNLQFTTSIENHVMVPIMNKQDPNKAAADWLKANPQALDKWLAGVTT
FT                   LDGKPGLPAVKAYLGVH"
FT   gene            264075..264701
FT                   /locus_tag="Bcen_3199"
FT   CDS_pept        264075..264701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3199"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   pfo:Pfl_3420 protein of unknown function UPF0126"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78094"
FT                   /db_xref="GOA:A0A0H2XT34"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT34"
FT                   /protein_id="ABF78094.1"
FT                   /translation="MKRIEQVVLAADLAGTAVFAIEGANAAIGAGLDLFGVMVLSLVVA
FT                   LGGGVIRDLLIGARPPSAVSDWRYPALAFAAGLFAFVFHARVASFSPSLLTTLDAAGLA
FT                   LFAVAGAVKALEFRVHPFIATLMGAVTGCGGGVVRDLLLARIPVVLVTDIYASAALLGA
FT                   VVVVSCRRLGCPPVVAAVLGGVACFALRIAAVRFGWQLPKIAAGA"
FT   gene            complement(264711..265136)
FT                   /locus_tag="Bcen_3200"
FT   CDS_pept        complement(264711..265136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3200"
FT                   /product="transmembrane pair"
FT                   /note="PFAM: transmembrane pair; KEGG: bur:Bcep18194_B0461
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78095"
FT                   /db_xref="GOA:A0A0H2XUC4"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUC4"
FT                   /protein_id="ABF78095.1"
FT                   /translation="MQGLPRRITQAVLYEAIAISCISPVIAAIFKQDLVYSGALSATMS
FT                   AIAMLWNLIFNALFERWEASRRQPARTLGRRILHATGFEGGLIFILVPVVSGWLDISWF
FT                   DAFVVDIGLFAFFFCYAFVFQWAFDRVFDVPAATKQS"
FT   gene            265283..266206
FT                   /locus_tag="Bcen_3201"
FT   CDS_pept        265283..266206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3201"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0462 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78096"
FT                   /db_xref="GOA:A0A0H2XV46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV46"
FT                   /protein_id="ABF78096.1"
FT                   /translation="MFSKIPLTALRVFEASARLGTFKAAADELSVTPAAVSHQIKSLES
FT                   RVGVLLFERGAGGVRLTEEGERLFRASHDALLALSRGLDALRPDAADERALVLTTTPAF
FT                   AAMWLIPRLGAFRRVDPHLHIKVETGNALVDLERDARIDLAIRATSRKFPALHEIALID
FT                   EYFGAYAAAGFDAHRTDEPLDLIETVWDTPLPVSVDWASWCRAAGREAWLERAVFRHYD
FT                   DEHYALQAVLHGQGIALLSSVLAAEHVERGALVPIEPAVRLAGARFVALCRPGREREPQ
FT                   VRRFLDWLEAEIARTRASVGRIAPAA"
FT   gene            complement(266288..267502)
FT                   /locus_tag="Bcen_3202"
FT   CDS_pept        complement(266288..267502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3202"
FT                   /product="glycosyl hydrolase"
FT                   /note="KEGG: bur:Bcep18194_B0463 glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78097"
FT                   /db_xref="GOA:A0A0H2XTV9"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV9"
FT                   /protein_id="ABF78097.1"
FT                   /translation="MPEHIPIPSAVSPRRTIRRHRNMNDRLLVATRKGLFVLQPDGHGG
FT                   WTPGEPHFIGEPVSMALADPRDRTLYAALNLGHFGVKLHRLRAGATDWEECAVPVYPPQ
FT                   PADASPARADTHAGSVDTADAPTGSPQPPWTLQQIWSLETGGADEPGVLWAGTIPGGLF
FT                   RSDDHGDSWVLNRALWNRPERAEWGGGGYDAPGIHSVMVDPRDSRHVTVGISCGGVWQT
FT                   ADGGATWRVTAEGMEADYMPPERRGEPNMQDPHRVVQCAANPDVLWMQHHCAIFRSTDS
FT                   GEHWRRIEAEPSSFGFAVAVHPHEPDTAWFVPAVKDACRIPVNGRFVVTRTRDGGRSFE
FT                   SLSNGLPAAPAYDLVYRHGLAVDDSGTRLAMASTTGGLWTSADGGEHWQQVSAHLPPVY
FT                   CVRFG"
FT   gene            complement(267512..267781)
FT                   /locus_tag="Bcen_3203"
FT   CDS_pept        complement(267512..267781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3203"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="KEGG: bur:Bcep18194_B0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78098"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV62"
FT                   /protein_id="ABF78098.1"
FT                   /translation="MAHLFFAASIQRHVETPERDVDAHTDGEAFDTIFNEQPRLRGYIV
FT                   DDQGALRKHLSVFIDGQPIRDRQRLSDALGATSRVYVVQALTGG"
FT   gene            complement(267911..268600)
FT                   /locus_tag="Bcen_3204"
FT   CDS_pept        complement(267911..268600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3204"
FT                   /product="Aspartyl/Asparaginyl beta-hydroxylase"
FT                   /note="PFAM: Aspartyl/Asparaginyl beta-hydroxylase; KEGG:
FT                   bur:Bcep18194_B0466 aspartyl/asparaginyl beta-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78099"
FT                   /db_xref="GOA:A0A0H2XT38"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="InterPro:IPR039038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT38"
FT                   /protein_id="ABF78099.1"
FT                   /translation="MSAAYDHAAALLRTLYDRHIDSGAVLDASAFPDAERFVRAWPAIR
FT                   AEALEVARDMPRIPRFHEIMREQYDISANDARDWRMFIMQAYGQPFPRNLSRCPTVASL
FT                   VAASPDVLSASLSFLAPGKHIPPHRGPFRGILRGYLVLSMPKRADGTPAAVLKVDGHEY
FT                   RLDEGRFLLWDDTFTHEVWNDSDAVRIVLLLDIRRRGMPRWLMWLSNAVIGVVRLGIRI
FT                   RGRSIPV"
FT   gene            268795..269163
FT                   /locus_tag="Bcen_3205"
FT   CDS_pept        268795..269163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78100"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUC9"
FT                   /protein_id="ABF78100.1"
FT                   /translation="MKLMKEWNMNTHWLVAATVAAMSLAGVATQASAQALTREQVRQEL
FT                   IDAQNNGLRFVTDTSYPDVSPLFQQPAERMPQRQASTAVGSDPAVSSDAGKPAAMSPRR
FT                   GAAACVGPASFCTVYFGS"
FT   sig_peptide     268795..268896
FT                   /locus_tag="Bcen_3205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 34"
FT   gene            269199..269510
FT                   /locus_tag="Bcen_3206"
FT   CDS_pept        269199..269510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78101"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV50"
FT                   /protein_id="ABF78101.1"
FT                   /translation="MVDRYVTLKEFMMKTYIALLTMIAAIVGQSAFAQSAAPLTRAQVR
FT                   DELIRLEAAGYDPAKGDDGEYPADIQAAEAKLAEQDGARMAASATRAAEPGMPAQVGN"
FT   sig_peptide     269199..269300
FT                   /locus_tag="Bcen_3206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.923 at
FT                   residue 34"
FT   gene            complement(269742..270713)
FT                   /locus_tag="Bcen_3207"
FT   CDS_pept        complement(269742..270713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3207"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_B0473 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78102"
FT                   /db_xref="GOA:A0A0H2XTW3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTW3"
FT                   /protein_id="ABF78102.1"
FT                   /translation="MKVLITGGAGFLGQRLARKLLERGELTGPDGRIEKIDELVLLDVV
FT                   KGSDFGDARVTSIVGDIADRAVLDSAIDTQTGAIFHLAAIVSGQAEADFDLGMRINLDA
FT                   SRTLLEVCRARGHQPRVVFTSSVAVYGGALPDVVQDDTALNPQSSYGAEKAIAELLLCD
FT                   YARRGFVDGRVLRLPTISVRPGRPNAAASSFASGIIREPLNGEESVCPVPGSTRLWLLS
FT                   PRGAIDALVAGCEINGAKLGNKRVINLPGLSVSVNEMIAALREVAGDEVVKLIRHAPDE
FT                   RVEKIVGSWPGRWDTSRAEALGLKGDTSFVDVIRSHIADEQR"
FT   gene            complement(270742..271518)
FT                   /locus_tag="Bcen_3208"
FT   CDS_pept        complement(270742..271518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3208"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase-like TIM barrel; KEGG:
FT                   bur:Bcep18194_B0474 hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78103"
FT                   /db_xref="GOA:A0A0H2XV67"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV67"
FT                   /protein_id="ABF78103.1"
FT                   /translation="MPRFAANLSMMYTEHAFLERFAAAAHDGFKAVEYLFPYDFAAEDI
FT                   RARLDAHGLEQALFNAPPGDWAAGERGIASLPGREDEFRRGIDLALDYARVIGNKKLHV
FT                   MAGMVPPGADRARHRDTYLANLRHAAQAAAAHGITILIEPINQRDMPGYFLSRQDDAQA
FT                   IRAEVGAPNLKVQFDCYHCQIVEGDLAMKLKRDFAGIGHIQIAGVPERHEPDVGELNYP
FT                   YLFALIDALGYDGWIGCEYRPKAGTSEGLGWLKTYL"
FT   gene            complement(271594..272919)
FT                   /locus_tag="Bcen_3209"
FT   CDS_pept        complement(271594..272919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0475 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78104"
FT                   /db_xref="GOA:A0A0H2XT42"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT42"
FT                   /protein_id="ABF78104.1"
FT                   /translation="MTALDAAASRSPAAAAQSGELDRTYKKVFWRIAPFLMLCYVVAYL
FT                   DRVNVGFAKLQMSQDLAFSETVFGLGAGIFFLGYFLFELPSNLLMHRLGARIWIARIMI
FT                   TWGLLSALFAFVQTPTQFYVLRFLLGLAEAGFYPGVILYLTYWFPSHRRAKIIAVFMSA
FT                   IPVSGIFGNPLSGWIMERFHGGSGFHGWQWMFMIEAVPAVLIGIATILYLDNSIRGAKW
FT                   LDEREKQLLEDEIAAQPQEQQQHGHSLKAVFSDPRMWWMSLIYFAFVTGQYGLTFWMPT
FT                   LVKSTGITDTLQIGLLSAIPFVVAIVVMNLFGHSADKRRERRWHLIVPALMGAIGFAVA
FT                   ASYSHNTAVSIVFLSLAAGGVLTCAPLFWSLPTAFLAGSAAAAGIAIINSVGNLAGFAS
FT                   PYVIGYLKDATHSTASGMYVLAAMLVIGAIAVWLTPAKLVNR"
FT   gene            complement(273051..273689)
FT                   /locus_tag="Bcen_3210"
FT   CDS_pept        complement(273051..273689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3210"
FT                   /product="class II aldolase/adducin-like protein"
FT                   /note="PFAM: class II aldolase/adducin-like; KEGG:
FT                   bur:Bcep18194_B0476 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78105"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUD4"
FT                   /protein_id="ABF78105.1"
FT                   /translation="MSDEAKLREEICVVGASLYARGHAVGSAGNISARLHDGWLITPTD
FT                   ACLGRLDPNDIAKVGTDGQPVSGGKPSKTLALHRGIYARNAEANGVVHTHSTHLVALTL
FT                   AGVWRDTDVLPPITPYYVMKVGHIPLIRYRRPGDPAVAAEVAALADRVRGVLLDRLGPV
FT                   MWGPSVSHASYALEELEETARLWLMTQPKPEPLTDAALDELRQTFGARW"
FT   gene            complement(273686..274987)
FT                   /locus_tag="Bcen_3211"
FT   CDS_pept        complement(273686..274987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3211"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   bur:Bcep18194_B0477 type III effector Hrp-dependent outer
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78106"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV55"
FT                   /protein_id="ABF78106.1"
FT                   /translation="MTASASRPLLGCIADDFTGATDLANMLVKSGMRTVQTIGVPADGA
FT                   AADTIVDADAIVVALKSRTIPAADAVAQSLAAYAWLRAQGCRQFFFKYCSTFDSTDAGN
FT                   IGPVADALLDAAGGDFTIACPAFPENGRTIYRGHLFVGDVLLNESGMENHPLTPMKDAN
FT                   LMRVLQRQTKSPVGLIRYDTIALGAAAVRARIDQLRAEGARFAIADALSDRDLYVLGEA
FT                   CAGLPLVTGGSGIALGLPANFRRAEQLPERDNAASLPRIDGLSAVLAGSASKATNAQVA
FT                   AWRATRPSFRIDPLAASRGEPVVDQALAFARSHLPQPVLIYATATPDEVKAVQQALGVD
FT                   AAGHLVESTLAAIARGLRELGVRKFVVAGGETSGAVVQALDVKSLQIGAQIDPGVPATA
FT                   TIDAQPLGLALKSGNFGTTDFFDKALRALDGAAR"
FT   gene            complement(275007..275897)
FT                   /locus_tag="Bcen_3212"
FT   CDS_pept        complement(275007..275897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3212"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: bur:Bcep18194_B0478 3-hydroxyisobutyrate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78107"
FT                   /db_xref="GOA:A0A0H2XTW6"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTW6"
FT                   /protein_id="ABF78107.1"
FT                   /translation="MSRNIGVIGLGAMGLGVARSLLRAGLRVHACDVRDTVLQAFAAEG
FT                   GIACATPAELGAQCDVVVTLVVNAAQTETVLFGEHGAVAAMQPGGVVIASATVAPEFAV
FT                   ALGARIEAAGLQMLDAPVSGGAARAASGEMTMMTSGPAAAYAGCEDVLAAIAGKVYRLG
FT                   DAHGIGSKVKIINQLLAGVHIAAAAEAMALGLREGVDADALYDVITHSAGNSWMFENRV
FT                   PHILNGDYTPLSAVDIFVKDLGLVLDTARRSKFPLPLSATAHQMFMSASSAGHGGEDDS
FT                   AVIKTFPGITLPPAR"
FT   sig_peptide     complement(275823..275897)
FT                   /locus_tag="Bcen_3212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.602) with cleavage site probability 0.260 at
FT                   residue 25"
FT   gene            complement(275956..276660)
FT                   /locus_tag="Bcen_3213"
FT   CDS_pept        complement(275956..276660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3213"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0479 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78108"
FT                   /db_xref="GOA:A0A0H2XV72"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV72"
FT                   /protein_id="ABF78108.1"
FT                   /translation="MFEKIPARAMSDHVAQQLLKQIEVGSFSATGKLPTEAVLAQEFGV
FT                   SRTVIREAISRLKNEGVVEPRQGSGVFVNQHGAIRPLRIDYAEAVEASSLPHLLAVRRA
FT                   IEAEVAAEAALHHTADDMADIDDALRKIDAAVAEGRDGVAEDVAFHRTIAAVTGNPYFL
FT                   KTLQFLNQYLEAGVKVTRSNEATREDFSRQVREEHAAIADAIRARDPMAARNAARTHMY
FT                   NAARRLAEAGIC"
FT   gene            complement(276851..277933)
FT                   /locus_tag="Bcen_3214"
FT   CDS_pept        complement(276851..277933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3214"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0484 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78109"
FT                   /db_xref="GOA:A0A0H2XT45"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT45"
FT                   /protein_id="ABF78109.1"
FT                   /translation="MAAMTPDVPASPLAEPAPRRIRFGIVLLPNFTLTAFSDFVDMLRL
FT                   SADDGDYSKPVRCAWSVIGETLAPVRASCGIQITPWETFDAAEPFDYVVVVGGLLHSGP
FT                   QAGPETLDFIRRAAAGGATVVGICTGVFTLMRAGVLDGYRTCVSWFHYWDFIERFPSAD
FT                   PDLLIADRLFVIDRRRITCSGGRASIDVAAAILLRHFDHATVQKALRILLVGEMQKGNA
FT                   PQPHPPGLEPATHPKVKRAILLMEQHVGRALPLEELACKLDLSTRQLERLFKAETGKSP
FT                   QAFAKQVRLRTAAWLLTSSDRTVADIASSCGFADASHLGREFRKQFGVPPATYRERGGD
FT                   VAEVDAALDASADPVEDIAD"
FT   gene            278007..279596
FT                   /locus_tag="Bcen_3215"
FT   CDS_pept        278007..279596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3215"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: sdaA; L-serine ammonia-lyase TIGRFAM: L-serine
FT                   dehydratase 1; PFAM: serine dehydratase alpha chain; serine
FT                   dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78110"
FT                   /db_xref="GOA:A0A0H2XUD7"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUD7"
FT                   /protein_id="ABF78110.1"
FT                   /translation="MQPASPIGRGRTCGFPSRTIAKTHFRAGRRGAWRRYPTPMPFLFY
FT                   RPILRFDVLGPNDISRMQPKGSQMNVSAFDLFKIGIGPSSSHTVGPMIAACRFASHVED
FT                   ANLLGFVRRVRVELYGSLGATGKGHGTDKAVLLGLEGHLPDTIDPDLIEPRLAAIRAEK
FT                   SLSLLGKQTVRFDEKEHIGFYRKLMSGTSIVHPNGMRFQAFDEHGQLLVEKEYYSVGGG
FT                   FVVNRDGDRVNGVRAAVEVPYPFRTGDDLMRQCREHGLSIAELMLRNECALRPADEVRA
FT                   GLLAIWRTMAACVERGCKVEGDLPGPMRVKRRAAELNGRLRSRSEESLRDPLSMLDWVN
FT                   LYAMAVNEENAAGGRVVTAPTNGAAGVIPAVLHYYVKFVPGSNEAGIVEFLLTAAAIGI
FT                   IYKETASISGAEVGCQGEVGVACSMAAAALAAVMGGTPDQVENAAEIGMEHNLGMTCDP
FT                   VGGLVQIPCIERNAMGAIKALNASRMALKGNGQHYVSLDSVIKTMRETGADMKTKYKET
FT                   SRGGLAVNVIEC"
FT   gene            279590..280855
FT                   /locus_tag="Bcen_3216"
FT   CDS_pept        279590..280855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3216"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B0486 sarcosine oxidase, beta subunit,
FT                   heterotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78111"
FT                   /db_xref="GOA:A0A0H2XV59"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV59"
FT                   /protein_id="ABF78111.1"
FT                   /translation="MLTKDPNMSRYSIFSLFRNGLSYHENWEKQWKSPEPKKEYDVVIV
FT                   GGGGHGLATAYYLAKEHGITNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAM
FT                   KLWEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQIKEI
FT                   EPTINLNSRYPVLGASIQRRAGVARHDAVAWGFARGADRAGVDIIQNCQVTGIRREGGA
FT                   VVGVDTVKGFIKAKKVAVVAAGNTTTLADMAGVRLPIESHPLQALVSEPIKPVVNSVIM
FT                   SNAVHAYISQSDKGDLVIGAGIDQYTGFGQRGSFHIIESTLQAIVEMFPVFSRVRMNRQ
FT                   WGGIVDVSPDACPIITKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIARDEPHPLNAP
FT                   FALDRFYTGHLIDEHGAAAVAH"
FT   gene            280877..281176
FT                   /locus_tag="Bcen_3217"
FT   CDS_pept        280877..281176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3217"
FT                   /product="Sarcosine oxidase, delta subunit,
FT                   heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase, delta subunit,
FT                   heterotetrameric; KEGG: bur:Bcep18194_B0487 sarcosine
FT                   oxidase, delta subunit, heterotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78112"
FT                   /db_xref="GOA:A0A0H2XTX1"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTX1"
FT                   /protein_id="ABF78112.1"
FT                   /translation="MLLIECPWCGPRAESEFTCGGEADIVRPVANETMTDREWGEYVFM
FT                   RENKRGLHKEQWLHTQGCRRWFKVTRDTVTYDIKGYEKFGGASAGNAHEEGTSK"
FT   gene            281173..284184
FT                   /locus_tag="Bcen_3218"
FT   CDS_pept        281173..284184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3218"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /EC_number="2.1.2.10"
FT                   /note="KEGG: bur:Bcep18194_B0488 sarcosine oxidase, alpha
FT                   subunit, heterotetrameric TIGRFAM: sarcosine oxidase, alpha
FT                   subunit family; PFAM: glycine cleavage T protein
FT                   (aminomethyl transferase); FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78113"
FT                   /db_xref="GOA:A0A0H2XV75"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV75"
FT                   /protein_id="ABF78113.1"
FT                   /translation="MSQKDRLGTGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGV
FT                   HFVARSFKYHRPRGIVTADVAEPNAVVQLETGPYTVPNARATEIELYQGLVATSVNAEP
FT                   TLENDKYAINQKLSRFMPAGFYYKTFMWPRNMWPKYEEKIREAAGLGKAPEVLDADRYD
FT                   KCYAHCDVLVVGGGPSGLAAAHAAATAGARVILVDDQRELGGSLLSCRAEIDAKPALQW
FT                   VEKIEAELRKLPDVTILSRSTAFGYQDHNLVTVTQRLTDHLPVSMRKGTRELLWKVRAK
FT                   RVILATGAHERPIVFGNNDLPGVMLAGAVSTYVHRFGVLPGRNVVVFTNNDRAYQTALD
FT                   LKACGAKVTVVDSRASSNGALPAAAKRQGVTVMSGAVVTAASGKWRVSSVDVASYSNGQ
FT                   TGGKLQTLPCDLVAMSGGFSPVLHLFAQSGGKACWNDEKACFLPGKPVQAEASIGAAAG
FT                   EFGLARALRLAVDAGVEAAKAAGFTAAQRPAAPQVAEAVEGALQPLWLVGSREAAARGP
FT                   KQFVDFQNDVAAADILLAAREGFESVEHVKRYTAMGFGTDQGKLGNINGMAILAGALGK
FT                   TIPETGTTTFRPNYTPVSFGTFAGRETGDFLDPIRKTAVHEWHVEHGAMFEDVGNWKRP
FT                   WYFPKNGEDLHAAVKRECLAVRNGVGILDASTLGKIDIQGPDAVKLLNWMYTNPWNKLE
FT                   VGKCRYGLMLDENGMVFDDGVTVRLADQHFMMTTTTGGAARVLTWLERWLQTEWPDMKV
FT                   RLASVTDHWATFAVVGPKSRKVVQKVCQDIDFGNEAFPFMSYRNGTVAGAKARVMRISF
FT                   SGELAYEVNVPANAGRAVWEALMAAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSI
FT                   TPFDLGMGGVVAKSKDFLGKRSLSRSDTAKEGRKQFVGLLTEDEQFVLPEGAQIIAKDT
FT                   QVSATDPTPMIGHVTSSYYSPILKRSIALAVVKGGLNKMGESVVIPLANGRRITAKISS
FT                   PVFYDTEGVRQHVE"
FT   gene            284174..284806
FT                   /locus_tag="Bcen_3219"
FT   CDS_pept        284174..284806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3219"
FT                   /product="Sarcosine oxidase, gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase, gamma subunit; KEGG:
FT                   bur:Bcep18194_B0489 sarcosine oxidase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78114"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT49"
FT                   /protein_id="ABF78114.1"
FT                   /translation="MWNETRNQTQVAGAGGVTLESPFVGAADVLKAHQARASKKFTLRE
FT                   RPFLDLVNVRGELSDSAFVAAFERVVGCLPPAAPNTVARGAEYDVLWLGPDEWLVRSNG
FT                   PVQAGVLEAKLAEAVQGSYAAAVDVGSGYTVVEISGERVRDVIARGCPLDLHPRVFKPG
FT                   QCAQSHYFKSPITLIPTGDDTFEIVLRRSFADYFVRIMLDAAAPLVS"
FT   gene            284803..285243
FT                   /locus_tag="Bcen_3220"
FT   CDS_pept        284803..285243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3220"
FT                   /product="Dihydroneopterin aldolase"
FT                   /note="TIGRFAM: Dihydroneopterin aldolase; KEGG:
FT                   bur:Bcep18194_B0490 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78115"
FT                   /db_xref="GOA:A0A0H2XUE3"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUE3"
FT                   /protein_id="ABF78115.1"
FT                   /translation="MKPFDEPFVAIDAPRLRGRGWSVFVDELKVPARIGIHAHEHEAPQ
FT                   PVVIDARLEYRCEPSEQGEWIDYDGYCARVASFLAHKPHTRLLETLVADLAVLSFREWP
FT                   ALESLTLSMYKPKIRPGTKRVGVSLDWTRGDYLRWTGAAGQL"
FT   gene            complement(285344..286030)
FT                   /locus_tag="Bcen_3221"
FT   CDS_pept        complement(285344..286030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3221"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bur:Bcep18194_B0495 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78116"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV64"
FT                   /protein_id="ABF78116.1"
FT                   /translation="MRRRFFWLIVLSLGIAQHAAAQQAPALPASAPEAAASAPGDASAP
FT                   LANDQPNEANRRITSYLTKKFGVAKERAAKLADIVSVTATKYSLPPALVYAIISIESRF
FT                   QEKARGQHGATGLMQVVPSAHRGMLRNVKDLTEPNANVEVGSRILSGYVKAAGGNVQAG
FT                   LKSYSGGSSAYAAKVMQRVDSFRFVLEPEDDAKSANTANDANNAKAHMVPVSDPSPAPA
FT                   ANRNTK"
FT   sig_peptide     complement(285965..286030)
FT                   /locus_tag="Bcen_3221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.890 at
FT                   residue 22"
FT   gene            complement(286304..286699)
FT                   /locus_tag="Bcen_3222"
FT   CDS_pept        complement(286304..286699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3222"
FT                   /product="rifampin ADP-ribosyl transferase"
FT                   /note="KEGG: sco:SCO2860 rifampin ADP-ribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78117"
FT                   /db_xref="GOA:A0A0H2XTX4"
FT                   /db_xref="InterPro:IPR021975"
FT                   /db_xref="InterPro:IPR038611"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTX4"
FT                   /protein_id="ABF78117.1"
FT                   /translation="MAVLDTGPFFHGTKADLRIGDLLTAGFRSNYRHDVVMNHIYFTAL
FT                   PKGAGLAAEMAKGDGRPRVYIVEPTGEFENDPNVTDKKFPGNPTRSYRSTSPLKIVGEL
FT                   DRWEPYDPEFIQQLRIRIETGIGEIIN"
FT   gene            complement(286732..287499)
FT                   /locus_tag="Bcen_3223"
FT   CDS_pept        complement(286732..287499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3223"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0496 ABC
FT                   proline/glycine betaine transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78118"
FT                   /db_xref="GOA:A0A0H2XV82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV82"
FT                   /protein_id="ABF78118.1"
FT                   /translation="MTTCGNVQFQQSSLPAYVARAAALVLLLVLLLRPAWLQGLFAPFA
FT                   DNGAPVIYDRASLLDLTLAHLGTVALSSLIGTIVAVAAGIAVTRPFGADFLPVARSVVD
FT                   IGQTFPPVAVLALAVPAVGFGLKPVLIALVLYGLLPIFESTIAGLEDVPRDVVDAARGM
FT                   GMSGWQQLVSVELPLAFPVIVNGIRLAVVINLGTATIGSTVAARGLGDVIIAGLQTSNT
FT                   AFVLQGGVIVGLLAVLVSDAIGAIARAASARRA"
FT   gene            complement(287496..288449)
FT                   /locus_tag="Bcen_3224"
FT   CDS_pept        complement(287496..288449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3224"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0497 ABC proline/glycine betaine
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78119"
FT                   /db_xref="GOA:A0A0H2XT52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT52"
FT                   /protein_id="ABF78119.1"
FT                   /translation="MIEIERVGKRFGDALAVDDVSLTVQRGTITALVGASGSGKSTLLR
FT                   MINRLIAPTSGTIRIDGVDTATVAPEQLRRGIGYAIQGHGLFPHWSVARNIATVPRLLG
FT                   WPAERIDARVNELLDLFHLAPAEFAGKLPHELSGGQQQRVGVARALAAEPAILLMDEPF
FT                   GALDPIIRNKAQDDLFALQRRLGITVVIVTHDIEEALKLGDTIAVMDGGRLLQVASPAE
FT                   ILGGPAPGVVEQLVAGVDRPLRLLALTPIDTVAEAGHVDGEPIAATRTLRDAVSELLWR
FT                   GVDALPVDDTANGTPNARGPRRITLDAIRAHARKPA"
FT   gene            complement(288446..289624)
FT                   /locus_tag="Bcen_3225"
FT   CDS_pept        complement(288446..289624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3225"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B0498 ABC
FT                   proline/glycine betaine transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78120"
FT                   /db_xref="GOA:A0A0H2XUE8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUE8"
FT                   /protein_id="ABF78120.1"
FT                   /translation="MTERAAASARRVTLDKVGILIGILTIVAVFGLSFAVLRPNRIAAG
FT                   TGLSVFAALPPMQGAALAALWTVGALWAMTASRPAWRLAAGCAGLATLAYAVGAAATHV
FT                   VAPDDMLARVSPDAGVWLLLFAWAVLIADALARLAFGPWRRLAALAVAIAAVSVPLASG
FT                   WWDGLSVMREYAVRSDDFWREAIRHVSLAGGSVAAALVAGVPLGIACARIATVRTVAMP
FT                   VLNIVQTIPSIAMYGLMMAPLGLLAAHVPLAAALGIRGIGVAPAVLALFLYSLLPIASS
FT                   VVVGLEQVPPHVTEAARAMGMTRMQRLLRVDLVLALPVILSGVRIVLVQNIGLTAVAAL
FT                   IGGGGFGTFIFQGIGQSAADLVLLGAIPTIALALASAVVFEAATSLAKGRAG"
FT   gene            complement(289621..290544)
FT                   /locus_tag="Bcen_3226"
FT   CDS_pept        complement(289621..290544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3226"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bur:Bcep18194_B0499 ABC
FT                   glycine betaine/choline transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78121"
FT                   /db_xref="GOA:A0A0H2XV69"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV69"
FT                   /protein_id="ABF78121.1"
FT                   /translation="MKLALPARILGLAFAAAIVAPGAHADTPVVVSSKIDTEGNLLGNL
FT                   ISQVLKAHGIPVTEKIALGTTPIVRKALTSGEIDVYPEYTGNAAFFFNKADDPVWKNAS
FT                   QGYDTAKKLDYAANHLVWLAPAPANNTWGVALLAPVAQSQHLKTFSDFGKWVAGGGKVK
FT                   LAASAEFVNSASALPSFEKAYGFKLKPEQLVVLSGGDTAATIKAAANQTDGVNAAMVYG
FT                   TDGGIASSGLAVLDDDKHVQPVYAPAPVIREAALKAHPQIADLLKPVFASLDLKTLQSL
FT                   NARIQLNGEPAAGVAKSYLKAKGFVK"
FT   sig_peptide     complement(290467..290544)
FT                   /locus_tag="Bcen_3226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            290712..291641
FT                   /locus_tag="Bcen_3227"
FT   CDS_pept        290712..291641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3227"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; KEGG: bur:Bcep18194_B0500 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78122"
FT                   /db_xref="GOA:A0A0H2XTX8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTX8"
FT                   /protein_id="ABF78122.1"
FT                   /translation="MKPELLVLIALRGDAHREIAASFDVRYAPTPDARERAIAEHGGTI
FT                   RAVLTNGSTGLTAAEIDRLPQLTFVSALGAGYEHIDVAHAKARGITVVTGAGTNDDCVA
FT                   DHAFALLLAAVRNVVQLDAKTRAGVWRDGLSMPPNVSGKKLGIVGLGKIGEKCARRAAG
FT                   FDIEIGYHNRSEKPVPYRYFDRVDTLAQWADFLIVATPGGAGTRHLIDRTVLDALGPGG
FT                   FLVNVSRGSVVDTAALADALREERIAGAGLDVYEGEPEPPRALTDLDSVVLTPHMGGWS
FT                   PEALDRSVRQFLDNAARHFTGQPVLTPV"
FT   gene            complement(291663..292031)
FT                   /locus_tag="Bcen_3228"
FT   CDS_pept        complement(291663..292031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3228"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mth:MTH1336 mutator
FT                   MutT protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78123"
FT                   /db_xref="GOA:A0A0H2XV87"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV87"
FT                   /protein_id="ABF78123.1"
FT                   /translation="MIPVSAKAIVRDGRSVLFLRNPRDEWELPGGWPEAGESLEDAVIR
FT                   EVQEECGIVASAIRYVGSRSCEVVPGKRVLIVCFRCEVDRREIVLSDEHHQFGWIDLDA
FT                   AKPANLPDFYWAFCKQAD"
FT   gene            complement(292167..294137)
FT                   /locus_tag="Bcen_3229"
FT   CDS_pept        complement(292167..294137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3229"
FT                   /product="dipeptidyl-peptidase IV, Serine peptidase, MEROPS
FT                   family S15"
FT                   /EC_number="3.4.14.11"
FT                   /note="PFAM: peptidase S15; KEGG: bur:Bcep18194_B0505
FT                   Xaa-Pro dipeptidyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78124"
FT                   /db_xref="GOA:A0A0H2XT57"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008252"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT57"
FT                   /protein_id="ABF78124.1"
FT                   /translation="MNIHRTGVRRAWLPALVAAATLAACGGDDGGSVAGVSALAQGQQE
FT                   GAAAAADTAGAPSLASRFSPSGVPYANPASSGRYKPVISNGQVQPSLSGGTIEENAWVD
FT                   TPVDSDGDGTRDRIHVRIVRPSETANGARTPVIVLASPYYAGLADSPDHDVDVELDGTP
FT                   HPAATAGAAASASTRILAAAPQSRMLQQVEAAAAGRSWIESYFVPRGFTIVYADSLGTA
FT                   GSDGCPTILTRDESVAMASVIRWLGRDATAKDANGKTVVANWSTGHVGMYGVSYDGTLP
FT                   KMVASLRTRGLDAIVPIAGLSNMYGYYRSGGLVRAPEGYQGEDVDVYIKALLTNAHPER
FT                   CTHLIDEALQQEDRKTGDYSPFWAARDIPTAFAVAPALVAQGLTDDNVRVDQSTSWYLA
FT                   MRRQGVPTQLWLHRLKHTDPTRVPGMADAWTAEVNRWFTRYLIGFDNGVEHDPRAVVAQ
FT                   ADGTLLKEADWAARHATPVTYFAGGDGASTGTLLRLPSGGPLARFTDDARIPALTLANT
FT                   PTGENRSRFETAPLTAAARLSGAATARVRLTFTGVANVTALLVDRAPDGTATIVTRAWT
FT                   DPRNRLSERVSQPVLPGMPYDLKLTFMPRDYKLEAGHRLGLVVLSSDYEATLRPTPGTG
FT                   LTLDPAGTSVTVPLASPSTGA"
FT   sig_peptide     complement(294057..294137)
FT                   /locus_tag="Bcen_3229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.794 at
FT                   residue 27"
FT   gene            294653..295498
FT                   /locus_tag="Bcen_3230"
FT   CDS_pept        294653..295498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78125"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUF3"
FT                   /protein_id="ABF78125.1"
FT                   /translation="MKNTLKTRERAMTITVTAAGGLTLAQMAQAALDGRQTTDTTASGA
FT                   PQDEPIRIRAIDPQAQQAAMTKQLSMVGDLSMKLRGVTDALATSLQDIVAKRPDLADAQ
FT                   FDFATDAGRIKVVSKTMTDSDRAWIESTLNSNAGLVLATRDFHEQAVDIAAQGAAVRGD
FT                   TFTDSDRAAASQAADARFHFMSLLNRSVAENPPPVAPGGHFTTQDGTTLTIEPSAGTAR
FT                   GTLALLDAARQLSSGAAIFVDSSGNKSYGMRTELVNVGFDVLAGYTPDGGNSVGFHEIA
FT                   "
FT   sig_peptide     294653..294745
FT                   /locus_tag="Bcen_3230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.939 at
FT                   residue 31"
FT   gene            complement(295534..296802)
FT                   /locus_tag="Bcen_3231"
FT   CDS_pept        complement(295534..296802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3231"
FT                   /product="Lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family"
FT                   /note="TIGRFAM: Lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family; PFAM: protein of unknown function
FT                   DUF214; KEGG: bur:Bcep18194_B0507 lipoprotein releasing
FT                   system, transmembrane protein, LolC/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78126"
FT                   /db_xref="GOA:A0A0H2XV74"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV74"
FT                   /protein_id="ABF78126.1"
FT                   /translation="MKGNRLKLPFEWQIGLRYARGGRRSAGDGFVSFIAGAAMAGIALG
FT                   VAALIVVLSVMNGFRTEVRDRMLSVLAHVEIFSPSGAMPDWRLTAHESLQNAAVRAVAP
FT                   YVDAQALLTNAGNVTGVALRGIDPVLEPRVSEIARKLKTGRLDALVPGEMGIVLGAALA
FT                   DTLHVKIGDRITFFAPGNTARLGDALPRFRQFNVVGTFESGHYQYDSALAYIHIRDAQQ
FT                   LSNVNAPTGIRLRIDDLQRAPEIALALSRTLSGNLYLRDWTRQNRTWFEAERLQKRMLS
FT                   LILMLIVAVAAFNLVSSLVMTVTQKQGDIAILRTLGAPPRSIMKIFAIQGMTIGLAGTL
FT                   AGVALGCAIAVSIPVVLPAVEQLLGIRFLTPSVYFLSALPSKLSALDVIEIASAAFLMS
FT                   CVATLYPSWRAARVRPAEALRDE"
FT   gene            296883..297944
FT                   /locus_tag="Bcen_3232"
FT   CDS_pept        296883..297944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3232"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: putative transposase, IS891/IS1136/IS1341;
FT                   KEGG: noc:Noc_1587 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78127"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTY2"
FT                   /protein_id="ABF78127.1"
FT                   /translation="MAGMILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWGK
FT                   KWPTGFDLNVLTTGSSKELGIHSGTINATCEQYAKSRSQRRRPYLRYRGRKSLGWVPLK
FT                   GRDLKREGDAFRFAGNTFRVFNSRPLPEGKIKDGTNFAQDARGNWFLNIVIEMPDVQAR
FT                   PVRSGVGIDLGLKDFATLSTGEKLPNDQFGRRAAEKLAKAQRARKHKRHIAKLHAKIAN
FT                   ARADSQHKLALDLVRHFDYIAVGNVSAAKLARTRMAKSVYDASWSSFRNTLRYKAIAHG
FT                   ATFEEVDESGSTQSCSACGSKDSTTRPKGIAGLRVREWACSDCGVEHDRDINAALNILR
FT                   CGRASPGVGILSL"
FT   gene            297922..298242
FT                   /locus_tag="Bcen_3233"
FT   CDS_pept        297922..298242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV92"
FT                   /protein_id="ABF78128.1"
FT                   /translation="MWESSPFRERGTSIRFDPAEPGILANAAPPCAEIGRWTREPVEIR
FT                   PTDRSSAGVARRHTAVSIVSGLIDNGAQHPVEHTKYSRRNRAAPSQTQNDSGKVAAGAA
FT                   CP"
FT   gene            298258..304260
FT                   /locus_tag="Bcen_3234"
FT   CDS_pept        298258..304260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3234"
FT                   /product="alpha-2-macroglobulin-like protein"
FT                   /note="PFAM: alpha-2-macroglobulin-like; KEGG:
FT                   bur:Bcep18194_B0508 alpha-2-macroglobulin-like large
FT                   extracellular alpha-helical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78129"
FT                   /db_xref="GOA:A0A0H2XT62"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT62"
FT                   /protein_id="ABF78129.1"
FT                   /translation="MDLLRFLLLLPIRVAGFVWWLLGCALRPLVGDVSWTAPAWMGVTA
FT                   AAVRRRPWHAGGLVLLAAALGYGGYWFKHRPKPPEPETVGFTVKAPAITTYEVDDADKP
FT                   KITVHPLEVAFSQSAAPIEQVGKPAGDGIEMTPALKGAWEWADDKTLRFTPVADWPVGA
FT                   HVEVRFAVHRVFAPQVTMHDDRFAFDVPAFAATFGDNQFYQNPDNPAEKQALLQLRFNY
FT                   PVDPAEFEKRIDLVLVGRDGKTVSPLRYTVNYDKMKTSAWVHSQPLEIPRDPLAVRLDV
FT                   DKGVKSARGGNGTPDVLHASVGVPGLYSLSIGNIAPTLVDNERYEPEQVLVAETSDGVR
FT                   GADLAARAKAWVLPKRKPGVEQADDDPPYEWNVADISDAVLKQSKPLPLDVVPTENDFA
FT                   TLQSFKYHATPGERVVVRFEGDLKSTGGYRLGAPVTNAFTVPDYPKLLRFMADGSLLSM
FT                   SGSKRLSVVSRNLPGMKVEIGRVLPDQIQHLVSFNNGTYARPELSYSFSEDHIVERFVQ
FT                   TRAFPAGDPGRAHYEGIDLGQYLKDGKRGVFLLHLSKYDPAAEKKKADDAKGSDSASDD
FT                   GSQDQSDNADSGDSSGNGDDGDNALGDTRLIVVTDLGMLVKKALDGSQDVFIQSIRTGR
FT                   PVAGATVSVLAVNGQALFTQTTSTDGVVHFPAFKGLDREKRPQLYVVKKDTDLSFLPVA
FT                   GRDRQLDFSRFDVDGERNATGQGQLSAYLFSDRGLYRPGDPFHIGLIVRAANWARSPAG
FT                   VPLQAEIVDPRGMTVERKPVTVDATGFTELGYTTAETAPTGTWTVNLYIVKDGQPGAEP
FT                   IGSTTVQVKEFLPDRMKVDAKLSQQVVEGWVKPKGLKGLVDAQNLFGTPAEKRRVAATL
FT                   TLRPVWPSFRSWQGYHFFDARRAKEGYTTTLQDGTTDDKGHAEFDLDLDKYADATYQLY
FT                   FQAKAYEAEGGRNVAANAQTLVSNNDWLVGYKSVDDLGYVKRGSPRTVRLVAIDPRAKA
FT                   IDVKDLRAQLVEQRYVSVLTKQDSGAYKYDSRLKEVPVDEKPLSIPAAGLDYALRTDKP
FT                   GSYALVIRRADGAAVNRIEYSVTGAANVTRSLDRNAELQVSLAKHDFKPGEQVEIAIRA
FT                   PYAGSGLITIERDKVYAHAWFHADTTSSIQHITVPAGFEGNGYINVQYIRDPSSDEIFM
FT                   SPLSYGVVPFSVNLDARRNAVSVDAPALVKPGDTVNFTVHSAKPAKVVVFAVDEGILQV
FT                   ARYKLGDPLKFFFRKRMLEVGTSQILDLILPDFEKLMAMAAPGGDADDAIGRQLNPFKR
FT                   KRDKPVVYWSGIVDVNGDTRLSYTVPDYFNGKLRVMAVSVSPDLVGTFEGATTVRGDFV
FT                   LSPNVPTTLAPGDEADVSVGVANNLTGVGNQPVPVAVTLKTGPQLQVIGPATQNVALAP
FT                   QHEGVALFRVKVTDTLGSGALSFGARYGAKGAQQRVDVSVRPAAAFRTQLDIARLDPGK
FT                   KAGVPNLRSMYDAYASRDASISTAPLVLSEGLSSYLVNFEHACSEQMVSAAVPRMFAAK
FT                   WLSVRALTSAMHAPEAGADAANASAIAQFVGVLRSRQNAQGGFGLWSATPDADPFVSAY
FT                   AMHVLLDARDRGVAVPKDMLDAGNAYLQRLAANDSLGSLDLLRQRAYAVYLLTRQGNVT
FT                   TNSLAAVQKRLQAAYPNDWRNDLAAAWLAASYQLLKQDKEAAALIAGPQALLERKRASD
FT                   GDYSTGYYIDPLTRDASVLYLLAKHFPERVRKLSPRAMDNLAAPLVDNRYNTLSSAMTI
FT                   LALDAYAASNVGQLDQLAINEVRAGAAPKDVSSIQANLVRSGTWAAGASRVDFVNGSTL
FT                   PAWWVASQSGYDRGTSTKAIRNGLEIVRDYTDTDGKPLARIALGQEIDVHLKIRATGSA
FT                   NVGNVAIVDLLPGGFDPVIAPPPATDTQEGDGNGDGSASAPVADAPWHSPIGVKGSTWQ
FT                   PQFADIREDRVVIYGTATTDVREFVYRIKASNAGRFVAPPAYGESMYDRRVQAQAPGGT
FT                   ALTVERVR"
FT   gene            304306..306735
FT                   /locus_tag="Bcen_3235"
FT   CDS_pept        304306..306735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3235"
FT                   /product="Penicillin-binding protein 1C"
FT                   /note="TIGRFAM: Penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase, family 51; KEGG: bur:Bcep18194_B0509
FT                   penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78130"
FT                   /db_xref="GOA:A0A0H2XUF7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUF7"
FT                   /protein_id="ABF78130.1"
FT                   /translation="MADASLLRRALHSAGRWLHRWQNWLGGALPVFGALAACRLWPHPP
FT                   LRDWKPSSVAVTDAQGRLLRLTLAKDDRYRLWVPLDRMSPQLVEAVMLHEDRWFRWHPG
FT                   FNPYGLLRGAWITYVRGGNPQGGSTLTMQLARSLWKLNTRTPAGKLEQVARAVQLELFY
FT                   SKRQILEAYLNDAPYGRNVEGAGTASVVYFDRMPDALTLPEALALAVIPQDPARRVRGG
FT                   QDAINRALAASRNRLYARWLTKHPRDASLAPLFALPLAMRPLSALPFDAPHAVDQALAA
FT                   RSAWRTTSGATAADGDRDDGSDGGARLVTTLDLDLQRTLERQISRYVARNDTRGVRNAA
FT                   AILVDARDMGVKALVGSANFFDRTIDGQVNGTLARRSPGSTLKPFIYALGFDQGVLHPQ
FT                   TVLRDVPTSFGPYAPENFDGHFLGPITATDALNRSRNVPAVWVASQLKSPDLYRFLQDA
FT                   GVRRLASAQHYGLALVLGGGEVTMQDLAALYAMLANRGEFRPLRLRADEPALPGRRLLS
FT                   TEASYMTMDMLRQHLRPDETSGAQPSSVPVYWKTGTSWSFRDAWTAGVFGPYVLVVWVG
FT                   NFDNSTNTAFVGVDAAAPLFFQGVDAMNAERTLVEPPRAVPPNLKRVRVCLASGDLPNE
FT                   WCPQQGWTWFIPGTSPIRVSTVHRPVVIDDATGQAACPPYDGKRTHTEVFEFWPSDLQQ
FT                   VFAQAGIPRRRPPQNAACRDAGQVEGDPPRITSPLRGSTYAMRVKSTDETRIAFNATAD
FT                   ASAHALYWFVNDAYVGRSAPGDALFWQPRTAGSYTVRVVDDHGRSDQRPLGVGLEQ"
FT   gene            complement(306760..308190)
FT                   /locus_tag="Bcen_3236"
FT   CDS_pept        complement(306760..308190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3236"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bja:bll1532 putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78131"
FT                   /db_xref="GOA:A0A0H2XV80"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV80"
FT                   /protein_id="ABF78131.1"
FT                   /translation="MPSRRPTNVNFFGIGRGRRSSRALVGDIAEQAGKLGIEICDVSGH
FT                   VEEVAARVARQAEVCHTLRESAALTLRGNHRIAEAAQQVRDVSANASNAVQQSQQTIEA
FT                   SLADIHGLVEGVTTISDQMGALRDALDHVRTVSEEISVIARQTHLLALNAAIEAARAGE
FT                   SGRSFAVVAAEVKNLSAKTGQATAQIETTLARLAEQTEHLLAEGTDNAARAHRVREGTR
FT                   TIGEVVHATGHAITELAGEAEQIASLTDEIEAQCHRLDEQVGEMASGVENSADNFSQAK
FT                   DRLGNLLSVSETLIELTAATGIESPDTRLIDTARSTAAAISKLFEDAVGRGDITLDALF
FT                   DTHYEPIPGTDPQQFMTRFTAFTDRVLPAIQEPVLDVDARVVYCASFDRQCYLPTHNRK
FT                   FSLPQRSDAAWNAANCRNRRIYTDRTARMSVAHDKPFLLQTYRRDMGNGQFALMKDVSA
FT                   PIVVGGRSWGVLRIGYSV"
FT   gene            complement(308417..309487)
FT                   /locus_tag="Bcen_3237"
FT   CDS_pept        complement(308417..309487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3237"
FT                   /product="outer membrane protein (porin)"
FT                   /note="KEGG: bur:Bcep18194_B1202 outer membrane protein
FT                   (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78132"
FT                   /db_xref="GOA:A0A0H2XTY7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTY7"
FT                   /protein_id="ABF78132.1"
FT                   /translation="MKSRTWTMCAALLGAAASTSSFAQSSVTLYGDLDAALLYTNRSLD
FT                   SATGGNAGRQFALTDTGMTPTNFGITGTEDLGGGLHARFKLESGFNITDGAFGHSNGNF
FT                   FGRQAWVGIDGGFGETKVGLQFSPFVLAILGSDPRNVSHFGAALVPYVDNVLVTGLFNP
FT                   NAISYTSPTIAGLTASAMFGFGGKAGDFQAGRQYSGSLTYTNGGFMLNAALYDGNGGTS
FT                   PTPVASTVAFVGRTIGAGYTFGPVTGKASFTSYKVAGSFSNNVYSAGLDYRVTPALDLN
FT                   TGAWYTTDRNDSHNHSLLAAIGADYSLSKRTGLYAQVGVVNNHGAMNTGLGITGGALYG
FT                   LPGTTVGVNAGIHHVF"
FT   sig_peptide     complement(309416..309487)
FT                   /locus_tag="Bcen_3237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 24"
FT   gene            complement(309705..311741)
FT                   /locus_tag="Bcen_3238"
FT   CDS_pept        complement(309705..311741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3238"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: Acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: bur:Bcep18194_A5520
FT                   acetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78133"
FT                   /db_xref="GOA:A0A0H2XV96"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV96"
FT                   /protein_id="ABF78133.1"
FT                   /translation="MLRFPERRQESHERMETRLSKIESVLHETRQFAPPAALEKTATIS
FT                   GMPAYRALVAEAEQDYEGFWARLAREGLTWHKPFTKVLDERNAPFYTWFDDGELNASYN
FT                   CLDRHVEAGNGERVAVIFEADDGTVTRVTYADLLARVSRFANALKKRGIGKGDRVVIYI
FT                   PMSIEGIVAMQACARIGATHSVVFGGFSAKSLNERLVDVGAVALITADEQARGGKTLPL
FT                   KSIADEAIALGGCEAVKSVIVYRRTGGKIDWHAERDLWMHELTDGESDRCEPTWVGAEH
FT                   PLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFDWKPDDVFWCTADIGWVTGHTYI
FT                   TYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDKVH
FT                   PKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGHERCPIVDTWWQTETGGHMITPLPGAT
FT                   PTVPGSCTLPLPGITAAVVDETGQDVPNGQGGILVVKRPWPAMIRTIWGDPERFKKSYY
FT                   PEELGGTLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESALVSHELVAEA
FT                   AVVGRPDDTTGEAVVAFVVLKRSRPEGDEAAALAKTLRDWVGKQIGPIAKPKDIRFGDN
FT                   LPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLNRSM"
FT   gene            complement(311936..313822)
FT                   /locus_tag="Bcen_3239"
FT   CDS_pept        complement(311936..313822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3239"
FT                   /product="RNA polymerase, sigma 28 subunit"
FT                   /note="PFAM: sigma-70 region 3; KEGG: reu:Reut_A1750
FT                   sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78134"
FT                   /db_xref="GOA:A0A0H2XT68"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT68"
FT                   /protein_id="ABF78134.1"
FT                   /translation="MPSSLDAGPARERDGAPSPCRGAHADRAAHLHALIALGIDRGYVT
FT                   HGEIADALPDDATDGADADAAASMLRELGIDVREHTGAHTAWTLDRHFAQVTEVASPLA
FT                   DASTPLPADDLLAGHTNDPIRLYLREMSATPLLERDEEIALALRLESGRAACIDALSRD
FT                   PAALAAVAALADDIRAGKVAASVYVTGFAGDAESPASAPATLPDAPAIESPAPNDDADL
FT                   SLDSPAWRDTVVDALERVGALAPAMQRALHADGFASAAYRTLLREATASTGRIRFTSRA
FT                   IERIGQANGERATRARTFEQRLVDTLAAAGIRAESARHDLFTPCDDVRAWLHACRAAHP
FT                   DCAAALARHAPALIDARGALARLSGQSALPLHIAIALDARLARIERAMQPARTKLFQSN
FT                   LRLVVSVAKRYADRGLPFSDLIQEGNIGLMKAVDRYDHRRGFKFSTYATWWIRQAITHA
FT                   LADLGRTIRVPAHTVDTLNKLSRLARLHRQRTGDVADARALSTQMRLPVDKVRELMSIV
FT                   REPISADLPVSPDHDLTLCDVTIDPDAPTPEEAASAGQLRAAVAELIDSLPVREAWILR
FT                   LRYGIDVDNEYSLREIGRQLNLSAERVRQLEVSALERIRQFRHAPALRSLLA"
FT   gene            complement(313806..314120)
FT                   /locus_tag="Bcen_3240"
FT   CDS_pept        complement(313806..314120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3240"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bur:Bcep18194_C7357 high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78135"
FT                   /db_xref="GOA:A0A0H2XUG2"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUG2"
FT                   /protein_id="ABF78135.1"
FT                   /translation="MISRHRRTFFVQAAGLCAALAAGTRAFAAAPPVDENDAAAKTLGY
FT                   RAKATTVDAGKFPKYQAGQTCSNCRFYKAAAGESSGTCPMFAGKTVAAEGWCNVYAKLA
FT                   "
FT   sig_peptide     complement(314034..314120)
FT                   /locus_tag="Bcen_3240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(314219..315466)
FT                   /locus_tag="Bcen_3241"
FT   CDS_pept        complement(314219..315466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3241"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: bja:bll0332 hypothetical protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78136"
FT                   /db_xref="GOA:A0A0H2XV86"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV86"
FT                   /protein_id="ABF78136.1"
FT                   /translation="MRPMRARRPTRFNRTPTMNTRLTSVTVASLLAVGVVLTPATASAG
FT                   VRVCTLPGSPTTALDRSVAREVFRTAGIAATFNTRGVDDNGDDDGISASELTKSLERDC
FT                   DVIAGFPRSAIADASGSKMTFSQGYLRSGYVSVSLRDAPAPSGAKETIAATYGSPSQLI
FT                   AAQQTNARFDLENTSEKTIGALAAGRAQRAIVWYPSVVAYERAHPKQRFQVAATSSPYS
FT                   DWQLSFAFGPGKDALQQRIDATLSQLSGNGRLASLTRGWTLPDGIAQAAASRVPGRFLD
FT                   GAIASAQRPGFVKVSTSEGGGVPSFDQAQVQHGKKLYGDACAKCHGDQLEGNTAPALSG
FT                   ESFAPEGKSHITVGGIFLYMSSNMPADRPGKMSAQEYEDLMAFLLYSNGYDASKNKLTA
FT                   EIANASKAPLIAGPRK"
FT   sig_peptide     complement(315332..315466)
FT                   /locus_tag="Bcen_3241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.728 at
FT                   residue 45"
FT   gene            complement(315495..317216)
FT                   /locus_tag="Bcen_3242"
FT   CDS_pept        complement(315495..317216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3242"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: ppu:PP2679
FT                   quinoprotein ethanol dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78137"
FT                   /db_xref="GOA:A0A0H2XTZ2"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR034119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTZ2"
FT                   /protein_id="ABF78137.1"
FT                   /translation="MKKLSASASRLATIGIAVAAAVALNPGLVEAAADYPAVTYQRLTD
FT                   AHGDPGWLTYYRTYDGRSHSPLKQIDTSNAKDLKQVWAYKFPADLKQGFEATPIVNGNY
FT                   LFVTTPKDNVYAFDAKTGKQLWKYEPKLGAASFKTACCDVVNRGVALYGKNVYIAMLNG
FT                   EIAALDAQTGTLVWKKQMFEPGLGYAFSLAPLAIDGAIVVGTSGGEYGIRGYIAALNPE
FT                   DGSQVWKRYTIPAAGEKGAETWPDGMQSHGGGAAWLTGTYDAASRTLYWGVGNPGPWLA
FT                   ALRPGDNLYSDSLLALDAKSGNLKWHYQYTNNDTWDYDGVNAAVLADIKYKGKDYDAII
FT                   HADRNGFFHAIDRTTGKLIYATPFVKALSVTGYTDDGKPIQDASKFPKAGTTIETCPSF
FT                   LGGKNWWSISYDQERNIAVVPALHACMSLTGKSVSYMEGLPYLGEGFEIKPEPGSEGYG
FT                   ELTAIDVNTGKKLWSHWSKKPWNGGVATTASGLAFSGSLDGHLYAFDTATGKVLWESPQ
FT                   LASGIISQPSVYEVDGKEYVAVLAGYGGANPIWGGPMADIAKDVPRGGTLYVFALN"
FT   sig_peptide     complement(317121..317216)
FT                   /locus_tag="Bcen_3242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.369 at
FT                   residue 32"
FT   gene            317648..319981
FT                   /locus_tag="Bcen_3243"
FT   CDS_pept        317648..319981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3243"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; KEGG: dar:Daro_1028
FT                   TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78138"
FT                   /db_xref="GOA:A0A0H2XVA2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVA2"
FT                   /protein_id="ABF78138.1"
FT                   /translation="MIRRPKAAGWYGAMRRGRRARCVGVTVGTLALFGLPPGSVRAQQQ
FT                   PDGGAIAPAEPPAIVLPAVVVVGTTPLPGIGTPLSKVPANVQSVRATELDAQHRATLTD
FT                   FFAANLPSVTISDAQGNPYQADVNYRGFTASPLLGTPQGLSVFVDGVRVNEPFGDVVNW
FT                   DILPTQAIDRVQLIPGSNPVYGLNTLGGALAITTKNGRSNPGGEAEVSGGSWGRKTASV
FT                   EQGGTIGSNLDYYATANVANDGGWADHNASRVRQAFGKLRYTDADTTLSIAAGGADNTL
FT                   SGTQTIPRSFLDNRKQAYTYPDRNRNSAGYLTLSGERFFGEHVELSGNAYYRHLRNTNT
FT                   SSNNNTDYGSVDEDGTVDTVQGSNAQSTIVTDSYGGSVQLTLLGKLGGMANRLVAGVSA
FT                   DVANSSYVASSQDASFTDARAAIGIGDFVPQTSAKTRNANVGVYLSDALSLTPHWTLTL
FT                   SGRYDWSKARIGDESGVQPLLDGSHVFSRFNPAVGLNWNPVPGFTTYATYNEGMRSPTA
FT                   IELACADPAAPCSLPNDFIADPALKPVISKTFEAGMRGRIGGATTWSAAAYRTTLTDDI
FT                   QFISSPASAQGYFRNVGDTRRQGIELAGRTRVGPLGVGLSYSYVDATYRSSWTEHSPAN
FT                   SAADANGNVTVKPGDRIPGIPAHTVKLRLDYAATPAWDIGANVTWRGGVYARGDENNGD
FT                   VNGRIAGYVLVDLDMRYRITKRFEVFASVTNLLDKRYASFGALGQNFFNGPNHTFDGAH
FT                   PVNEQFVGPGAPRGAWVGVRYAWD"
FT   sig_peptide     317648..317776
FT                   /locus_tag="Bcen_3243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.979 at
FT                   residue 43"
FT   gene            complement(320051..321067)
FT                   /locus_tag="Bcen_3244"
FT   CDS_pept        complement(320051..321067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3244"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: dar:Daro_1698
FT                   peptidase S33, proline iminopeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78139"
FT                   /db_xref="GOA:A0A0H2XT71"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT71"
FT                   /protein_id="ABF78139.1"
FT                   /translation="MTRRPTRSTPSLAPRALPDTPASPAPPVHRRLHRDAQSIAFAVAG
FT                   AAQGHPVVVLHGGPGSGSQAGILRLFDLTRVRVVLVDQRGAGASGPRGGTRHNDTARLI
FT                   ADLEAVREQLGIARWGVVGGSWGAALALAYAGTHPARVTGVVLRGLFLTSPREVRGLFM
FT                   TSRTRAPREWRRLHAAAGGGRPDHLLSRCAAGLRPGANTARQRAVALAWHAYESAILAS
FT                   ARTRRSPVHAVRSNQTVGRLIDKYRVQAHYLQHDCWLGERRVLALARRAAQARVPLFAA
FT                   HGMHDPVCPVGNVERLARAAPEAEIERVQAGHLASDPALARSVARAVNAMFATVPLT"
FT   gene            321382..323424
FT                   /locus_tag="Bcen_3245"
FT   CDS_pept        321382..323424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3245"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction region; SMART:
FT                   ATPase; KEGG: reu:Reut_A1778 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78140"
FT                   /db_xref="GOA:A0A0H2XUG7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUG7"
FT                   /protein_id="ABF78140.1"
FT                   /translation="MRDDVEQAAGSRAAHPAGWPAPSIQKAHERSETFGLQVSARPDYD
FT                   VLSNAALVLKREQSRVLCVHAMPVMETLHEQIVNTQSMIVLTDAEGLILHSIGDDDFLR
FT                   RAEKVALRPGANWAENRQGTNAIGTALAELCPMVVHGDQHFLAANRFLTCSSVPILDPY
FT                   GDAIGVLDVTGDHRSYHQHTMALAKMSVQMIENHLFTTTFQETLQVSFHGRPEFLGTLM
FT                   EGIVAFTADGRFLSANRSAQFQLGMPLAALRAHTLSSLFDVTSAQLIDRMRASTDRHLM
FT                   LNLGNGAVVCARVHFRRATLAEGSRPTDVHDAGAPAARANAVPAPAAGTSAGLSRLNYL
FT                   DTGDAQVASVIAKVRKVIGKDIPILITGETGTGKELLAQAIHNDSPRRDAPFVAVNCAS
FT                   IPETLIESELFGYEEGAFTGARRKGAIGKLLQANGGTLFLDEIGDMPYPLQVRLLRVLQ
FT                   ERLVNPLGSTKTIAVDIAIICATHRDLREMIAQNRFREDLYYRLNGLVVRLPPLRDRTD
FT                   LAVVVQKMLQREAFAGPGRPPLSVAPDVMELFVRCTWPGNFRQLGNLLRTAAAMVDDDG
FT                   EIRREHLPDDFFDDLRRGDAHVGHAGQAAPDSPAAASAGPCVADALPPADARLQDVAAS
FT                   AIAAALARHGGNVSAAARALGVSRNTIYRKMPAADAGRQPSSDED"
FT   gene            323878..324801
FT                   /locus_tag="Bcen_3246"
FT   CDS_pept        323878..324801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3246"
FT                   /product="Coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: Coenzyme PQQ biosynthesis protein B; KEGG:
FT                   reu:Reut_A1779 coenzyme PQQ biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78141"
FT                   /db_xref="GOA:A0A0H2XV89"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV89"
FT                   /protein_id="ABF78141.1"
FT                   /translation="MKIKILGSGAGGGLPQWNCNCANCRRARSGSGHVLSRTQSSIAVS
FT                   DDGVDWVLVNASPDILSQLRAAPDLQPARAIRDSGIAAVVLCDAQIDHVTGLLMLRERS
FT                   TPLPLYASAPVLDDLSTGLPLVPLLGHYCGVAAHTIVPGEPFAVPAARGIRFTAIAVDS
FT                   KPPPYSPRRASAAPGDNIALSIEDVASGRRAFYAPGLASVTDDVRAAMDGADLVLVDGT
FT                   FWTGTEMIDLGLSGKHASDMGHLAQCAEPGQPGMIDWLDTLPARTRKVLTHINNTNPIL
FT                   DPHSVEHAHLRAHGIDVAHDGMQFQV"
FT   gene            324804..325523
FT                   /locus_tag="Bcen_3247"
FT   CDS_pept        324804..325523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3247"
FT                   /product="Coenzyme PQQ biosynthesis protein C"
FT                   /note="TIGRFAM: Coenzyme PQQ biosynthesis protein C; PFAM:
FT                   TENA/THI-4 protein; KEGG: reu:Reut_A1780 coenzyme PQQ
FT                   biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78142"
FT                   /db_xref="GOA:A0A0H2XTZ7"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTZ7"
FT                   /protein_id="ABF78142.1"
FT                   /translation="MNAPIPATALHATPWTATEFEARLRALESRYHIHHPFNRRLNSGA
FT                   CSPTQIRGWVANRFYYQICIPLKDAAILSNCPDRETRRRWIQRLIDHDGQGDNAGGIEA
FT                   WVRLGEACGLTRDELWSLEHVLPGVRFAVDAYVNFARRAPWQEAVCSSLTEMFAPQIHL
FT                   DRLAGWPSHYPWIEPAGLHYFRSRVPLAQRDVEHGLAVTLAHFTTPDAQQRALGILQFK
FT                   LDILWSMLDAVEKAYPL"
FT   gene            325520..325801
FT                   /locus_tag="Bcen_3248"
FT   CDS_pept        325520..325801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3248"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D; KEGG: dar:Daro_1701
FT                   coenzyme PQQ synthesis D"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78143"
FT                   /db_xref="GOA:A0A0H2XVA7"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVA7"
FT                   /protein_id="ABF78143.1"
FT                   /translation="MNAIEAASGVPLRPCLRGMYRLQWEAAQDAYVLLYPEGMVKLNPS
FT                   AGEILARCDGTRELDDIIGELERLFMQSDLATDVYRFLDHARLRGWLD"
FT   gene            325803..326942
FT                   /locus_tag="Bcen_3249"
FT   CDS_pept        325803..326942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3249"
FT                   /product="Coenzyme PQQ biosynthesis protein E"
FT                   /note="KEGG: reu:Reut_A1782 coenzyme PQQ biosynthesis
FT                   protein E TIGRFAM: Coenzyme PQQ biosynthesis protein E;
FT                   PFAM: Radical SAM; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78144"
FT                   /db_xref="GOA:A0A0H2XT76"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT76"
FT                   /protein_id="ABF78144.1"
FT                   /translation="MTPDTSRPSAPLWLLAELTYRCPLHCAFCYNPVDFATHGAELDTD
FT                   AWRTVISDARALGAAQIGFSGGEPLQRGDLETLVAHARGLGFYTNLITSGIGLNVARIE
FT                   RLKAAGLDHIQLSLQDSTRELNDFLTSTRTFELKRDVARLIKAHGYPMVLNCVLHRYNL
FT                   PHVGQIIEMALDLGADYLELANTQYYGWAMLNRDQLMPTVEQVREAEDTVNRYRKLIGE
FT                   RCKILFVVPDYFERRPKACMNGWGSVFLGVAPDGTALPCHAARSLPGLALPNVRDRSLR
FT                   DIWYDSDAFNAFRGDDWMREPCRTCDERHADHGGCRCQAYLLAGDPREADPVCAKSAHH
FT                   GQVEQAVQFARRRAPSDEQPLVFRSKENSLAQCGAACDC"
FT   gene            complement(327208..327546)
FT                   /locus_tag="Bcen_3250"
FT   CDS_pept        complement(327208..327546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUH2"
FT                   /protein_id="ABF78145.1"
FT                   /translation="MEAPDQDFPVQDLLRRLMADTRSSSEIARLSGVSQPTVSRLRLSN
FT                   GHRLRRSAPFNKLCSFYGVDTEPSRRRYNDLLRDAIVDAWDGSDEHGRALLVVIQGLKD
FT                   LQAKADDG"
FT   gene            327550..328524
FT                   /locus_tag="Bcen_3251"
FT   CDS_pept        327550..328524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV95"
FT                   /protein_id="ABF78146.1"
FT                   /translation="MHYTYTVTAVEWACCQQRGCIPRKLMTLKHLPPTFCWTKIGTESG
FT                   EELPTVVLRKEWERRLGGGRFLWGINQPLGSSAQVAAHRTGSLLALFSPVASRPRAGAR
FT                   KDALLWNAWVDASGQVRPLPPHTFIASRSTLPSGRRREQHYALVCASSTALTVGTQLRV
FT                   FPDHLRSVSTGKPLGAAQGAAVVDCIGRAKEQTGKSYPLALSVELEAPYFVRLAQPCVL
FT                   KARDLAEVNKATRAGDFDRFVELVARLRGRSPTDAVRGVTRDLFDVPPLETAAAYVAPT
FT                   HVARLRNRPAAEHPRDLTGDLFDLSPGEAAAFAGLAHPRVGRA"
FT   gene            328732..328962
FT                   /locus_tag="Bcen_3252"
FT   CDS_pept        328732..328962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU01"
FT                   /protein_id="ABF78147.1"
FT                   /translation="MSTHICSPEAQAAQRFVEATRNVDQAFRAVRGESDDDGSSAEYAR
FT                   AMSRLDRALDELARAQEFFDRVVGADTTHGN"
FT   gene            complement(329124..330011)
FT                   /locus_tag="Bcen_3253"
FT   CDS_pept        complement(329124..330011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3253"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: bur:Bcep18194_B0523
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78148"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVB1"
FT                   /protein_id="ABF78148.1"
FT                   /translation="MQGSMRLARTFWLLLLLAVTSPAFAFHARVVAIPSAAMSETLKAT
FT                   IVLPDDYARDNHGERYPVVYLLHGSGGDHTDWTSNTHIAALADRYHVILVMPDGGHESW
FT                   YIDSPFDSGSRYETFVGDEVVSYVDLHFRTIATQHARAITGLSMGGFGALRIALDRPET
FT                   FGAVGSISGAVDPRCCTDEPGIAHVFGDPDRHPSFWNRNVIAESARAFVRAHLDLTIDC
FT                   GRDDAFVDSNRTLHERLVALGVPHDYAERPGGHTWDYWANAIRYQMRFFATSFQHRGYA
FT                   SRAAPSAPGMTRAG"
FT   sig_peptide     complement(329934..330011)
FT                   /locus_tag="Bcen_3253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.921 at
FT                   residue 26"
FT   gene            complement(330108..330848)
FT                   /locus_tag="Bcen_3254"
FT   CDS_pept        complement(330108..330848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3254"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bur:Bcep18194_B0524 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78149"
FT                   /db_xref="GOA:A0A0H2XT80"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT80"
FT                   /protein_id="ABF78149.1"
FT                   /translation="MIQPTPVVFIHGFIGTFDVRGWNGPHLRPDLLGYGVHRAAPPDTI
FT                   SLAAQVEHVRQTVEMHFGMQPVDVVGHSVGGAIAMLFAHAHPERVRRIVNVEGNFTLDD
FT                   AFWSASVGRMTPGEADTMLDGLRAAPLDWLRGAIDAPSPGQLDDARRWLAHQPASTLRA
FT                   MGRSVVDTTGDAGYLPALAQVFDRHRVWLIAGERSRAGWHVPAFALARCAGFDTIAGCG
FT                   HLIAAERPDALRATLERIVGEPSA"
FT   gene            complement(330845..331651)
FT                   /locus_tag="Bcen_3255"
FT   CDS_pept        complement(330845..331651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78150"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUH6"
FT                   /protein_id="ABF78150.1"
FT                   /translation="MHSRFDRFRSTPLGAQLEALIEQPERYLEFAALSRVGVAAIGAIQ
FT                   DEIAHKFPEIETDTTARQFCGAMVADVMRRRGHEVVQARGRLGGALFSYGAVFSACPHR
FT                   LPFADVVAALARMPARLAAYAAHVPAALATRRPAGTGFSLVEHACHLRDLDAVFAARID
FT                   AVRRAELPVIESVDGTALAAQRDYLAQPLDLAVAAFVSGRAALCATAAALEPAQLARCG
FT                   LRDGIRRMSLDELVRELLDHDRTHGLELDELLAELELPPLPSAHAA"
FT   gene            complement(331747..332178)
FT                   /locus_tag="Bcen_3256"
FT   CDS_pept        complement(331747..332178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3256"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: DGPFAETKE; KEGG: bur:Bcep18194_B0528
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78151"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV99"
FT                   /protein_id="ABF78151.1"
FT                   /translation="MRVMVIVKATADSESGQMPDTELMAEMGRFNEELVKAGILLAADG
FT                   LRPSSHGKRVHFSGKNRSVIDGPFAETKELVAGYWLWQVKSMEEAVEWVKRCPNPMPGD
FT                   SDIEIRPLFEMEDFGDAFTPELREQEARMRAEVDARQQR"
FT   gene            complement(332338..334107)
FT                   /locus_tag="Bcen_3257"
FT   CDS_pept        complement(332338..334107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3257"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS; PFAM: response regulator receiver;
FT                   KEGG: bps:BPSS1940 putative sensor kinase/response
FT                   regulator fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78152"
FT                   /db_xref="GOA:A0A0H2XU05"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU05"
FT                   /protein_id="ABF78152.1"
FT                   /translation="MHVELFAQHHACPGWQGDMARRITAFDWSATGLGPLDGWSASLVA
FT                   AVRTVLASPLPLVMLWGRPGYMIYNDAYAGFAGGRHPYLLGQPVELGWPEVADFNRNVM
FT                   NTCLAGGTLSYRDKALVLLRSGRPEDVWMDLHYSPLPDDEGAPGGVLAVVVETTERVLA
FT                   TRHRDRAEAALQASNAELRELTETLEQRVTDAIAERAAIEEQLRHAQKMEAIGNLTGGI
FT                   AHDFNNVLQVISGNLQILSVELGAHASAQPRIENANNAVRRGAQLASHLLAFARRQPLA
FT                   PTTLNPCRLIDGMNEMLHRALGETVRIVSALAPDVGNVLADRHQLENALLNLAINARDA
FT                   MRGGGTLTIAAYNSTQPGHAAGTRGTTMPPGEYVTFEIADTGIGMTADVLERVFEPFFT
FT                   TKPDGEGTGLGLSMVFGFVKQSGGHVSIDSTPGQGTTVRLTFPRCHEAADEPARTPQHD
FT                   AVRGRETILVVEDDADVRLTVVDMLAQLGYKVITASDGEAALRVLDSETPIDLLFTDVI
FT                   MPGRVKGGELGRRAALRKPPLPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAAR
FT                   IRSVLDAQQADAA"
FT   gene            334263..334493
FT                   /locus_tag="Bcen_3258"
FT   CDS_pept        334263..334493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVB6"
FT                   /protein_id="ABF78153.1"
FT                   /translation="MAAKEVSKKKYLKILNKRLRAEPAAPAGASFVFFPLGAKAKHATG
FT                   VVSGDARSKRELAVMAAVQRKAAEEFVVADA"
FT   sig_peptide     334263..334385
FT                   /locus_tag="Bcen_3258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.843 at
FT                   residue 41"
FT   gene            complement(334684..336108)
FT                   /locus_tag="Bcen_3259"
FT   CDS_pept        complement(334684..336108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3259"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; KEGG:
FT                   bur:Bcep18194_B0539 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78154"
FT                   /db_xref="GOA:A0A0H2XT84"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT84"
FT                   /protein_id="ABF78154.1"
FT                   /translation="MPAATAPASAAARLERLPFSGYHKRIFFIIAIAFFFDSVDLGTMT
FT                   FVLGSIRKEFGLSTAAAGLVASASFFGMVLGAAVAGLLADRFGRRPVFQWSMVLWGAAS
FT                   YLCSTAQSVDALIVYRVLLGIGMGMEFPVAQTLPSEFVPTEKRGRLIALMDGFWPLGFI
FT                   TAGIVAYFVLPQFGWRTVFALLAIPAVFVLVVRRIVPESPRWLEHAGRHAEADTVMHAI
FT                   EAKVMRSAGVTTLPPPSRLAEPAAARGRGALREIWSGVYRRRTVMVWLLWFFALLGFYG
FT                   LTSWLGALLQQAGFEVTKSVFYTVLISLGGVPGFLCAAWLVERWGRKPTCIASLIGGGA
FT                   MAYAYGQSALYGGSTTLLIVTGLAMQFFLFGMWAALYTYTPELYGTGARATGSGFASAI
FT                   GRIGSLIGPYVVGVVLPVFGQGGVFTLGALSFIAAAVAVWTLGIETKGLALEQLAAGDD
FT                   AGGSGRYPAAAADEAS"
FT   gene            complement(336270..337031)
FT                   /locus_tag="Bcen_3260"
FT   CDS_pept        complement(336270..337031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3260"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   bur:Bcep18194_B0540 ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78155"
FT                   /db_xref="GOA:A0A0H2XUI0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUI0"
FT                   /protein_id="ABF78155.1"
FT                   /translation="MNWQGIRAIYRAEMARTRRTLMQSIIAPVISTSLYFVVFGSAIGS
FT                   RISDVNGIGYGSFIVPGLVMLSLLSQSISNASFGIYFPRFTGTIYEILSAPVSYWEIVI
FT                   AYVGAAASKSILLGVIILATAGLFVPLHILHPFWMVLFLVLTAVTFSLFGFVIGIWADS
FT                   FEKLQLVPLLIITPLTFLGGSFYSVDMLPPAWRVVTLFNPIVYLISGFRWSFYGIADVH
FT                   VWISLAATALFLVILLAIVAWMFRTGYKLKN"
FT   gene            complement(337028..337981)
FT                   /locus_tag="Bcen_3261"
FT   CDS_pept        complement(337028..337981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3261"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0541 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78156"
FT                   /db_xref="GOA:A0A0H2XVA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVA4"
FT                   /protein_id="ABF78156.1"
FT                   /translation="MQPILSVSDLSKTYASGFQALKHVTLDIRPGEIFALLGPNGAGKT
FT                   TLIGSICGIVTPTEGRVTVGGHDIRDQYRAAREMIGLVPQELTTDAFETVWATVSFSRG
FT                   LFGKAPDPAYIEKTLKALSLWDKRDNKLMTLSGGGMKRRVMIAKALSHEPRILFLDEPT
FT                   AGVDVELRRDMWKLVDSLRESGVTILLTTHYIEEAEEMADRIGIILGGELVLVEEKREL
FT                   MRKLGKKQLTVQLEHPLADMPPALAPFGLERTEDGAALVYTYDSQRDDASIAKLINALG
FT                   SAGIGFRDLHTTQSSLEDIFVSLIDNRRNGVQGAGA"
FT   gene            338406..338702
FT                   /locus_tag="Bcen_3262"
FT   CDS_pept        338406..338702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3262"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG:
FT                   bur:Bcep18194_B0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78157"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU09"
FT                   /protein_id="ABF78157.1"
FT                   /translation="MSLIDFKSVADAQAAAWKSTIVGEVGPARIKVLRMDAQPYEAEVH
FT                   DYNEGLLVLDGTLMLEVDAETVVVGAGQMFLAHAGTRHAVLPGSHGTLAIIDV"
FT   gene            339319..340917
FT                   /locus_tag="Bcen_3263"
FT   CDS_pept        339319..340917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78158"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC1"
FT                   /protein_id="ABF78158.1"
FT                   /translation="MICIPEWRKAILSCAVLALPFVAGCGGGDDPGPITVPQCSGSACG
FT                   PSGAETTPPVVTKLCPDALDYTTTYTGGAGSGEYVKVKFDTTKLTYQMQFIESSVPTSA
FT                   GQVNNTRAGLTISGAFHHPTTLPTAEQNRCAFVLDSGATSDGAYSVTINRADPPMLFVG
FT                   NGVVGGGIPGATIAFAGIPLLPGITLGVVPSRTFDFYPFIGFTDTETDFTKVAGNYNEV
FT                   GIHLSPIGGDGQSPTGAVGWESDVVNWNQTLNADGSCSITQGSDYSCQTTGTPWAQRKN
FT                   ADGSADNVFVSNPAGGQGYPIAGQGSTLIIAPSQAKGIMIVGRLNGVLVPIVIRVGYTH
FT                   VDTVNLLASVADAEVGISMLSSTKAIAANSLKGGYIGATSASACGIVTSSGQGNKLASA
FT                   GPSFNPNVPHPDLPGIFANNAFYSVAGSCNDGTAVSTLAANYTSTLFQGSTAAFIDPQT
FT                   SSVTSQFALDYTQATPGKIRVTAAQDFNAKGANGNAAIFGKGDTGWLVTAGNVYAMVVN
FT                   DNKVNPFFTIGAFVQ"
FT   sig_peptide     339319..339402
FT                   /locus_tag="Bcen_3263"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.753) with cleavage site probability 0.334 at
FT                   residue 28"
FT   gene            340989..342242
FT                   /locus_tag="Bcen_3264"
FT   CDS_pept        340989..342242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78159"
FT                   /db_xref="InterPro:IPR021340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT87"
FT                   /protein_id="ABF78159.1"
FT                   /translation="MNLKQWMAAASLAPVLAACGGDGDPPPAPVVRLCPQTIDYNTVFI
FT                   GGSGSGELVKVQLDTTKMTYRMTYLASPVPATTGTVQPTRDTAPANVVDGTLADETGLP
FT                   TVKLNQCTFRMQNASLDPSRPARLFLGEGVLGGAIPGATIQFDGVIGVGKITKTTFPYY
FT                   PFISFSSLETDLTKIAGTYNQLGYHQVPSQNFQPVALDQQVTINADGSYTETDNFGKKN
FT                   GGQPLASSATVNQPFTLRPDAPAFQSLNYLPQIPPTLAALDPAKAGKGILIVGRLRNQL
FT                   VPVFIRTGAANADLTQGPPSADDESGISFLSPRTAVAQGSQDGEYTGVDSAFNYRATAL
FT                   VGAQATLLDPFNASQAALTRALNLDYTQKVPGVVTTVHADAASGPATGKFVFTGGVFGF
FT                   LDMADTSNPYFTVGAFVQ"
FT   sig_peptide     340989..341051
FT                   /locus_tag="Bcen_3264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.695 at
FT                   residue 21"
FT   gene            342316..343140
FT                   /locus_tag="Bcen_3265"
FT   CDS_pept        342316..343140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3265"
FT                   /product="OmpW"
FT                   /note="PFAM: OmpW; KEGG: bur:Bcep18194_B0546 OmpW family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78160"
FT                   /db_xref="GOA:A0A0H2XUI5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUI5"
FT                   /protein_id="ABF78160.1"
FT                   /translation="MKKLIVAGVVAGVSTLASAQQAGDNVATLGWLHIMPQDSTNGLTT
FT                   NLASMPINGPLRLPGSFTSPGTSLTVNNADTVGLTLTHFFTDHIAVTSVLGVPPEFTLT
FT                   GHGVIRPPGPAGALGNVDMDKSANQPAVKNARQWSPTIILQYYFNSSTAKFRPFVGIGV
FT                   AYSWFSNIELNGNFAKDINENLGSVLAAGAGKPGATSVEGKASSSFTPVYNIGASYAID
FT                   KHWGLTATLTYMPLKTYSSLVIKAADGSTLATTRTRLKADPLITFVGISYKF"
FT   sig_peptide     342316..342375
FT                   /locus_tag="Bcen_3265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.757 at
FT                   residue 20"
FT   gene            343262..343765
FT                   /locus_tag="Bcen_3266"
FT   CDS_pept        343262..343765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVA9"
FT                   /protein_id="ABF78161.1"
FT                   /translation="MSIRKIVSLVAAVAFTAVSAAPAFAVTVSRADGQPMNPNGEPFSA
FT                   TGLTNLSKGSINASCTATFNGTITSTGIVNITSTTFAGGATCGLISGSASSTSPWTGQA
FT                   DSTTQLSINNVKVNVTLLGTCGPSKVVTAWSDANSSLAFNNSVLTPDCTVTGTVLTSPK
FT                   FHVQ"
FT   sig_peptide     343262..343339
FT                   /locus_tag="Bcen_3266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            344174..345274
FT                   /locus_tag="Bcen_3267"
FT   CDS_pept        344174..345274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU13"
FT                   /protein_id="ABF78162.1"
FT                   /translation="MLTDPAKYGDARGATPDRLRTAAWLQYLIDHLDTAVCAMAATDVG
FT                   DTPVVASYAIRAGTGAHLSREATAVLHRLVPWIATDGGGCACDPADPLGACAHVPSAQQ
FT                   LADAERCCPGSLAVFDTAHGVIDACAFDDPDVGWAALERIADGVECHGEVANEPDGQRE
FT                   TPPAKNLRDRLTAVAAMSTETPVRPGAVIDAIVLRVCGPRDDATRVDEMAALAMFSAEL
FT                   AAGNGVSVHAYGGRHNFVAQAIRTHRADLASMEGLLAALAVCRLDRLIGAGSFWAHYLL
FT                   AGIAIAAPDTVRAIGRRFHGDTWQTWLDHVLAWPAVSRFGAKEDVAFDRLRDAMSLTSR
FT                   RNPIVRAKRMRGVSAAGPRSANEKAR"
FT   gene            complement(345347..347047)
FT                   /locus_tag="Bcen_3268"
FT   CDS_pept        complement(345347..347047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3268"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="TIGRFAM: choline dehydrogenase; PFAM:
FT                   glucose-methanol-choline oxidoreductase; KEGG:
FT                   bur:Bcep18194_B0553 choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78163"
FT                   /db_xref="GOA:Q1BQE2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQE2"
FT                   /protein_id="ABF78163.1"
FT                   /translation="MTTREYDYIICGAGSAGNVLATRLTEDPDVTVLLLEAGGPDYRFD
FT                   FRTQMPAALAYPLQGRRYNWAYETDPEPHMDNRRMECGRGKGLGGSSLINGMCYIRGNA
FT                   LDYDNWSTHKGLENWTYLDCLPYFKKAETRDVGPNDYHGGSGPVSVTTSKPGVNPLFEA
FT                   MVDAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPKGRRASTARGYLDQAKVRPNLEIVTH
FT                   ALADRILFDGKRASGVTYLRGSERATAHARREVLVCSGAIASPQLLQRSGVGPGAWLKE
FT                   LDIPVVLDLPGVGQNLQDHLEMYIQYECKEPVSLYPALKWWNQPKIGLEWMLNGTGLGA
FT                   SNHFEAGGFIRTRDDDPWPNIQYHFLPVAINYNGSNAIEMHGFQAHVGSMRSPSRGRVK
FT                   LRSRDPNDHPSILFNYMAEALDWREFRDAIRATREIMRQPALDRYRGRELNPGADCKSD
FT                   KELDAFVRARAETAFHPSCSCKMGYDDMAVVDEEGRVHGLDGLRVVDASIMPIITTGNL
FT                   NAPTIMIAEKIADKIRGRTPLARVDVPYFVANGAPARNVAKAVRQPETV"
FT   gene            complement(347064..348533)
FT                   /locus_tag="Bcen_3269"
FT   CDS_pept        complement(347064..348533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3269"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: bur:Bcep18194_B0554 betaine
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78164"
FT                   /db_xref="GOA:Q1BQE1"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQE1"
FT                   /protein_id="ABF78164.1"
FT                   /translation="MSVYGLQRLYIGGGYVDATSGKTFDTFDPATGELLAQVQQASAAD
FT                   VDRAVASAQEGQREWAAMTAMQRSRILRRAVELLRERNDELAAIETRDTGKPIGETLAV
FT                   DIVTGADVIEYYAGLATAIEGLQVPLRAESFVYTRREPLGVCAGIGAWNYPIQIACWKT
FT                   APALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGSVGALLTGHPDIA
FT                   KVSFTGGVETGKKVMSLAGASSLKEVTMELGGKSPLIVFDDADLDRAADIAVTANFFSS
FT                   GQVCTNGTRVFVHRSIKDAFTQKVLERVKRIRVGKPTDADTNFGPLVSAAQLDKVLGFI
FT                   ESGKAEGAKLLAGGTRLTDGHFGSGQYVAPTVFGDCRDDMKIVREEIFGPVMSILEFES
FT                   EDEVIARANDTHYGLAAGVVTENLSRAHRAIHRLEAGICWINTWGESPAEMPVGGYKQS
FT                   GVGRENGITTLEHYTRIKSVQVELGRYNPVF"
FT   gene            complement(348566..349150)
FT                   /locus_tag="Bcen_3270"
FT   CDS_pept        complement(348566..349150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3270"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_B0555 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78165"
FT                   /db_xref="GOA:Q1BQE0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQE0"
FT                   /protein_id="ABF78165.1"
FT                   /translation="MPKVGMREIRRAQLIDATLRSIDEAGLPGTTLASVAQRANISTGI
FT                   VSHYFGDKDGLLEATMRHVLRDLWSATTRRRVAARKDPRSRLRAVVAANFDDTQVSAPV
FT                   MKTWLAFWSQSMHDPMLKRLQHVNTRRLHSNLCAEFAKALPLAKAREAASGLAALIDGL
FT                   WLRGALAGGPIDTRAALKLAHDYIDLLLASD"
FT   gene            349875..350777
FT                   /locus_tag="Bcen_3271"
FT   CDS_pept        349875..350777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3271"
FT                   /product="alpha/beta hydrolase"
FT                   /note="KEGG: bur:Bcep18194_B0556 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78166"
FT                   /db_xref="GOA:A0A0H2XVC4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC4"
FT                   /protein_id="ABF78166.1"
FT                   /translation="MPTEKHVVPLPNGLKVYVEQNVFDPAFDTAMLVNGALATTASFGQ
FT                   TVQYLGERMNTICFDLPYAGQSRQHNPGCFILTKDDEAAILQYLVEHFAPAYLVSVSWG
FT                   GVASLFALARGCPSVRRAAICSFSPFLNDAMVDYVTRARDHIAAGENLKAAQLLNDTVG
FT                   RYLPRIMKLYNYRYLTRLPRDEQDQVAFHVDQILSLQPERYFSEFANIGCELLFLNGER
FT                   DEYTTPADVRQLGAHVARARFATVPDAGHFLDIEGRAQREYTRAALLDFFCGEAAAAAG
FT                   VARAAAHACVPTPMHALSS"
FT   gene            350845..351414
FT                   /locus_tag="Bcen_3272"
FT   CDS_pept        350845..351414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3272"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: bur:Bcep18194_B0557 isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78167"
FT                   /db_xref="GOA:A0A0H2XT91"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT91"
FT                   /protein_id="ABF78167.1"
FT                   /translation="MNIVQTIAIVVPWAAWLAYWIATSQGVKTTVRKEASRSRTLQSIP
FT                   LIVGGALIILPDPSWQALVPDWQRFGLQAQCGLAVLVAGLLFSVWARLHLGTNWSVSVT
FT                   LKEDHELVRTGPYALVRHPIYTGCLIALVGAALIGGEWRGAIGVLLVFASLAYKVRVEE
FT                   SWLTGYFGPAYAQYRREVAALIPGFY"
FT   gene            351432..352715
FT                   /locus_tag="Bcen_3273"
FT   CDS_pept        351432..352715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3273"
FT                   /product="glycosyl transferase, family 28"
FT                   /note="PFAM: UDP-glucuronosyl/UDP-glucosyltransferase;
FT                   KEGG: bur:Bcep18194_B0558 glycosyl transferase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78168"
FT                   /db_xref="GOA:A0A0H2XUJ0"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUJ0"
FT                   /protein_id="ABF78168.1"
FT                   /translation="MAKMIVTAIGSAGDVHPLLGVARTLAARGHDVVFCTHAPFEATVR
FT                   RCGFAFVPVGTAAEYDAAMANPALWNPRTSFRTLWQVIAPTLRPHYDALRALTDADTVL
FT                   VGTLWAFSARFMQELHGTPYVSVQVSPSTLLSAHAPPTHPRLTIPARWPLPVKSALMTL
FT                   IERQVLDRVCGPALDAVRRELGLAPARRVLGRWLHSTDGVLCLFPGWFAPPQPDWPSNH
FT                   LQSGFPLFNDIATPDDDGVLDAFLAAGEAPVVFTAGSTLVDHAAYARAVADALRATGAR
FT                   GILLTPHDAVQGDDRLLVRRFVPMRTLLPRCRALVHHGGIGTAALACEAGIVQVVTPFA
FT                   HDQFDNAQRVVANGCGVRVDGPLDGARLGAALARVLDEPAFAVHAERTRALLAAAPDGC
FT                   GAAADFIERFVPRRGRAAARADVAVAGA"
FT   gene            352712..354307
FT                   /locus_tag="Bcen_3274"
FT   CDS_pept        352712..354307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3274"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /note="TIGRFAM: Drug resistance transporter EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0559 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78169"
FT                   /db_xref="GOA:A0A0H2XVB3"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVB3"
FT                   /protein_id="ABF78169.1"
FT                   /translation="MSTASPLHDESGAPSAFDVPAPAPAAQPVRGIRLALLTFALSLAT
FT                   FIEVLDSTVTNVAVPAISGSLGVSNSQGTWVISSYSVAAAIAVPLTGWLARRVGELRLF
FT                   VGAVLLFTLTSLLCGLARDLHVLVICRALQGLCSGPMVPLSQTILLRTFPPDKRTIALA
FT                   LWAMTVLLAPIFGPVVGGWIVDNFSWPWIFLINLPIGLFSFAVCTAMLRPDAQRGAAGP
FT                   IDVPGIVLLVIGVGSLQAMLDLGHDRGWFDSPLIVTLAVVAALAIVSLLIWEAGEAHPV
FT                   VDLSLFRDRTFSFCVLIISLGMMSFSVVGVVFPLWMQAVMGYNAFHAGLATASLGVLAL
FT                   VFSILVGLHAHRFDARVLATFGFLVFAAVLAWDAQFTLKMTFAQIAAPGLIQGIGLPCF
FT                   FIPLTAATLSRIPDDRLAAASSLSNFLRTLSAAFGTAMSVTLWDNRATYHYDVVSQSVT
FT                   HASANTQRFVHALNAMGVDGVRELTTLHHVVMQQAYMMATNDMFWMASMTCLALAAMMW
FT                   LTRPKRGAAASFGH"
FT   gene            354318..355256
FT                   /locus_tag="Bcen_3275"
FT   CDS_pept        354318..355256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3275"
FT                   /product="Rhamnosyltransferase"
FT                   /note="TIGRFAM: Rhamnosyltransferase; KEGG:
FT                   bur:Bcep18194_B0560 rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78170"
FT                   /db_xref="GOA:A0A0H2XU18"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR006446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU18"
FT                   /protein_id="ABF78170.1"
FT                   /translation="MTTLGALVILYHPSDAQLDALRAWRHACDALLVVDNTPQPDARAR
FT                   ELCACEGIALLHHGNRGGIAGAYNAGLTALFRDGLDAVALFDQDSSVPAAYFPAMRDVC
FT                   AGLARRAFLAGPRIFDENARSFLPELATNGIGLRRLRIEPGTPMQRCAFLISSGCVVSR
FT                   DAFDVLGRFDETLFIDHVDTEYSFRALARNVPLYVVPSLVLPHRIGAKHRHAIGPFEMT
FT                   SMNHSWQRRYYSARNAVQLGMQYGLRFPVALVPNLLTVWQVVQIALVERDKRAKLAGIL
FT                   FGVADGLFGRLGPLERTRPRLAARARRVRQG"
FT   gene            355268..357118
FT                   /locus_tag="Bcen_3276"
FT   CDS_pept        355268..357118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3276"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT; PFAM: outer membrane efflux protein;
FT                   KEGG: bur:Bcep18194_B0561 RND efflux system, outer membrane
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78171"
FT                   /db_xref="GOA:A0A0H2XVC8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC8"
FT                   /protein_id="ABF78171.1"
FT                   /translation="MIQAAGSARGVKGGSMIAAAAALLALAGCVPSGFLPSLSLRAPAD
FT                   DALAHTAGPGANGAWPAPDWVKQLQDPQLDDLVAEASQHNPDLQVAQARLRIAQAQLQQ
FT                   FDSLTGLTGTAGATISRARMPKPGDIADVTAGGYRVPVQIFGDPNVSPSSVFVGLNYQL
FT                   DLWGKNRAATKSLMSLRDAAGVEAEQVRLTLAVAIVTVYCQLDQAYAVRDLLQQKLKIS
FT                   QRVTAVLRERTARGLDNAYDASDASIKRSRLLEQIALNDEQIKLAQLQLGVLSGRGPER
FT                   GLALQRPRVGAFAGGAVPARLPADLLGRRPDIVAARLRVEAAFANADSTRAQFYPDVNL
FT                   VALGGVFALTPASLFSRDSLAGSVGPAISLPIFDRGRLKAKLGADVAQADVAIGLYNKT
FT                   VDDALGQVAQLVTSLQTSQTLVAQQQDAVAAAQKIVQIAADRHRRGVLMQKDVDVADLT
FT                   LIDERAQMIALLGKQRTLRVGLIGALGGGFDAGATVAQAQTPAGPRARSGAAKRGAATA
FT                   VAAVGAVAANRETAGQSNDARAGSTAVSPAATATSNASASARRDDTTRPSTIGATRPDA
FT                   APRGNPVLARTASASPTRDSSPMPAIPVFQHDRLIVTQSD"
FT   gene            357118..358308
FT                   /locus_tag="Bcen_3277"
FT   CDS_pept        357118..358308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3277"
FT                   /product="secretion protein HlyD"
FT                   /note="PFAM: secretion protein HlyD; KEGG:
FT                   bur:Bcep18194_B0562 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78172"
FT                   /db_xref="GOA:A0A0H2XT95"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT95"
FT                   /protein_id="ABF78172.1"
FT                   /translation="MHHDNLHSAAPPAALNDPALDARRATRRKRFTVFFAIVLLAAIAW
FT                   IAYWLLSDRYYEDTDDAYVAGSIVQVAAQIPGAVTDVVVADTQAVRAGQTLVRLDDTEA
FT                   SVAFAQAKAQLAQAVRQVANARISNTMYVEAVNARRADLSLAQRALAARSGASVEIVAP
FT                   EELARARAAVAGAQANLAAAQAQLDAARALGSKLPVDESPAVVQAAAQFKLAYRNLKRT
FT                   TIVAPVDGTIGQRSVQVGQQVGPGVPLMSIVQLNRLWVEANFKEGQIRHMRVGQPVEVV
FT                   SDLYGSRIAYRGRVQGFSAGTGSAFSMLPSQNAAGNWIKVVQRVPVVIALDPRDLAAHP
FT                   LRVGLSMRATVDTHDRNGHALDSEPPTPAVSTRVHDGVASDAEAAAAAIIRENQGG"
FT   gene            358537..359733
FT                   /locus_tag="Bcen_3278"
FT   CDS_pept        358537..359733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3278"
FT                   /product="glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding; KEGG:
FT                   bur:Bcep18194_B0564 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78173"
FT                   /db_xref="GOA:A0A0H2XUJ5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUJ5"
FT                   /protein_id="ABF78173.1"
FT                   /translation="MSSNRGVVYLGPGQVEVQKIDYPKMVDPSGRAIGHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAPVGLVLGHEITGEVVEVGRDVETLKLGDLVSVPFNVACGRCAMC
FT                   KDTHTGVCLNVNPSRAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIR
FT                   DLTCLSDILPTGYHGAVSAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAE
FT                   RLAHARAMGFETVDLSKDASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPA
FT                   TVLNSLMEITRPAGAIGIPGLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTP
FT                   VLKYNRNLMQAILFDRLPIAKIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA"
FT   gene            complement(359819..360577)
FT                   /locus_tag="Bcen_3279"
FT   CDS_pept        complement(359819..360577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVB7"
FT                   /protein_id="ABF78174.1"
FT                   /translation="MRVLPNRSVRARDAWRSVLNARAESRHATCCRCRECGFVAFRALE
FT                   HCPVCGRWNWPFEPIRHTPADARAVHAPRSFHTWSSRVARALRNAAFQRPRASSAPLLS
FT                   ILTLVLLVGGYVMVDQTCKADPVCRGSAAPAAVATETMLQASNDPLLPVVPAPVYPFHS
FT                   PDQTQVAANPQQSAPLAGKPARPMAVVQAAPSLRPDRTRAGAVRVADWKGNRDTAHRPT
FT                   RAIRRVSLHTGRTRRTAASNAELAKLYRGH"
FT   gene            complement(360781..362217)
FT                   /locus_tag="Bcen_3280"
FT   CDS_pept        complement(360781..362217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3280"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0568 transcriptional regulator, GntR family
FT                   with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78175"
FT                   /db_xref="GOA:A0A0H2XU22"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU22"
FT                   /protein_id="ABF78175.1"
FT                   /translation="MKRYAVLAQTIADAIRRGDLAAGARIPTVRAACRAYRVSPSTVFR
FT                   AYYALESEGLIVARARSGYFVANVADKHVRFGRDSPRKPGAAQNDAARTGDDDALFRLL
FT                   DSLKCDDIVPLGSAFASYSLFPMSSLWRQVASAARHMDRTKLLEGLPPGNEALRRQIAL
FT                   RYLNAGASLPLEEIVITTGATEALTLSLQALTRPGDIVAIERPAFHAVLQAVQCLHLKA
FT                   VEIPVDPRTGLDLDALAEALDTHPVRACWFMTSFHNPTGATLTDERKRALIDLLASRGV
FT                   PLIEDDVYGELQFGTAPTRPAKLYDDSGLVLHCGSFSKCLAPGFRIGWVAAGRFVRQIR
FT                   EAKGTSTPAADVPAQMAIASYLRDGAYDRFLRKLRRNLAAHQAQMLSAVRAYFPTDTEV
FT                   FAPRGGYFLWIELPPHLDAMHLFDDAMESGVSIAPGPIFSATGGFRRYLRLNYGRPWTP
FT                   AVERALETLGTLAARQRHGG"
FT   gene            362430..363893
FT                   /locus_tag="Bcen_3281"
FT   CDS_pept        362430..363893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3281"
FT                   /product="coagulation factor 5/8 type-like protein"
FT                   /note="PFAM: coagulation factor 5/8 type-like; KEGG:
FT                   bur:Bcep18194_B0569 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78176"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVD3"
FT                   /protein_id="ABF78176.1"
FT                   /translation="MSRESFFAASLPYPKVSSVKLQTLVAGLVAGIALNLFSGVAAAAC
FT                   VNNPAAQPNATFPAALTGKLVYHSYVKYGDGTSQLFLYDFSAHTLTQLSKSAWGITDPM
FT                   NGVFSPDGKWLAFMGISNGAWNVFMLQLGAGTPPVNMTNSTGATRNEDPKFSTDGKTLV
FT                   FKQNGDVKQATLSYTSAGPVFTSVVSLTNAPAGAEYSMPFLAPDASAVYYATGTGSNMG
FT                   LMKRTIATGATAVFDRPAGLQTYYPTVRADGMVYYARWKDSGGADQIYAKTADPASTPS
FT                   ALALNDCMSNNSDPAPVSGTNYLFFSSTTAGGYQLYVGDVTTGQRWSLSQFGVNADATK
FT                   AKLGANYYGGAAAARTLLSQGRPAAASASYNASLTADKAFDGNTASTRWDSPEGAGVDP
FT                   QWISVDLGATKTVSSIDLYWDAGALVYQIQTSNDNVNWTTIYSTSNGVSYSHVTLPNLN
FT                   GHGRYVRMLGTKRATQWGYSLYEMQVWGS"
FT   sig_peptide     362430..362561
FT                   /locus_tag="Bcen_3281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.893) with cleavage site probability 0.641 at
FT                   residue 44"
FT   gene            complement(363949..365064)
FT                   /locus_tag="Bcen_3282"
FT   CDS_pept        complement(363949..365064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3282"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0570 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78177"
FT                   /db_xref="GOA:A0A0H2XT99"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XT99"
FT                   /protein_id="ABF78177.1"
FT                   /translation="MARLLHSLTQYRSPIRAPGQKLLEIQGTLPMSPDRTASLSHFAFM
FT                   PLPNFTMIAFTNAIEVLRMANYLSGQPLYRWSVISPDGGPVTASNGLTVDTGPAECAGQ
FT                   PDIVFVCGGVDVQRATTPAHLSTLRRFARSGIPLGSLCTGTYALAKSGLLAGYACAIHW
FT                   ENMSALKEEFPDTRFLKELFVIDRDRITCTGGVAPLDMMLNLIAARVGTARVTQIAEQF
FT                   IVEHVRDTSAQQRMPLVARLGSANKSLFEVISLMENNIEEPLSREELARLANMSQRQLQ
FT                   RLFREHLGMTPTHYYLTLRLRRARELLLQTDMSIMHITMACGFQSACHFSKSYRDAFGV
FT                   APTRERRKQVAPLAQGAVSAAPAFPARVLHA"
FT   gene            365351..366694
FT                   /locus_tag="Bcen_3283"
FT   CDS_pept        365351..366694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3283"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   bur:Bcep18194_B0571 glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78178"
FT                   /db_xref="GOA:A0A0H2XUK0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK0"
FT                   /protein_id="ABF78178.1"
FT                   /translation="MGNPGTAGLELRLQPFILRHGRTMSNTQPFFSQPLAERDAPVRSA
FT                   ILKELERQQSQVELIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCEFADEVEAL
FT                   AIDRVKQIFNAGYANVQPHSGAQANGSVMLALAKPGDTVLGMSLDAGGHLTHGAKPALS
FT                   GKWFNAVQYGVNRDTLRIDYDQVEALAHEHKPNLIIAGFSAYPRALDFARFRAIADSVG
FT                   AKLMVDMAHIAGVIAVGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEDIAKKINSA
FT                   VFPGLQGGPLMHVIAGKAVAFGEVLHADFKTYIDNVLANAQALGEVLKAGGVDLVTGGT
FT                   DNHLLLVDLRPKGLKGAPVEQALERAGITCNKNGIPFDTEKPTVTSGIRLGTPAGTTRG
FT                   FGVAEFREVGRLILEVFDALRANPEGDPATEQRVRREIFALCERFPIY"
FT   gene            366733..367704
FT                   /locus_tag="Bcen_3284"
FT   CDS_pept        366733..367704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3284"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   bur:Bcep18194_B0572 membrane dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78179"
FT                   /db_xref="GOA:A0A0H2XVC2"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC2"
FT                   /protein_id="ABF78179.1"
FT                   /translation="MSTLHQDSIIIDGLNISKFEKPVFEDMRKGGITAANCTVSVWENF
FT                   TKTVDNIGVMKKKIRDNGELLTLVRTTDDIFRAKKEGKTGIILGFQNAHAFEDNLGYIE
FT                   AFADMGVRVVQLCYNTQNLVGTGCYERDGGLSDFGREVITEMNRVGIMVDLSHVGGNTS
FT                   SEAIAFSKKPVCYSHCLPSGLKEHPRNKSDAQLKEIADAGGFVGVTMFAPFLKRGIEAN
FT                   IDDYIEAIDYVVNLIGEDAVGIGTDFTQDFAKEFFDMLTHDKGRYRQLTNFGKVINPDG
FT                   IRTIGEFPNLTAAMERHGWSESRIRKIMGENWVRVFKDVWGA"
FT   gene            367843..368376
FT                   /locus_tag="Bcen_3285"
FT   CDS_pept        367843..368376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3285"
FT                   /product="4-vinyl reductase, 4VR"
FT                   /note="PFAM: 4-vinyl reductase, 4VR; KEGG:
FT                   bur:Bcep18194_B0573 4-vinyl reductase, 4VR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78180"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU26"
FT                   /protein_id="ABF78180.1"
FT                   /translation="MQPQLPINVDPDTGVWTTDALPMLYVPRHFFTNNHVAVEEALGVE
FT                   AYAEILYKAGYKSAYHWCDKEAKQHGITGVAVFEHYLKRLSQRGWGLFSIIEADPASAR
FT                   AKIELRHSSFVLQQPGKEGKLCYMFAGWFAGAMDWVNDTTPEGKGAPRAYSKEVQCAAE
FT                   HHDHCVFEVSPIAH"
FT   gene            368453..370516
FT                   /locus_tag="Bcen_3286"
FT   CDS_pept        368453..370516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3286"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bur:Bcep18194_B0574 NADH-flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78181"
FT                   /db_xref="GOA:A0A0H2XVD7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVD7"
FT                   /protein_id="ABF78181.1"
FT                   /translation="MRYPHLFKPMQLNQLTLRNRIVSTAHAEVYAEPGGLPGDRYIRYY
FT                   EEKAKGGVGLAICGGSSPVSIDSPQGWWKSVNLSTDKIIDPLTRLADTMHKHGAKIMIQ
FT                   ATHMGRRSSFHGEHWPHLMSPSGVREPVHRGNAKIIEIEEIRRIIGDFAAAAKRVKAAG
FT                   MDGIEISAAHQHLIDQFWSKRSNHRTDEWGGSLENRLRFGIEVLTAVREAVGKDFCVGL
FT                   RMCGDEFHEDGLDHEALKEIAQAMSETGLIDYLSVVGSGGDTHNTIANCMPPMALPPEP
FT                   FVHLAAGIKSVVKIPVMHAQSIRDAGQAERLLANGMIDLVGMTRAQIADPHMVIKIRDG
FT                   REDEIKQCVGANYCIDRQYNGLDVLCIQNAATSREATMPHIIEKSRGPKRKVVVVGAGP
FT                   AGLEAARVAKLRGHDVVLFEKNAEVGGQVMIAAKAPQREQMSGIIRWFDMETKRLGVDR
FT                   RLGVAADEKMIMAEKPDIVVLATGGSSFTWQVPAWGVAEGLAVSAWDILTGTVEPKQNV
FT                   LLFDGVSTHAGAGVADFMASRGSKVEVVTPDVKVADDCGGTTFPIFYRRLYAFGVIPTP
FT                   NTMLDRVYEENGKMIAVLRNEYTEELEERAVDQVVIENGSSPNDELYWKLKPESVNRGQ
FT                   IDPHTLFAAEPQPCLSEELGNGRFLLFRVGDCISMHNVHGAIYDSLRLVKDF"
FT   gene            370520..372445
FT                   /locus_tag="Bcen_3287"
FT   CDS_pept        370520..372445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3287"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding; KEGG:
FT                   bur:Bcep18194_B0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78182"
FT                   /db_xref="GOA:A0A0H2XTA3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTA3"
FT                   /protein_id="ABF78182.1"
FT                   /translation="MNPSFLITALLWLSVAGLAFAVAKRSSYWRLGRATAPGSFGVANL
FT                   FAIPKRYFVDLHHVVARDPYIAKTHVATAGGAIGALALVFVNYGLAIYSPWLDKLIFLA
FT                   ALAMLVGAVFVWRRRAAKDVPARLSRGPWNTLPWLLGSFALGLVLFMLVPTGAMSGAFA
FT                   VLCALLIGVGAFTMTVGAAKGGPMKHAIAGLLHLAFHPRQERFAATRESFTGNGTATPP
FT                   TALKLPDIEHQEYGVAKPVEFRWNQLLSFDACVQCGKCEAACPAFASGQPLNPKKLIQD
FT                   LVVGMAGGSDAAYAGSPSPGIPVGQHRGEPNGPIVSGLIEEQTLWSCTTCRACVQECPM
FT                   LIEHVDAIVDMRRNRTLVHGTVPGKGQEVLANLRETGTMGGYDTAARYDWSVDLSAPVA
FT                   QPGKPVDVLFVAGEGAFDMRYQRTLRAFVKVLNKAGVDYAVLGSTETDTGDVARRLGDE
FT                   ATFQQMAKRLIGTLGTLSYQQIVTADPHVMHSLRNEYRALGLRVTVKHHTTYLAELADS
FT                   GKIAPKAVEALQEKRTTYHDPCYLGRYNGEIEAPRKLLKTIGIQVVEMERNGMRGRCCG
FT                   GGGGAPLTDIPGKQRIPDIRIADARTIGADVVAVACPNCTAMLEGVVGPRPDVLDVAEL
FT                   VAASLE"
FT   sig_peptide     370520..370585
FT                   /locus_tag="Bcen_3287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.944 at
FT                   residue 22"
FT   gene            372450..373619
FT                   /locus_tag="Bcen_3288"
FT   CDS_pept        372450..373619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3288"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein, alpha subunit;
FT                   KEGG: bur:Bcep18194_B0576 electron transfer flavoprotein,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78183"
FT                   /db_xref="GOA:A0A0H2XUK5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK5"
FT                   /protein_id="ABF78183.1"
FT                   /translation="MNTIKRIDPRRPFIITAAGLKRITLGEEGSADANAAQWSAHGHGA
FT                   AAAKPRRALQDPKHVMLVVAHSERGALDDHSRQAIAAAAVLADAQTEVALLAFGELKDD
FT                   VAELGVDKLIELAGFDRRAFDPESELQALQACVAALAPKHVFVPDNATGDGDLGRRYAA
FT                   AAGASVATHVVEIDAKHVGAYAQAGRAFATRALPDVILLAQNAVDAKLPFVGAGERLAA
FT                   DFIRPAHDAAQPYRDLGLDEIDAAQVALEEADFIVSAGNGVSDIGAFERLAGVFGAAIG
FT                   ASRVAVDNGHFTRDKQVGATGKTVEASVYIAFGISGAVQHLQGIKDCRHVIAVNLDGSA
FT                   PIAKRANLTVVGDAQATIAALIEQVQAARAARGESPAAVGTREPEGVAA"
FT   gene            373616..374401
FT                   /locus_tag="Bcen_3289"
FT   CDS_pept        373616..374401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3289"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: bur:Bcep18194_B0577 electron transfer flavoprotein
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78184"
FT                   /db_xref="GOA:A0A0H2XVC7"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC7"
FT                   /protein_id="ABF78184.1"
FT                   /translation="MNAPRPLQRIAVLVSVGRHPVSGVARYSRNDAAALETGRQLAEQH
FT                   RATLDVIHAGDPANSALAEYLALGAREVEVLACRDGDDAVHALAARVEGYDLVLTGTRA
FT                   EGAYDTGMLPYRVAAALGYPLVGSAVDVTVEGGRAAVRQFLPKGLRRRVDAALPAVVAV
FT                   HPLAGVEPRYAYARLRAGAIRPALAAPGADADATAWTVGPVERKPVKLVAAEKRSGHAR
FT                   MLSATTTESRGGNVVNEGSSVEKAQVILAYLREHQLIDY"
FT   gene            374455..375696
FT                   /locus_tag="Bcen_3290"
FT   CDS_pept        374455..375696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3290"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="PFAM: Rieske [2Fe-2S] region; KEGG:
FT                   bur:Bcep18194_B0578 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78185"
FT                   /db_xref="GOA:A0A0H2XU31"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU31"
FT                   /protein_id="ABF78185.1"
FT                   /translation="MKVSADIRALIERRKEGHSLDAPFYTSEDIFALDMEAIFRQHWIQ
FT                   VAIEPDIPEPGDYVTVQLGNDSILIVRDDDMAIRAFHNVCRHRGARLCNEDKGSVGNIV
FT                   CPYHSWTYNLTGQLMFAEHMGEKFDRCKHSLKSVHVENLAGLIFICLADEPPVDFAQMR
FT                   AEMEPYLLPHDLPNTKIAAQIDIIEEGNWKLTMENNRECYHCVANHPELTISLYEYGFG
FT                   YQRSDANAEGMDAFAETCVRRGKEWAEMGLPSAEIEKLLDVTGFRTQRLPLDRHGESQT
FT                   LDAKVASKKLLGGFDKADLGGLSFWTQPNSWHHFMSDHIVTFSVIPLSAGKTLVRTKWL
FT                   VHKDAKEGIDYDVKNLTAVWNATNDQDRALVEFSQRGANSSAYEPGPYSPYTEGLVEKF
FT                   SAWYIGRLAEKTGA"
FT   gene            375726..376874
FT                   /locus_tag="Bcen_3291"
FT   CDS_pept        375726..376874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3291"
FT                   /product="Oxidoreductase FAD-binding region"
FT                   /note="PFAM: ferredoxin; KEGG: bur:Bcep18194_B0579
FT                   ferredoxin/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78186"
FT                   /db_xref="GOA:A0A0H2XVE0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE0"
FT                   /protein_id="ABF78186.1"
FT                   /translation="MMRDAANFEPADSRVTHPAFWNALPERWTSDVEETLVCCHVRQET
FT                   HDVKSFFFRSPQGRTFSFEPGQFITLELDIDGETINRCYTISSSPARPHTISITVKRVP
FT                   GGKVSNWLHDNLQPGAAVRVLGPAGEFTCARHPARKYLFLSAGSGVTPLMSMSRAHHDL
FT                   AEDRDILFVHSARTPDDIIFARELDLIASNHTNFRTSFVVERVGARTNWPGVTGFLTLP
FT                   LLKLIAPDFMEREIFTCGPAPYMKAVRDLLDEAGFDRKQYHEESFSFETLAQTASDEVL
FT                   AELVPPVEGGDAATKQYTVSFAKSNREISCGSEQHVLDAARQSGVRLPASCTQGMCGTC
FT                   KVKLVSGQVEMKHNGGIRQREIDQGMVLLCCSKPLSDLVIDK"
FT   gene            377009..377872
FT                   /locus_tag="Bcen_3292"
FT   CDS_pept        377009..377872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3292"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bur:Bcep18194_B0580 ABC
FT                   proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78187"
FT                   /db_xref="GOA:A0A0H2XTA6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTA6"
FT                   /protein_id="ABF78187.1"
FT                   /translation="MKLFGKLLWTGALSAMVALSASALADTKPTLKIGYVEGWDDSVAT
FT                   SNVAARVIEKKLGYEVKLVPVAAGIMWQGVARGDLDATLSAWLPVTHGSYWDEYKAKVV
FT                   DLGANFPDAKIGLIVPAYVKAKSIDDLNAEKGSFGGRIVGIDAGAGVMRKTDDAIKSYG
FT                   LNYTLMPSSGSAMTAELSRSVGANKPVIVTGWAPHWMFAKWKLRFLEDPKKVFGGAEHV
FT                   DSVVNPGLETKAKPVVAFLKKFQWKPGEIDSVMLAIQNGSKPEVAADAWIAAHADRVNS
FT                   WTEGAQ"
FT   sig_peptide     377009..377086
FT                   /locus_tag="Bcen_3292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            378098..379753
FT                   /locus_tag="Bcen_3293"
FT   CDS_pept        378098..379753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3293"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B0581 amino acid transporter; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78188"
FT                   /db_xref="GOA:A0A0H2XUK9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK9"
FT                   /protein_id="ABF78188.1"
FT                   /translation="MSQAGLRANRTSDVEATISHDSTGHTLHRGLTWKDAFWVTSGVPA
FT                   GVLFTIGGVCATIGQPAWAIWIAAITMGLIQSATYAEISGLFPHKSGGASVYGAIGWVR
FT                   YSKLIAPVSVWCNWLAWSPMLALGCGLAASYALTSLFPANAAVLHWQLKVADLGFIKPG
FT                   LSLRINATFIIATILLLITFKLQHSGASKAARTQRILGIASLTPLLIVGIVPFVTGDVP
FT                   MSNLLPLLPLGHDAQGNLTAASFGSWNGQGVTMALGAMFMAGWASYGFETAVCYTREFR
FT                   DPRRDTAKAIFWSGALCLVVMTLVPMAFQGALGTQAMLDPSIGDGTGVAAAMAKIVGGG
FT                   AWVANAVVVMLMLSILLIVMTSMMGSSRTLYQASVDGWLPKYLSHVNEHGSPTRAMWTD
FT                   LGFNLVLLMMSDYMTVLSISNVCYMLFVFLNLQSGWIHRMDRGNWDRPFRCPTWLLVGG
FT                   AICGYANLVYVGAGANLQGEGTLRNGLIAMLLIVPVFLFRHYWQDRGRFPAQMQRDMEL
FT                   EVPKRAPWLSLMPYAALIGAALTIWLSYYFAWVK"
FT   gene            complement(379864..380748)
FT                   /locus_tag="Bcen_3294"
FT   CDS_pept        complement(379864..380748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3294"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase-like; KEGG: bur:Bcep18194_B0585
FT                   formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78189"
FT                   /db_xref="GOA:A0A0H2XVD1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVD1"
FT                   /protein_id="ABF78189.1"
FT                   /translation="MTAEHRPDQFVLTLSCPSAAGQVAAVVGFLDRHRCYVDALNVFDD
FT                   DLSNRFFVRCVFHPTDETLQIDALRQEFAPIAAGLGGHDGDNQWAIHDVNARPKVLIMV
FT                   SKLEHCLADLLFRWRMGELKMDIVGIVSNHPDFEPLAAQHGLPFRHFPITADTKAQQEA
FT                   QWLDFFESSGAELVILARYMQVLSQETSAKLANRAINIHHSFLPGFKGAKPYHQAHARG
FT                   VKLIGATAHFVTDDLDEGPIIEQVVERVDHALRPEQLLAVGRDVESLTLARAVKAFIER
FT                   RVFLNGDRTVVFP"
FT   gene            complement(380953..381879)
FT                   /locus_tag="Bcen_3295"
FT   CDS_pept        complement(380953..381879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3295"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0586 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78190"
FT                   /db_xref="GOA:A0A0H2XU37"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU37"
FT                   /protein_id="ABF78190.1"
FT                   /translation="MGPLEGLMSKPEPLPSMQALRAFESAARLASFTAAARELGSTQPA
FT                   VSQQVFQLEAELGVPLFERSPRGVTLTADGQCLYEAVRLSLDTLRGATATLRARREHGA
FT                   LTIVTDFGFATYWLMPRLAGLKRVMPDVDVRVVTSQDYDAQRDHGDIAVLFGDGHWPSC
FT                   TAARLFPESVTPVCSPAFRDAHRGVARAEHLLALPLLHVQPTRPERWLSWSGWFDAHGL
FT                   ESPAATRGVTFNSYALVIHAALLGEGVALGWAPLVDELVAAGQLVKLVDAPVVTSRGYF
FT                   LVRPPQRPEPDATHVFRRWLLDACAAA"
FT   gene            382099..383649
FT                   /locus_tag="Bcen_3296"
FT   CDS_pept        382099..383649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3296"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bur:Bcep18194_B0587
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78191"
FT                   /db_xref="GOA:A0A0H2XVE3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE3"
FT                   /protein_id="ABF78191.1"
FT                   /translation="MTNPTPNILILMADQLTPFALPAYGNRVARTPTLDRLAAEGVVFD
FT                   AAYCASPLCAPSRFSLLTGKLPSGIGAYDNAAELPAQTLTFAHYLRAGGYRTMLSGKMH
FT                   FCGPDQLHGFEERLTTDIYPADFGWVPDWDQPTERPSWYHNMSSVLDAGPCVRTNQLDF
FT                   DDEVTFAAKQKLYDVARERAAGHDTRPFCMVVSLTHPHDPYAITREYWDLYRDEDIDMP
FT                   AVRLDAAESDPHSQRLRFVCENDRTPPTDAQIRAARRAYYGATSYVDTQFGSVLAALEQ
FT                   CGFADDTIVIVTSDHGDMLGERGLWYKMTFFEGGCRVPLIVHAPGRFGAARVRGPVSHV
FT                   DLLPTLVELAGATPAGGWPDAGWPDPVDGASLVPHLHGTPAHDVALGEYLAEGALAPVV
FT                   MIRRGDWKYVHCLADPDQLYHLSDDPRELTNLAGQPEAADVLAAFRVEAAQRWNLPELD
FT                   RQVRASQRRRRFHYAATTQGRIHAWDWQPFTDASQRYMRNHIELDTLEAMARFPRVGR"
FT   gene            383695..384660
FT                   /locus_tag="Bcen_3297"
FT   CDS_pept        383695..384660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3297"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bur:Bcep18194_B0588 ABC
FT                   proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78192"
FT                   /db_xref="GOA:A0A0H2XTB1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTB1"
FT                   /protein_id="ABF78192.1"
FT                   /translation="MKRQCNAAIRRIGAALAAAACVAAQPAHAADPQTCDAVKMAAPGW
FT                   TDIDATNAMAGVVLKALGYRQDVANLSVPITYQGLKKGQVDVFLGNWMPAQAPLVKPFV
FT                   DEKSIDVLHANLSGAKFTLAVPDYVAAAGVHTFADLARYADRFGGKIYGIEPGAPANQN
FT                   IKRMLSDHVLGPANRSLVESSETGMLTQVERAVRDKRWIVFLAWEPHLMNTKFHLTYLS
FT                   GGDAYFGPNYGGATVNTVTRAGFAGQCTNLARLFRQMTFSVDVENRMIADMLDNKTSPA
FT                   LAAQHALKAEPALVAGWLDGVTTAAGAPGLPAVRAALDGR"
FT   sig_peptide     383695..383784
FT                   /locus_tag="Bcen_3297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            384921..386060
FT                   /locus_tag="Bcen_3298"
FT   CDS_pept        384921..386060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3298"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B0589 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78193"
FT                   /db_xref="GOA:A0A0H2XUL2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL2"
FT                   /protein_id="ABF78193.1"
FT                   /translation="MKHTKVAVAAALACAACIPAVGHAQSSVTLYGILDAGITYVNNTG
FT                   GSHVVKFDDGVAYGNRFGLKGTEDLGGGLKAVFTLESGFHLGNGQLGFGGAEFGRQAYV
FT                   GLQNDWGTLSFGNQLDITNELVSIYNISAWGSGYAIHQGDFDRFNGDRLPNSVKFLSND
FT                   LSGFKFGAMYSFGNVAGNFHRNSAWSAGASFTKGDFSIGAAYTRLNNPNGIYAFDPYAM
FT                   IGTHTFLGQQTVTVDPATGARTDLFANTPMDVDSQGTFGIGTSYTIGKLTLDANYSYTT
FT                   IKGFGQSSHMQVYEGGGLYQFTPALSFIAGYQHTRFEGHHWNQGTAGLHYLLSKRTDIY
FT                   ISGDYLRASQGVDAVVGYSFTPSTTQTQADVRIGMRHSF"
FT   sig_peptide     384921..384995
FT                   /locus_tag="Bcen_3298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.939 at
FT                   residue 25"
FT   gene            386302..387552
FT                   /locus_tag="Bcen_3299"
FT   CDS_pept        386302..387552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3299"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   KEGG: bur:Bcep18194_B0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78194"
FT                   /db_xref="GOA:A0A0H2XVD6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVD6"
FT                   /protein_id="ABF78194.1"
FT                   /translation="MTTPVPDSSPLSPLPANLFRHAPFQRFWGTRVMSSLAFQILSVAI
FT                   GWYVYALTHSAFALGLVGLAQFVPMFALTLVVGQVADRYDRRRIATICQSVEALAAGVF
FT                   LLGAVQGWLAAPAVYALAAIVGTARAFESPSVSSLLPAVVPRSDLPRATALSTSANQAA
FT                   QILGPAFGGLLYGIGAPVAFGTSVAAFAIAAMLSGTIPLRSAPPAREPVTLRSVFSGIA
FT                   FIRREPAILGALSLDLFAVLFGGATALLPIYARDILQVGPWGLGALRAAPAVGALAGTL
FT                   WLTRFPLKGRPGRAMFGGVIAFGIATIVFGLSRHFALSLVALAALGASDVISVVVRLSL
FT                   VQLRTPDDMLGRVSAVNSLFIGTSNQLGEFESGVTAAWWGAPAAIAVGGAATIAVALAW
FT                   MRLFPQLTNMKSLERDA"
FT   gene            complement(387566..387988)
FT                   /locus_tag="Bcen_3300"
FT   CDS_pept        complement(387566..387988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3300"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   bur:Bcep18194_B0595 protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78195"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU42"
FT                   /protein_id="ABF78195.1"
FT                   /translation="MPFLRRARIVVRPLATRLPIMTEPTRSIDDLSPARVTTAFDLPGH
FT                   TTVRSLGVAQGIVVRSRSIVGSFGASLQTIFGGNITLYTSLCEKAREQAFDKMLAEARK
FT                   LGANAIVAMRYDSTEIGSGVTEVICYGTAVRVTQDA"
FT   gene            complement(388063..389316)
FT                   /locus_tag="Bcen_3301"
FT   CDS_pept        complement(388063..389316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3301"
FT                   /product="leucyl aminopeptidase, Metallo peptidase, MEROPS
FT                   family M28E"
FT                   /EC_number="3.4.11.10"
FT                   /note="PFAM: peptidase M20; KEGG: bur:Bcep18194_B0596
FT                   leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78196"
FT                   /db_xref="GOA:A0A0H2XVE8"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR012189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE8"
FT                   /protein_id="ABF78196.1"
FT                   /translation="MPTLKPTRLSAALGGMLLTAAAHATPVWITLGDTAFRQLQRIDAT
FT                   ATAQYSTTVDAGKAADGAARRETVHVVEIDDTRLGELAHAVHHTRGHGPGYVIHDSFDD
FT                   ARQALQPLPATLAKQAAAPAYTVSNVPQIGTWVQQLQASNIVGTITSLSGFTNRYYTTS
FT                   HGVAASDWLALQWKQLAGSRADITVEQFAHTGFPQKSVILTIRGSDPAAGTVVLGGHLD
FT                   STVGRTTENTRSPGADDDASGIASLTEALRVLLANNYRPKRTIKFVGYAAEEAGLLGSK
FT                   AIAKQFRTQNANVVGVLQLDMTNYKGDPKDIYLITDYTNAAQNTYVKNLAATYLPELAI
FT                   GTSQCGYACSDHASWNAQGYPASFPFEADQNDSPYIHTVNDTLENSDRQANHALKFGKL
FT                   ALAYAVDLGGIAGATVKR"
FT   sig_peptide     complement(389242..389316)
FT                   /locus_tag="Bcen_3301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            complement(389396..391108)
FT                   /locus_tag="Bcen_3302"
FT   CDS_pept        complement(389396..391108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3302"
FT                   /product="Propeptide, peptidase M4 and M36"
FT                   /note="PFAM: Propeptide, peptidase M4 and M36; KEGG:
FT                   bur:Bcep18194_B0597 propeptide, peptidase M4 and M36"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78197"
FT                   /db_xref="GOA:A0A0H2XTB7"
FT                   /db_xref="InterPro:IPR001842"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTB7"
FT                   /protein_id="ABF78197.1"
FT                   /translation="MQTSRKALPLALSLALGFGIVGGTLADTKVSNPQAASLRESLTRG
FT                   VAPPAAKADTAAGQFRADGVAVTLYNPAWRVKKAAATPAATARDFVASQAAQLGLDAAA
FT                   LASLVVTSERNDADFTVVRLQQQAAGLPVYGSDIAVTVAKDGRILYVASNTISGVVATT
FT                   RKSQAVDQQQALDRARAYLGVSGFTHLDAQLVAFVDQAGTHTAWKVRGRPQDGPKGDWE
FT                   LLIDSGSGEVLRAEDKAFYATDGTGFVFRPDPLSPTKSSYGSTGYKDSSDADSTQLTAA
FT                   RVRVTLKELAQSGTRYTLTGPYAACIDFDAPLDKACPSQSTPAFEFTRGNLYFEAVNAY
FT                   YHIDTFLRYVNQTLGIKALPYQYTGGVQYDPHGESGDDNSSYSSSSGRLTFGQGGVDDA
FT                   EDADVVIHELGHGIHDWVTNGGLSQQEGLSEGTGDYLAAAYSRDFNQWSPSDAQYQWVY
FT                   NWDGHNEFWGGRVTNWNVGRTYAQARGAEIHTAGQYWASCNLVARDAIGAQAMDKAFLK
FT                   GLSMTNSSTNQKAAAQAVLTAAAALGYSSTQLTAIGNAYNKSCTYGVTVPQKS"
FT   sig_peptide     complement(391028..391108)
FT                   /locus_tag="Bcen_3302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            complement(391601..392545)
FT                   /locus_tag="Bcen_3303"
FT   CDS_pept        complement(391601..392545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3303"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0599 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78198"
FT                   /db_xref="GOA:A0A0H2XUL9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL9"
FT                   /protein_id="ABF78198.1"
FT                   /translation="MPEDFHFLLLPGFSALGFMSAVEPLRVANRFRTELYRWHVISADG
FT                   APVAASNGIPVAAEAACADVPQVDTVFVVAGFDPLVCYTRTLGDWLRRQHRHGATLGGI
FT                   DTGSFVLAEAGLFDASQPLTLHWEALAAFRERYPGLNATQELFEIDDRRITCAGGTASI
FT                   DMMLDLIGRRHGADLAAAISEQFVVSRIRQRSDSQRLEIAARYGVHNRKLIQVIGTMQR
FT                   HMENPLGSDALAQEVSITRRQLERLFSATLNDTPTRFYLNLRLDRARELLQQTDMSITS
FT                   VCVACGFESPSHFSRTYRARFGMSPRSDRRATR"
FT   gene            complement(392667..393629)
FT                   /locus_tag="Bcen_3304"
FT   CDS_pept        complement(392667..393629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3304"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0600 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78199"
FT                   /db_xref="GOA:A0A0H2XVD9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVD9"
FT                   /protein_id="ABF78199.1"
FT                   /translation="MLVLHQRFDDADRHAEALRGWNQRYDQIGSGAYRSAVKHAVLDGV
FT                   QLFQETANVRIIQRGCLPHGHTVFGMPLTGSGTFAFGGARIERGTIVMARGGIPFELHS
FT                   PDDMSLIGVVVEPELMQQIEDAADVRLDARALRHGVVEVPVAARERASVQLATLLERVL
FT                   SAPDTFDAARAQCAIRADVGNVLVDLLTYRMPEPSNRLTHACHADIVRRVHDYVIEHPE
FT                   APVDILSLCTQLRVSRRTMQNSFQSVVQTSPLNYTRSLRLAQVRRLLLDTRQSDLPISE
FT                   AAARWGFLHLGHFASVYKAQFGELPSATARRTVHRAKTR"
FT   gene            393871..395028
FT                   /locus_tag="Bcen_3305"
FT   CDS_pept        393871..395028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3305"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /note="PFAM: methylamine dehydrogenase heavy subunit; KEGG:
FT                   bur:Bcep18194_B0601 amine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78200"
FT                   /db_xref="GOA:A0A0H2XU46"
FT                   /db_xref="InterPro:IPR009451"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU46"
FT                   /protein_id="ABF78200.1"
FT                   /translation="MRTRRRTAALAATLALVAAWAGGANAVEKPEELVVQKMPPWHPHE
FT                   VYIVDISMPSMTDGRIYVYDADAKKLLGQIDGGFAPGLAISPDRKTSFVATTYFSRGSH
FT                   GTRTDVVEMIDNATLDHAGEIVIPAKHAQHVPSPYNTAFSADGKRLYVANITPSASVTV
FT                   IDAVSKKVLSEIDTAACVLAYPSGNDRFTALCESGKALTVTLDANGKETKRTMSEAFID
FT                   VDKDPAFVNASRYKGEYLFTTYGGNVRSADFSGDKPAFGKPWPLLTDAERAEGWRPGGM
FT                   QQTAVQAKQNRYYVLMHKGTDGSHKDAGTQVWVIDLKSKQRVARWDLAQLKVDPLVSIQ
FT                   VSEDDKPLFYGLTATSDLVVMDARTGALQHVEKQVGNTSSLLVNP"
FT   sig_peptide     393871..393951
FT                   /locus_tag="Bcen_3305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            395036..395590
FT                   /locus_tag="Bcen_3306"
FT   CDS_pept        395036..395590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78201"
FT                   /db_xref="GOA:A0A0H2XVF2"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVF2"
FT                   /protein_id="ABF78201.1"
FT                   /translation="MTLDPVLATSAQAGAAVVVLLGAFAKMRRPAAFRQALAGYRLLPD
FT                   ALTAPVAFAIPLAEAVAAVVLLFPDTRTAGATGLIALLLAFAAGLAINLLRGHTDIDCG
FT                   CSGFTAARADVPRGIGWLHVGRVLLLVALAATAFVEPGTRAVVWFDYLTLFFSVLLIVC
FT                   ALLTVDVLLANVPRLSHLRNS"
FT   gene            395587..396222
FT                   /locus_tag="Bcen_3307"
FT   CDS_pept        395587..396222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3307"
FT                   /product="Methylamine dehydrogenase accessory protein MauD"
FT                   /note="TIGRFAM: Methylamine dehydrogenase accessory protein
FT                   MauD; PFAM: Redoxin; KEGG: bur:Bcep18194_B0603 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78202"
FT                   /db_xref="GOA:A0A0H2XTC1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013478"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC1"
FT                   /protein_id="ABF78202.1"
FT                   /translation="MMQTALTVSTALLWVAVLALGAICLALVRQIGILYERIMPAGALM
FT                   IDKGPAVGAIAPTFELTDMRGAQVKVGGIDAMGKATLLFFLSPTCPVCKKLLPLLPSLQ
FT                   ASEATPVNIVLASDGDADEHTRFARKHDLGRFPYVLSQELGFAYQIGKLPYAVLLDETG
FT                   TVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDHSHDAHDGHAQHA"
FT   sig_peptide     395587..395652
FT                   /locus_tag="Bcen_3307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.410 at
FT                   residue 22"
FT   gene            396262..396798
FT                   /locus_tag="Bcen_3308"
FT   CDS_pept        396262..396798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3308"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /note="PFAM: Methylamine dehydrogenase light chain, C
FT                   terminal; KEGG: bur:Bcep18194_B0604 amine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78203"
FT                   /db_xref="GOA:A0A0H2XUM4"
FT                   /db_xref="InterPro:IPR013504"
FT                   /db_xref="InterPro:IPR016008"
FT                   /db_xref="InterPro:IPR036560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM4"
FT                   /protein_id="ABF78203.1"
FT                   /translation="MGVFDSWFERSARGVAQHSSRRSAMAKLGKVLVGSALLPLLPVDR
FT                   TAYAADAASGASGASGAGASDDPTSCDYWKYCAIDGWLCSCCGGTSSSCPPGTTPSPIT
FT                   WIGTCRNPHDGSDYIVSYNDCCGKTSCGKCFCNRNEREKPLYKLSLNNDINWCMANGNS
FT                   NYHCSVSVLLGAAKQ"
FT   gene            396795..397295
FT                   /locus_tag="Bcen_3309"
FT   CDS_pept        396795..397295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3309"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG:
FT                   bur:Bcep18194_B0605 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78204"
FT                   /db_xref="GOA:A0A0H2XVE2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE2"
FT                   /protein_id="ABF78204.1"
FT                   /translation="MKVKQAGKRIVACMAAATAFALPAAAHAQEAVHYPVGKSLFDAQC
FT                   AVCHQAGGKGQDGLAPPLTEYPGKYAAAEAGRAQLIATLLHGMFGEIEVHDKRYNFKMP
FT                   SFASASDDDIAHVLNYVVFDLNAQHGDAKPFTAADIRAARAKQMDGTAVHAQRAVVIKG
FT                   LGL"
FT   sig_peptide     396795..396881
FT                   /locus_tag="Bcen_3309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.967 at
FT                   residue 29"
FT   gene            397292..397828
FT                   /locus_tag="Bcen_3310"
FT   CDS_pept        397292..397828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3310"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: bur:Bcep18194_B0606 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78205"
FT                   /db_xref="GOA:A0A0H2XU53"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU53"
FT                   /protein_id="ABF78205.1"
FT                   /translation="MNGVRASVHGTRCAASSWLGGLSHRLSCWLLLAAAAAGAFAAPAS
FT                   AQADGAADAALARQHWVLNCMGCHTATGGGIPGKVPPLANSLGYFTHLPAGREYVMRVP
FT                   GASNSALSDRELADVLNWVLTTMNRDALPRDFKPYTAAEVAAHRRPALSDVAAVRAGLV
FT                   RALQARGIDGVADRY"
FT   sig_peptide     397292..397438
FT                   /locus_tag="Bcen_3310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.493 at
FT                   residue 49"
FT   gene            397862..399367
FT                   /locus_tag="Bcen_3311"
FT   CDS_pept        397862..399367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3311"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0607 aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78206"
FT                   /db_xref="GOA:A0A0H2XVF5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVF5"
FT                   /protein_id="ABF78206.1"
FT                   /translation="METNETFALLDATRAFLAKPKKMLIGAEWSDAASGRQLDVVNPAD
FT                   GTVLARVPEADERDVQQAVAAARRAFDAGPWRSAKTTDRERLMLVLADLIEANARELAE
FT                   IESLDNGKPVLVAQGLDVAMAAQCFRYMAGWATKIEGSVIDAGMPYLPDSEIFAYTRKE
FT                   PVGVVGAIIPWNFPLLMAAWKIAPALATGCTVVLKPAEDTPLSALRLGELIQAAGFPDG
FT                   VVNIVTGYGHTAGAALSRDPRIDKIAFTGSTQTGKTIGHAALDNMTRMSLELGGKSPVI
FT                   VLPDVDLDKAALGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERVAKIAASLKIGPGM
FT                   DPATQIGPLVSAKQRERVCGYIDSGFGEGARAAAGGRAIDGPGFFVEPTVLVDTTQAMR
FT                   VVREEIFGPVLVAMPFDDVDTAVQLANDTPYGLGASIWSNDLAAIHKLIPRIAAGTVWV
FT                   NCHSLLDNALPFGGMKQSGFGRELGRAVIDQYTESKSVMMNYA"
FT   gene            complement(399425..399928)
FT                   /locus_tag="Bcen_3312"
FT   CDS_pept        complement(399425..399928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3312"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bur:Bcep18194_B0608 protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78207"
FT                   /db_xref="GOA:A0A0H2XTC3"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC3"
FT                   /protein_id="ABF78207.1"
FT                   /translation="MKALHAGHRRCGHPFGAFILVATLLSYLLVVAAGISVALQQVLNA
FT                   NLRAQIGSPWWAGSVSYLVGLAAMLAVALLSPHPRLSGTFSGAGSWFSWTGGLFGAVFV
FT                   GVAILMVPRLGAATTLALIVVGQMTGALVFDHFGVLGIVQHSASPIRVAGAACLILGVV
FT                   LIRA"
FT   sig_peptide     complement(399830..399928)
FT                   /locus_tag="Bcen_3312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.707) with cleavage site probability 0.398 at
FT                   residue 33"
FT   gene            399991..400872
FT                   /locus_tag="Bcen_3313"
FT   CDS_pept        399991..400872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3313"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0609 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78208"
FT                   /db_xref="GOA:A0A0H2XUN1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN1"
FT                   /protein_id="ABF78208.1"
FT                   /translation="MPSLRQIQYFLTVADLGGFTPAAGALHVAQSALSRQIGQLEDELG
FT                   FLLFDREPRGVRLTPAGAIYRERVASIPATLMAAADEGAQLSRGEAGVLRLLHSSTVPV
FT                   SSLMPDLDRFMRDCSGARIDLDRASSEDQVTDIANGHADIGIVRLPVLRRDARVRFVEL
FT                   AAERLCAALPADHPLAGRKRIAIARLRREPFVSAVYRERGGLARVVLDLCLKRGFVPAA
FT                   ARIVSPKTSMLNLVAAGRGVAIVPARMASIGIDGVVFVPISDEDAQSVCALVLPVEPTV
FT                   LAQAFVRAVTAG"
FT   gene            400898..401239
FT                   /locus_tag="Bcen_3314"
FT   CDS_pept        400898..401239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78209"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE5"
FT                   /protein_id="ABF78209.1"
FT                   /translation="MFGRTDVMTQTRYPASRINRRDSSPRGPSASNRARSFAFAPRVTP
FT                   RCMATMMAKRATTKKATSIVLLLAEETGDGHRDGRSCSSPSISVMRSIRARGGAATGGP
FT                   RAIARRLPA"
FT   gene            401536..402489
FT                   /locus_tag="Bcen_3315"
FT   CDS_pept        401536..402489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3315"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bur:Bcep18194_B0611 ABC
FT                   proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78210"
FT                   /db_xref="GOA:A0A0H2XU58"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU58"
FT                   /protein_id="ABF78210.1"
FT                   /translation="MKSTKIAALAAAVLATGAFTHAALAETEATTCRTVRFADIGWTDI
FT                   TSTTALASTVFEALGYKPTTTIASVPISFAGLKSKQLDVSLGYWWPVQQKQLQPFLDSK
FT                   SINVVEPPNLSGAKATLAVPSYEYQAGLKTFDDIAKHRAELDGKIYGIEPGSSANATIQ
FT                   KMIDTNQYGLGGFKLVESSEAGMLVTVERAVRDKKWVVFLGWEPHPMNIQLSMNYLSGG
FT                   DAAFGPNYGEARVYTLTAPDFIARCPNAGKLVTNLRFSTQLENQLMQSVMNKTKPAEAA
FT                   KAYLKKNPQVLDPWLAGVKTFDGKDGLPAVKAYLGL"
FT   sig_peptide     401536..401613
FT                   /locus_tag="Bcen_3315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.978 at
FT                   residue 26"
FT   gene            402551..403480
FT                   /locus_tag="Bcen_3316"
FT   CDS_pept        402551..403480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3316"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bur:Bcep18194_B0612 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78211"
FT                   /db_xref="GOA:A0A0H2XVG1"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVG1"
FT                   /protein_id="ABF78211.1"
FT                   /translation="MNHEVIITCAVTGAGDTVGKHPAIPVTPKEIAAAAIEAAKAGATV
FT                   AHCHVRDPQTGRGSRDPNLYREVVDRIRSADVDVIINLTAGMGGDLEIGPGEDPMRFGK
FT                   GTDLVGGLTRLAHVEELLPEICTLDCGTLNFGDGDYIYVSTPAQLRAGAKRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDDPPLFQLCLGIPWGAPADTGTMKAMVDNLPPGAHWA
FT                   GFGIGRMQMPMVAQAMLLGGHVRVGLEDNIWLDRGVHATNGTLVERAREIVERLGGRVL
FT                   TPAEGRRKLGLPARGERALERRAIAEFA"
FT   gene            403571..404536
FT                   /locus_tag="Bcen_3317"
FT   CDS_pept        403571..404536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3317"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase-like; KEGG:
FT                   bur:Bcep18194_B0613 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78212"
FT                   /db_xref="GOA:A0A0H2XTC5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC5"
FT                   /protein_id="ABF78212.1"
FT                   /translation="MAVKTDIKTFAAIGTGVIGSGWISRALAHGLDVVVWDPAPGAEAR
FT                   LRANVANAWPALERVGLAPGADPARLRFVSTIEACVADADFIQESAPEREALKLELHEQ
FT                   ISRAAKPDAIIASSTSGLLPTDFYARATHPERCVVGHPFNPVYLLPLVEVLGGARTSPE
FT                   AVEGAMEVYRKLGMRPLHVRKEVPGFIADRLLEALWREALHLVNEGVATTGEIDDAIRF
FT                   GAGIRWSFMGTFLTYTLAGGDAGMRHFMQQFGPALELPWTKLVAPTLTDALIDSVVEGT
FT                   TEQQGTRSIKELERYRDECITEVLKSIAAVKARHGMRFED"
FT   sig_peptide     403571..403657
FT                   /locus_tag="Bcen_3317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.925 at
FT                   residue 29"
FT   gene            404547..405035
FT                   /locus_tag="Bcen_3318"
FT   CDS_pept        404547..405035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3318"
FT                   /product="thioesterase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B0614 thioesterase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78213"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN6"
FT                   /protein_id="ABF78213.1"
FT                   /translation="MTGDTPLTIYRDVVRPEWVDYNGHLRDAFYLLIFSFATDALLDRI
FT                   GLDDAARRERGRSVYTLEAHVNYLHEIKEGTPVRVDARVLAHDAKRLHLYLELFADGHD
FT                   DAVSASEQMLLHVDTRDGAKSAPFDDDVAARVAELHALQRECAAPAYAGRVIGLPPRR"
FT   gene            405086..406042
FT                   /locus_tag="Bcen_3319"
FT   CDS_pept        405086..406042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3319"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG:
FT                   bur:Bcep18194_B0615 lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78214"
FT                   /db_xref="GOA:A0A0H2XVE6"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE6"
FT                   /protein_id="ABF78214.1"
FT                   /translation="MLEPEIAAFVAAVDAWYPADAAARSPDEQRRLYDRFAAEWTPAAL
FT                   PAGIVQHDAVWRAPGGRTIALRRYTCAHGTPRGTVLFFHGGGFVVGSLDSHALITAQLA
FT                   ADTGLDVIAVDYRLAPEHRAPAALDDCLEVTRAARDAHRPLGPCVPPLTLAGDSAGGML
FT                   AAAVATALRDAGERNVDGIALVYPMLGFEPQSPARDAEAYAPMLTLDDVHRYRALYWGG
FT                   DLADVLRDGNPLLCASVPLEATRFDGLPPVLAIGAEHDPLRDDARVYVERIRAAGGIAR
FT                   YWMGEGLVHGCWRALGTSPQAARMHRLVGGFLLAPHA"
FT   gene            406066..407271
FT                   /locus_tag="Bcen_3320"
FT   CDS_pept        406066..407271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3320"
FT                   /product="Gamma-butyrobetaine,2-oxoglutarate dioxygenase"
FT                   /EC_number="1.14.11.1"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: bur:Bcep18194_B0616
FT                   gamma-butyrobetaine,2-oxoglutarate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78215"
FT                   /db_xref="GOA:A0A0H2XU61"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU61"
FT                   /protein_id="ABF78215.1"
FT                   /translation="MQAAAQHRIEDWRTFSADAAIAAATIGDDAVEVEWSDARRSPFHF
FT                   DWLRDNCACSACVHAITREQVFEIADAREDLSALTVHVETDGALHVEWNDGHRSAWSPG
FT                   WLRAHAYDDASRAERLAAHGRHVWTGDDATAIGVFAWRDVMEDDRALLAWLGALQRTGL
FT                   TRVEGVPAERGRVDEIARRVGLIRESNFGVLFDVESKPRPDSNAYTSLNLPPHTDLPTR
FT                   ELQPGVQFLHCLANDATGGDSIFLDGFALADALRREHPDDFEQLASTPFEFWNKSANSD
FT                   YRCSAPVIGLDARGNVTEVRVANFLRGPLDAPAGSVAAVYRAYRRFLALAREPRFRVQR
FT                   RLRAGDMWAFDNRRVLHARTGFDPSTGRRHLQGCYVDRDELLSRWRVLSRSAPAGAAAV
FT                   AG"
FT   gene            complement(407466..407768)
FT                   /locus_tag="Bcen_3321"
FT   CDS_pept        complement(407466..407768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78216"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVG5"
FT                   /protein_id="ABF78216.1"
FT                   /translation="MKSLVSAVVAAAALSASFGAFAQQSTVTRAQVRNELVQLEQAGYK
FT                   PGVSSPYYPNDIQSAEARVHGVDSSGYGAQPAPLVHSGAPAAASSNARDSIFFGQ"
FT   sig_peptide     complement(407700..407768)
FT                   /locus_tag="Bcen_3321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(407983..408969)
FT                   /locus_tag="Bcen_3322"
FT   CDS_pept        complement(407983..408969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3322"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B0618 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78217"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC7"
FT                   /protein_id="ABF78217.1"
FT                   /translation="MHAWSARHVPAQGGKVAVVTGANSGLGWHLAETLAAKGATVVMGC
FT                   RDATRSAQAADAIRRLHPHARVEVDPLDLADLASIARFAADVGERHGRVDILCNNAGVM
FT                   FLPLRHTRDGFEMQFGTNHLGHFALTGHLLPALRAARRARVVTMSSGFNRGGRIRVDDL
FT                   RAAHRYNRYLAYCDSKLANLVFALELQRRFERAAFAGISVAAHPGYAATNLQFAGPAMD
FT                   RSPTRAALMRAANRYLAQPADQGALPAIHAATSPDLAGGAYIGPSGWFESRGLPAPASV
FT                   PRAARNVATAALLWEASEAATGVRFLSSGAPAGRASGRPFDTAAEAR"
FT   gene            complement(409140..409430)
FT                   /locus_tag="Bcen_3323"
FT   CDS_pept        complement(409140..409430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78218"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN9"
FT                   /protein_id="ABF78218.1"
FT                   /translation="MKASQSLPALDPADVHVEILERSDTLLVVRWVEPGRCHYGEQRWR
FT                   RRFAQRTGTCALSRQVIHRGDEVFRPAERPAPANAAAMISAAEVLALAGSR"
FT   gene            410097..410861
FT                   /locus_tag="Bcen_3324"
FT   CDS_pept        410097..410861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3324"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_B0620 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78219"
FT                   /db_xref="GOA:A0A0H2XVE9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVE9"
FT                   /protein_id="ABF78219.1"
FT                   /translation="MRLQGKRALVTAAGQGIGRATALRFASEGADVLATDINEAALVRL
FT                   EADAERAGGRLVTRRLDVTATNEVAALAASERAFDVLFNCAGYVHHGSILECDEDAWAF
FT                   SLNLNVTSMYRLIRALLPAMLEAGGGSIVNMASAASSVKGVPNRFVYGTTKAAVIGLTK
FT                   AVAADFVERGIRCNAICPGTIESPSLEQRIADQARTRHVSADEVRQAFVARQPIGRIGS
FT                   ADEVAALALYLASDEASFTTGTIHLIDGGWSN"
FT   gene            410925..411767
FT                   /locus_tag="Bcen_3325"
FT   CDS_pept        410925..411767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3325"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bur:Bcep18194_B0621 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78220"
FT                   /db_xref="GOA:A0A0H2XU66"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU66"
FT                   /protein_id="ABF78220.1"
FT                   /translation="MKLLRFGDKHHEKPGLLDAQGHIRDLSGVIDDIAGDALTPASLAR
FT                   LRDIPPSSLPLVEGTPRLGACVGRVGKFICIGLNYSDHAAESGMEVPKEPVVFGKWTSA
FT                   ISGPNDDVEIPRGSEKTDWEVELGVVIGQGGRYIDEADALSHVAGYCVVNDVSEREYQL
FT                   ERGGTWDKGKGNDTFGPIGPWLVTADEVPDPHALRLWLEVDGHRYQNGTTATMVFRVPH
FT                   LISYLSRFMSLQPGDVISTGTPPGVGLGQKPPVYLRAGQVITLGIDGLGEQRQRTVQA"
FT   gene            411791..413068
FT                   /locus_tag="Bcen_3326"
FT   CDS_pept        411791..413068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3326"
FT                   /product="Mandelate racemase/muconate lactonizing
FT                   enzyme-like protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme-like; KEGG: bur:Bcep18194_B0622 mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78221"
FT                   /db_xref="GOA:A0A0H2XVH0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVH0"
FT                   /protein_id="ABF78221.1"
FT                   /translation="MPIIRSMRVLDVRFPTSRQLDGSDAMNPDPDYSAAYVVLETDRDG
FT                   LEGHGLTFTIGRGNEICCAAIDAMRHLVVGLDLDWIREDMGRFWRHVTSDSQLRWIGPD
FT                   KGAIHLATGAVVNAVWDLWAKAVGKPLWRLVADLSPEELARAIDFRYLTDCLSPDEALD
FT                   LLRRQAPGKAARIAALERDGYPCYTTSAGWLGYSDDKLRRLCREAVDEGFEYVKLKVGA
FT                   NLEDDIRRVTIAREVIGPDRKLMIDANQVWEVDEAIDWVRELAFARPWFIEEPTSPDDV
FT                   EGHRKIREAIAPVQVATGEMCQNRVLFKQFIARGAIDVVQIDACRLGGVNEILAVMLMA
FT                   AKYGLPVCPHAGGVGLCEYVQHLSMIDYVCISGTKEGRVTEYVDHLHEHFVEPCVVRGA
FT                   AYMPPTAPGFSIEMKPESLEQYRFRG"
FT   gene            413156..413932
FT                   /locus_tag="Bcen_3327"
FT   CDS_pept        413156..413932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3327"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B0623 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78222"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTC8"
FT                   /protein_id="ABF78222.1"
FT                   /translation="MDLNLQDKVVIVTGGASGIGAAISMRLAGEGAVPVVFARHAPDDG
FT                   FWRELTQQQPRAACVTVELQDDAQCRDGVAQTLARFGRIDGLVNNAGINDSIGLDAGRD
FT                   AFVASLERNLIHYYVMAHYCVPHLKAARGAIVNVSSKTAVTGQGNTSGYCASKGAQLAL
FT                   TREWAVALRDDGVRVNAVIPAEVMTPLYQNWIAGFDDPQAKVAEIAGKVPLGQRFTTAD
FT                   EIADTAVFLLSERASHTTGQWLFVDGGYTHLDRAIS"
FT   gene            413945..415483
FT                   /locus_tag="Bcen_3328"
FT   CDS_pept        413945..415483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3328"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0624 ABC sugar transporter, ATPase subunit;
FT                   TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78223"
FT                   /db_xref="GOA:Q1BQ82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BQ82"
FT                   /protein_id="ABF78223.1"
FT                   /translation="MQPDLNPNTTQPLIALTGIGKRFPGVQALDDCRFDLRAGEVHALM
FT                   GENGAGKSTLMKILAGVYQRDAGEIRMDGRPVEIADPRAAQALGIGIIHQELNLMNHLS
FT                   VAQNIFIGREPRGRFGVFVDEEKLNRDAAAIFQRMRLDLDPRTPVGRLTVAKQQMVEIA
FT                   KALSFDSRALIMDEPTAALNNAEIAELFRIIRDLRAHGVGIIYISHKMDELRQIADRVT
FT                   VMRDGKYVATVPMADTSMESIISMMVGRQLDTETRTPPDTSGNEIALEVRGLSRGRAIR
FT                   DVGFTLRRGEILGFAGLMGAGRTEVARAVFGADPVDAGEIRVHGRAVTIRTPADAVKYG
FT                   IGYLSEDRKHFGLAIGMDVQNNIALSSMRRFVRRGLFLDARGMRDAARSYVRQLAIRTP
FT                   SVAQPARLLSGGNQQKIVIAKWLLRDCDILFFDEPTRGIDVGAKSEIYKLLDALAADGK
FT                   AIVMISSELPEVLRMSHRILVMCEGRVTGELRAADATQEKIMQLATQRESTVLS"
FT   gene            415520..416557
FT                   /locus_tag="Bcen_3329"
FT   CDS_pept        415520..416557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3329"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B0625 ABC sugar transporter, inner membrane
FT                   subunit; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78224"
FT                   /db_xref="GOA:A0A0H2XUP4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP4"
FT                   /protein_id="ABF78224.1"
FT                   /translation="MSNDTHPVPPLATGDTPAAASSLKSRFFNPAARQKLLAFASLVLL
FT                   IVFFSFASSNFLEVDNLVSILQATAVNGVLAVACTYVIITSGIDLSVGTLMTFCAVMAG
FT                   VVLTKWGMPLPLGILAALCFGALSGCVSGFVIAKMKVPPFIATLGMMMLLKGLSLVISG
FT                   TRPIYFNDTPGFTSIAQDSLIGNLIPALPIPNAVLILFLVAIGASIVLNRTIFGRYTFA
FT                   LGSNEEALRLSGVNVDAWKIAVYTFSGAVCGIAGLLIASRLNSAQPALGQGYELDAIAA
FT                   VVIGGTSLSGGAGSIVGTIIGAFIMSVLTNGLRIMSVAQEWQTVVTGVIIILAVYVDIL
FT                   RRRRR"
FT   gene            416640..417581
FT                   /locus_tag="Bcen_3330"
FT   CDS_pept        416640..417581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3330"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bur:Bcep18194_B0626 ABC
FT                   sugar transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78225"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVF1"
FT                   /protein_id="ABF78225.1"
FT                   /translation="MIRSKVLNAIVGLTFAAGVTAGAQAQETYIPLISKGFQHQFWQAV
FT                   KSGATQAAKDYKVKVTFEGPETEAMVDKQIDMLSAAIAKKPAALGFAALDSKAALPLLK
FT                   RAQAEKIPVIAFDSGVDSDIPVTTAATNNKAAAALAADKLAALIGDEGQVAVVAHDQTS
FT                   RTGIDRRDGFLDRMKSAHPKVQVVTVQYGEGDQLKSTEVTKSILQAYPKLKGLFGTNEG
FT                   SAIGVVNGVREMKRKVVIVGYDSGKQQKDAIRSGLMAGAITQNPIGIGYKTVEAAVKAI
FT                   KGEKLPKVIDTGFYWYDKTNIDDPKIAAVLYD"
FT   sig_peptide     416640..416717
FT                   /locus_tag="Bcen_3330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 26"
FT   gene            417651..418541
FT                   /locus_tag="Bcen_3331"
FT   CDS_pept        417651..418541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3331"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bur:Bcep18194_B0627
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78226"
FT                   /db_xref="GOA:A0A0H2XU72"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU72"
FT                   /protein_id="ABF78226.1"
FT                   /translation="MGAVRIDSHQHFWRYRAADYPWIGPGMGVLARDYLPDELWPQMHA
FT                   QALGASIAVQARAGRDETAFLLDLARDDARIAAVVGWEDLGAPALADRVAEWRSPKLRG
FT                   FRHQVQDEADVGAFVADPAFNRGVAWLQANGYVYDVLVFERQLPDVRAFCARHDAHWLV
FT                   LDHVGKPALAEFERDDTALARWRASLRELGALPHVACKLSGLVTEADWRRGLRGQDIRH
FT                   IEQCLDAALDAFGPQRLMFGSDWPVCLLAASYDEVASLVERWAEARLSAAERGALWGGT
FT                   AARCYAVPGDVKRGI"
FT   gene            418610..419377
FT                   /locus_tag="Bcen_3332"
FT   CDS_pept        418610..419377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3332"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0628 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78227"
FT                   /db_xref="GOA:A0A0H2XVH5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVH5"
FT                   /protein_id="ABF78227.1"
FT                   /translation="MSIQPIQNRRLYQQIADKLSAMIESGDFPPGSYLPPERELAERFG
FT                   VSRTSVREALIALEVNGLVSVRVGDGVKVRHPEAAAAPEPAPAPDATVAPFSIVEIDPE
FT                   LGIALDLDTEIPPFALLQARRLIEPEAASLAAKHGSDAQIEGIHEAFLRNQDDNRSGSL
FT                   THPGDRLFHIRIAEASDNAAYALMIKQLLAHKYDLMFQRLQSLYMPNDMPHRSELEHRA
FT                   ILDAIRARDPDAARRAMAEHLDEVIRIFGRALD"
FT   gene            419560..420705
FT                   /locus_tag="Bcen_3333"
FT   CDS_pept        419560..420705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3333"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: mlo:mll2703 glycolate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78228"
FT                   /db_xref="GOA:A0A0H2XTD0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTD0"
FT                   /protein_id="ABF78228.1"
FT                   /translation="MRVNDCHNFHDFRELAKRRLPGPIFNYIDGAADDETTYRRNTSAF
FT                   ESCDLVPNVLRGVRDVDLSVTVMGQKLGMPVYCSPTALQRLFHHDGERAVAAAAAKFDT
FT                   MFGVSSLGTVSLEEARAISPGPQVYQFYFHKDRGLNREMMNRSREAGVNVMMLTVDSIT
FT                   GGNRERDKRTGFSIPFRLTLAGLTEFALKPAWAVNYLTHERFRLPQLDRHVDMGGGAMS
FT                   ISRYFTDMLDPSMSWDDVAAMVREWNGQFCLKGVMSVDDARRAADIGCTGIVLSNHGGR
FT                   QLDGSRAAFDQLAEVVDAVGDRIDVMMDGGVQRGSHVLKALALGAKAVGLGRYYLFPLA
FT                   AAGQPGVERALQLMRTEIERDMRLMGCASVAQLGRNQLRFR"
FT   gene            complement(420758..421999)
FT                   /locus_tag="Bcen_3334"
FT   CDS_pept        complement(420758..421999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3334"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B0629 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78229"
FT                   /db_xref="GOA:A0A0H2XUP7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP7"
FT                   /protein_id="ABF78229.1"
FT                   /translation="MDFDVIVLGAGIVGVSAALHLQDRGRKVALVDRGAPGEGTSFGNA
FT                   GLIERSSVEPYPFPRSPFTLMRYALNRSTDLYWHSASLPAFAPWLARFWWESAPPRHAA
FT                   ASRDMLPLIERCIVEHDALIARAGAGELVRASGWLEAFRTPAAFERGVAEAGLTARRHG
FT                   LGITPLDAAALRAHEPSLAPGFCGALHWLDPKSVVDPAALVKAYAHLFVQGGGTLLTGD
FT                   AASLDALSPGWQVRTDDGPAAAPAVVVALGPWSDTVFGKFGYKIPLREKRGYHMHYAPS
FT                   ARGVPSAPIVDREYGYVIAPMRRGLRLTTGVEIARRGLPPTGVQLERAERVARPVFGFG
FT                   ERLDPHPWLGFRPCTPDMRPVIGPAPAHRGLWFAFGHNHHGLTLGPVSGRLLAEMMTGE
FT                   APFTDPAPYRADRF"
FT   gene            complement(422115..423473)
FT                   /locus_tag="Bcen_3335"
FT   CDS_pept        complement(422115..423473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3335"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: ccr:CC2613
FT                   pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78230"
FT                   /db_xref="GOA:A0A0H2XVF4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVF4"
FT                   /protein_id="ABF78230.1"
FT                   /translation="MSAAPSMRSALALAATVRAGQVSAMSLVQAVLADIAARDSAINAC
FT                   AATFDERARRDALRIDRLVRAGRDPGPLAGVPFLVKWNIDVAGYTTVAGSPARAALPPA
FT                   VADATIVARMCAAGAIPIGATQMDELACGATGVNPHYGAVRLPADPTRMTGGSSSGSAA
FT                   AVAAGYVPLALGSDTNGSVRAPAALCGVWGFRPGDGRLSRAGCLPYADSLDTVGGFAND
FT                   VDDLAVLYDTLRETHAPRAQRPRDPAAPLRVAVLTGDFETHADADAQRAVRRAAARLRA
FT                   GETVAVASDEVAHVREAALVISNVELARAHHGLVDAPAALVSEHLRSRLAAGLATSDSA
FT                   YRHALADRAAWRTRIAALFARHDLLLAAATPCAAPRFTDATVDINGVALEPAKTLGLLT
FT                   QPISFAGLPVVSAPCFASGELPVGVQLIGGPGGDAVCFDAARQFSAAWGDMLR"
FT   sig_peptide     complement(423399..423473)
FT                   /locus_tag="Bcen_3335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.776 at
FT                   residue 25"
FT   gene            complement(423470..424621)
FT                   /locus_tag="Bcen_3336"
FT   CDS_pept        complement(423470..424621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3336"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc2352 probable permease transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78231"
FT                   /db_xref="GOA:A0A0H2XU77"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU77"
FT                   /protein_id="ABF78231.1"
FT                   /translation="MVTDLHLTDAAYGVGAGLFFVGYLLLQVPAGWLVRRIGVKRCLAG
FT                   SMLTWGIVSVATLTTRDTASFYALRFLLGVTEASFFPAVIAYFSVWFPSHRLAKVMAFL
FT                   FLAMPLGVIVGGPLSGWIMDATHGGFGLRGWQWMFLIEGLPAIVLGVYLLARVTERIDD
FT                   ATWLTDTEKRMIHAEMAQEAAGKRTRLGAALREPTLWLLFATSFLYNIGNYGLVFWMPT
FT                   MIKALGSSSNLQIGLVSAIPYLVASVAMVANAQHSVRTGERRWHTALPVAIGGIALLAS
FT                   LGMRTHPVLAVACLTVGVAGIMSTLAMFWSLPSRILAGEAAAGGAGLVNIGAAVAGFVG
FT                   PTLMGYATGLTGSTELGVALLAFTLFAAAALILSIPRRLMVRT"
FT   gene            complement(424884..426320)
FT                   /locus_tag="Bcen_3337"
FT   CDS_pept        complement(424884..426320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3337"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="PFAM: amidohydrolase; KEGG: pfl:PFL_0775
FT                   N-acyl-D-amino acid deacylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78232"
FT                   /db_xref="GOA:A0A0H2XVH9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVH9"
FT                   /protein_id="ABF78232.1"
FT                   /translation="MHFDVILRRGELIDGTGAARFEADLGVTGTRIAAIGDLGGATAAH
FT                   TVDASGLVVAPGFIDSHTHDDAFVLTDPDVEPKVAQGVTTVIAGNCGISLAPLLAERDV
FT                   PQPLDLLGAWQAFRFPSFRAYLDALDATPAAVNTAALIGHSTLRVRHMADLDRAANAAE
FT                   IAAMAADVREAMAAGAFGVSSGTFYPPAAAATTDELIDVCAPLRETGGVFATHLRDETD
FT                   AIIASLDEAFSIGRALDVRVVLSHHKVAGKANHGRSVETLAHIDAQRTRQPLCLDCHPY
FT                   PATSTMLRADRIHQSSRVILAWSKPHPELAGRDFHELLPLFGDSVDAAIDALRPAGAIY
FT                   FVMDEADVERIVRHELTMVGSDSLPNDMRPHPRLWGTFPRVLGEFSRERGLFPLETAVR
FT                   KMTGLTAEQFGIAERGRLAVGHYADLVVFDPVRVIDRATFASPTLRPEGIEHVFVNGQA
FT                   VLEHGRHTGTRPGRALRRDI"
FT   gene            complement(426485..427372)
FT                   /locus_tag="Bcen_3338"
FT   CDS_pept        complement(426485..427372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3338"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: pfl:PFL_2496
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78233"
FT                   /db_xref="GOA:A0A0H2XTD4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTD4"
FT                   /protein_id="ABF78233.1"
FT                   /translation="MKIENSELEAFVAVAELGTFHRAAEKLNLTQPGLSRRIQKLEQTL
FT                   GVELFQRTTRSVTLTGVGRQFLPMAREQIAQLGMMLSSIQDIAQKRYGKVRLASIPTIV
FT                   AQALPDVLRRYAAKYPHVAVQILDGNHDFVLSQVRAGIAEFGVSLHPGDDDDLLFEPLF
FT                   TDRYVLAAHNDDPLARADAVTLGELRQAKLIIGGRDSGNRLLLEMLMGQEAVRARWFYE
FT                   VEHISCVAALVAAGVGCAILPESALRAYGSPAVRAVPIASPTIERTVGIVRHRGISMSS
FT                   FAGDLQALVKASFA"
FT   gene            427980..428504
FT                   /locus_tag="Bcen_3339"
FT   CDS_pept        427980..428504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78234"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ1"
FT                   /protein_id="ABF78234.1"
FT                   /translation="MMDETAVDAVQVATTATPASPTGSAFSSHDTAVRQVVLGIISFTR
FT                   WPTTPVRLHLCVTGRPDYAGGLTDTLQAGSTVLDVQRVRSDDPSLGIACDVVYLGALSN
FT                   DARARVRAALAGHPVLTIAEHDPSCTAGGMFCLDVDGDRVSFDINLDAVARSGVRVHPN
FT                   VLNLARRPVTP"
FT   gene            428501..429769
FT                   /locus_tag="Bcen_3340"
FT   CDS_pept        428501..429769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3340"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: GGDEF domain; PFAM: GGDEF; KEGG:
FT                   bur:Bcep18194_B0644 diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78235"
FT                   /db_xref="GOA:A0A0H2XVF9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVF9"
FT                   /protein_id="ABF78235.1"
FT                   /translation="MTRAVPPIRASRPPRPTLQSVLRRAHLRLAFVAVTMAAVSLIVVA
FT                   VIALRAYAGNNLNLLARSLGYTVEAALVFGDRVAANEAIGMIAGDEDVAQVVVTDSKGQ
FT                   LFATWQLPAGNGLARLERAVADVALPGPVTVPVMHDGIIVGHVVVRGRGHQFFGFLLGG
FT                   VGGILGCLAVSVFGAYVSSKRLLRDIVSPLRALAGVAHAVRRERAFARRVEPAAIAELN
FT                   QLGDDFNALLDEFEDWQNTLRDENASLEHKATHDALTGLPNRVQFESRLALALCDATLT
FT                   GQRVAVLYLDCDRFKEINDGFGHDAGDAVLIDIASRLRTRVRETDLVARLGGDEFAVML
FT                   AAVPEAGSVCRIADEILSGMAPSIELSDGRVVATMMSAGVALYPDHALDASGLLRAADI
FT                   AMYRAKRARPGSWQLAESVAGPV"
FT   sig_peptide     428501..428662
FT                   /locus_tag="Bcen_3340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.802 at
FT                   residue 54"
FT   gene            429856..430368
FT                   /locus_tag="Bcen_3341"
FT   CDS_pept        429856..430368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3341"
FT                   /product="OmpA/MotB"
FT                   /note="PFAM: OmpA/MotB; KEGG: bur:Bcep18194_B0645 outer
FT                   membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78236"
FT                   /db_xref="GOA:A0A0H2XU82"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU82"
FT                   /protein_id="ABF78236.1"
FT                   /translation="MNHSFPVSTGRTCVGSALLLCMLLVGCQTPPPLHRGLTQTQVTAL
FT                   KSAGFQETGQGFEFGSTGPILFDFDRYNLKPDVRRIVERIGRTLRSAGINGVRVYGYSD
FT                   DEGTAAYDAELSRRRAEVVAVELVDVGLDAKRIAIVGKGKLDPVGDNRTPAGRAQNRRA
FT                   AIVVSPR"
FT   gene            430773..432893
FT                   /locus_tag="Bcen_3342"
FT   CDS_pept        430773..432893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3342"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG:
FT                   bur:Bcep18194_B0646 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78237"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVI5"
FT                   /protein_id="ABF78237.1"
FT                   /translation="MSFAPNGGIPSGLGGGAFGSLSALGGLAGPVASSVAGSLGPLAGL
FT                   AGHVDTVQRALQLAQTGFSLMEKTPGAIADAINGAANPARLTQLNRYVTLDTPLGPDVL
FT                   LVSAAVVDEHVNRLPEIHLDLLSHRHDLRPEDLIGQQVKIRFDQQARLSTLERVVAAGG
FT                   GDNDRYFDGYVASFDRAGNPGNVTQYHLTAVPWFWFLTRSTDCRIFQNKTAQDILTEIF
FT                   QEHGFSDFTFDIRTSQKPLEYVVMYQESYYNFCARLMEQEGLIWTHRYEKDKHFLVIGD
FT                   TNLLFRPIDGLATVPFAATEASEDSGIDQLHEGRRFGVGKVTFRDFNHQNPSSPLMLVE
FT                   AGPQNLKHARLDATERFEHQSLYDHGDDGNRYARFAMEAEEAQAHRYTGGGYAWRMTTA
FT                   GAVTVANHPVLENNQEYVILHVRHEAVNDYTQHSAKLPYRNSFSLLPKKIPYRAPRATP
FT                   KPVIHGTQSAIVVGPKGEEIHTNGSAVKVHFPWDRRGKKDGSDSMWVRVSQPWAGDGWG
FT                   AAAIPRIKQEVLVAFNQGDPDNPVIVGRVFNGEQGNPYHGAAGQTMGIKSQTHKGQGSN
FT                   ELLMSDVNGAQMLYMHAQKDMHTVVEDAQWTQVLKGDRTVEVGKGNHTTAIAVGNLSDV
FT                   VVQGNTLHQTPQGVHTLEAKELWIKIGGDGGTRIHMTADSIDIYKGESVIHLDDGNINI
FT                   QAARTDINPKNG"
FT   sig_peptide     430773..430850
FT                   /locus_tag="Bcen_3342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.827) with cleavage site probability 0.391 at
FT                   residue 26"
FT   gene            432922..433344
FT                   /locus_tag="Bcen_3343"
FT   CDS_pept        432922..433344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78238"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTD8"
FT                   /protein_id="ABF78238.1"
FT                   /translation="MYQMQEGTLALPVEWQDKTMNVFVSAATGTEGVSFVITRERLPWG
FT                   MKFAEYVTSEIRKVAKQVPDYAEVANEDATVSGRAAHVHEFTWTNNQALIHQRLTMVEY
FT                   GQVVLMLTFTAPGTLSDTQREQIRTVIQSLQLRDPV"
FT   gene            433352..437836
FT                   /locus_tag="Bcen_3344"
FT   CDS_pept        433352..437836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3344"
FT                   /product="PAAR"
FT                   /note="PFAM: YD repeat; KEGG: rso:RS05482 putative
FT                   rhs-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78239"
FT                   /db_xref="GOA:A0A0H2XUQ4"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028900"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ4"
FT                   /protein_id="ABF78239.1"
FT                   /translation="MSDTPNYNEPSGSAQERLDQIAGLEDGEAAKAAEQPFYEHLNYGM
FT                   LGADAGLTAVEGTAAGLGAAGTALAGGATGGAALGAGAIAAGTVMLPLAIAVGGAWALD
FT                   KVGVTGWLSKEFTQVGDALGLTIGRGDPHPACIGDRIAHSSGFMGILAGIAVGVAIGVA
FT                   VAATVATGGLAGALIVGACMAGGLTLGSALASASQSMGSNCGEIVTGSSNVYFEGKKVA
FT                   RVTDLVKCDHHSGVPQALVDGSKTVFVNGLPLVRIGHETHCSGKVNSGRNSIWIDKTTG
FT                   HYGPKNPELSATQEFLAGLLGGIVGGGVGKFAGKGLRGLREKFKPEPTRSAEQKGIKDE
FT                   NRPTCKDPVDPVSGEMLEIRTDLVIPGILPLEFKRRYRTRSDDHGLLGHRWSDNWSQQL
FT                   TFDGGRFVRFHDGAGLVIGFDAPDMALNGINLREPRYRLVGSRLEPRIFDRDTRQLRIF
FT                   APLVDGRSSRLERIEDLDGNAIVLSYDIAGRLSGMAHSDGYRLEIVCHGRDRRLERIVL
FT                   HDADGGSRTLVDYDYQNSMLTHVASFQFGQFYYAYDEHGWMTQWRDTDQTDVRYRYDTA
FT                   GRVVETGTQQGYHTGRFIYEAGRTRVIDVDGEWTYDYNDEGLVTAETDPLGHCTRSEWE
FT                   LGRLMARIDPLGRRTDYRYDERGQLTSVVESSGRMVEFDYDDEQRLTGTRLPNGGRIRL
FT                   EYDHLYRLIARTEPDGNRTAYRYGPRGELLRVVQGDRETRLDYDDRLRLTDIELPTGAR
FT                   FRRRIDVLGRLLEETSPDGHVTRYDYADGPANPRGLLSAITRPDGSVSRARYNSESLPV
FT                   EWIDPLGRTIRRTYGPFDLLTASIDAAGHATRFEYDHATRLTKVINALGETYTYRYDAA
FT                   GRLAAEIDWGGRATRYERDAVGRLLAKTLPDGGQWRYTYDASDRLVEIDAGDVKLAYRY
FT                   DASGRLASAEVQGEHVHVTRFAYDRNGRLIGEDQHGELLRHVYDADGQRSLRLTPRRET
FT                   AYAYDALGALTQVAGLTIRRDGLGREIGRQAGDFVAQQQYDALGRIRRQIAGPAVAFDA
FT                   LQADPARALEQLTRQVYHYDAAGQLERVDTGADTLTYQRDERGQIISAESLLQPSEHFR
FT                   YDAVMNIAAHGQRAPVDAHHYRRGGLPEQVGYARYQYDARGRTIEKTVEQPGFRPKTWQ
FT                   YTWDGLNRLVKVVTPERGVWAYRYDAFNRRIEKQQVGGRETVRFLWDGPMLAERWIEQR
FT                   DGTTGQVVTWHIEPGSFSPLAQETDSGIFSILTDQVGLPKAAFDEHGTTVWKGAYSLWG
FT                   KPLPARRAANDAQGAAISIDTTLRFPGQWADDETGLCYNLNRYYDPDSGQYLSCDPIGL
FT                   EGGFRTQGYVHAPDAWVDPLGLSGCEDVKEYDVVPYRPSNSPLENHHGVLDVWMAKNVP
FT                   DYGGKYPIKSPTIALSAESHAATKAAYRDWLTMKTGRPVGGKVDWEAVSNREMQALSEQ
FT                   MFDAAKVPQASRDAYYRALNQYLYTGEFDPVKF"
FT   gene            437845..438333
FT                   /locus_tag="Bcen_3345"
FT   CDS_pept        437845..438333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppu:PP4094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVG4"
FT                   /protein_id="ABF78240.1"
FT                   /translation="MRSIKEIVEIIRSDGRCQVLPASGKLPQLPHADMAYPNDMVEFYN
FT                   LCGGVILFRPGKDNISFKILPAGDVLQTNMIIVGDPCEDDISFSWYAICKTDNGDYISI
FT                   DTSKERNGRCYDSNFEVHGVVGSCPIIALSFSELLDELYKSSGADIFWKAKDYGDAYA"
FT   gene            438812..439267
FT                   /locus_tag="Bcen_3346"
FT   CDS_pept        438812..439267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU87"
FT                   /protein_id="ABF78241.1"
FT                   /translation="MSVIAVDQDIESMLRRYRDRDIDLRQLRVWLGNESARVEAQIPRG
FT                   QLQKLKRGSEAQGNGVIAQLLPACDYCLGIGSPEQFVSRQEYQQYSQRRDVAVTNGVLA
FT                   EIVPPPFDSEGQGAAGAATYYRCTRCHSIWVFVEPERAENGSWDRVI"
FT   gene            complement(439424..440077)
FT                   /locus_tag="Bcen_3347"
FT   CDS_pept        complement(439424..440077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78242"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVI9"
FT                   /protein_id="ABF78242.1"
FT                   /translation="MHITCFGSPMNCPIRLSSAAAIACALSVSAAHASGRDTLTDRSAG
FT                   ANVFRSERRAAARDDGHAARMSRRRVQFAAPAERSPFDTPDTRPLRVTSDALVAPLPAS
FT                   SGREPDFVLPPNRVALGAGGSDSLGRAVPGYEQREQNWNEYLRANGSRPAGSGGSYAPQ
FT                   RPYDAPRGPHGAPNPFDPSVPQPETRTFYDNGSGTKCTATGGAGTSRSSCDIAW"
FT   sig_peptide     complement(439976..440077)
FT                   /locus_tag="Bcen_3347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.975 at
FT                   residue 34"
FT   gene            440863..441981
FT                   /locus_tag="Bcen_3348"
FT   CDS_pept        440863..441981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3348"
FT                   /product="L-leucine-binding protein / L-isoleucine-binding
FT                   protein / L-valine-binding protein"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B0651 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78243"
FT                   /db_xref="GOA:A0A0H2XTE3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTE3"
FT                   /protein_id="ABF78243.1"
FT                   /translation="MTLSRLTSISVAAVLFAAGAAAAQAETVKIAIAGPMSGSVAQYGD
FT                   MVKAGALTAIEQINAAGGAGGNKFEVVMMDDACEPKQAVAVANKIVSQKIKYVIGHVCS
FT                   GSTIPASDIYENEGIVMVTPSATAPQLTEGKKRHFIFRTIGRDDQQGPAAAHYIINNVK
FT                   PKKVAVLHDKQSYGQGIASSVKKDLEAAKIPVVLFEGINAGDSDYSAIITKLKSQGVDF
FT                   VYFGGYHPEMGLLMRQAREQGVKATFMGPEGVGNKDVTAIAGPASEGMLVTLPADFSAD
FT                   PANAALVKAFADKKRDPNGPFQMPAYAAVKIIADSIAGAKTTDPTKVAAYMHKTTFDTP
FT                   IGKVAYDAQGDLKAFKFVVYTWHKDATKTAAK"
FT   sig_peptide     440863..440940
FT                   /locus_tag="Bcen_3348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.681 at
FT                   residue 26"
FT   gene            442132..443091
FT                   /locus_tag="Bcen_3349"
FT   CDS_pept        442132..443091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3349"
FT                   /product="L-leucine ABC transporter membrane protein /
FT                   L-valine ABC transporter membrane protein / L-isoleucine
FT                   ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B0652 ABC branched chain amino acid family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78244"
FT                   /db_xref="GOA:A0A0H2XUQ9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ9"
FT                   /protein_id="ABF78244.1"
FT                   /translation="MRPNANGSFPHMTDFFPQFAQQLVNGLTLGAIYALIAIGYSMVYG
FT                   IIGMINFAHGEIYMIGAYVGLVTLTAIGISAGYPLPLVLGAALIVSVIVTGLYGFAVER
FT                   VAYRPLRGGPRLVPLISAIGMSIFLQNYVQIGQGARDVSVPVLISGAFEIHLGGDYDVT
FT                   IPYARLLIVCVTLVLMIALTLFISHSRMGRACRACAEDMKMANLLGIDTNRVISFTFVL
FT                   GAMLAAVGGVLIGLTIGKLNPYIGFVAGIKAFTAAVLGGIGSIPGAMLGGVLLGLAETF
FT                   AAGYMPAEYKDVVAFGLLVLILLFRPTGLLGKSDIEKV"
FT   gene            443103..444374
FT                   /locus_tag="Bcen_3350"
FT   CDS_pept        443103..444374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3350"
FT                   /product="L-isoleucine ABC transporter membrane protein /
FT                   L-leucine ABC transporter membrane protein / L-valine ABC
FT                   transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B0653 ABC branched chain amino acid family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78245"
FT                   /db_xref="GOA:A0A0H2XVG9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVG9"
FT                   /protein_id="ABF78245.1"
FT                   /translation="MSQVISVRRPAADASFGQALKNAVAAAILTAILTIPVLGLQLKLD
FT                   GYQVVLTPHWRPVWIAVAAVFLFQLFKPWLMRAKAAVKLPAAPTMGAQQQRVIIWVLLA
FT                   VGLVWPFFGSRGAVDVATLALIYVILGLGLNIVVGFAGLLDLGYVGFYAVGGYTYAMLN
FT                   QYFGLSFWECLPIAAIAAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLLANNLTSLT
FT                   GGPDGISSIPKPTVFGFEMARSASVEGAKTFHELIGLEYSGEHMVIFLYLIALLLVGFT
FT                   LFVTSRLIRMPMGRAWEALRDDEIACRSLGLNPTRIKLSAFTLGAAFAGIGGAFFAARQ
FT                   GLVNPESFTFIESALILAIVVLGGMGSQLGVILAAILLTVLPEVARGFAEYRMLIFGLV
FT                   MVLMMMWRPQGLLPASRPHVELPQ"
FT   gene            444371..445144
FT                   /locus_tag="Bcen_3351"
FT   CDS_pept        444371..445144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3351"
FT                   /product="L-leucine ABC transporter ATP-binding protein /
FT                   L-valine ABC transporter ATP-binding protein / L-isoleucine
FT                   ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0654 ABC branched chain amino acid family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78246"
FT                   /db_xref="GOA:A0A0H2XU92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU92"
FT                   /protein_id="ABF78246.1"
FT                   /translation="MSANAELLKVAGLQMRFGGLLAVDGIDFDVRRDEVFAIIGPNGAG
FT                   KTTVFNCVGGFYKPTGGDVVLDGHAIAGLPSHKIALKGLVRTFQNIRLFKSLTVVENLL
FT                   VAQHRKVKAGLLHGLFATPAYRHAEKEALERAAVWLDRMGLTAVANRPAGTLSYGHQRR
FT                   LEIARCMITEPRLLMLDEPAAGLNPQEKIELQHLIDKLRREFGVSVLLIEHDMSLVMGV
FT                   SDRILVMEHGRPIVIGTPEAVRNDPRVIKAYLGEE"
FT   gene            445144..445845
FT                   /locus_tag="Bcen_3352"
FT   CDS_pept        445144..445845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3352"
FT                   /product="L-leucine ABC transporter ATP-binding protein /
FT                   L-isoleucine ABC transporter ATP-binding protein / L-valine
FT                   ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0655 ABC branched chain amino acid family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78247"
FT                   /db_xref="GOA:A0A0H2XVJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVJ4"
FT                   /protein_id="ABF78247.1"
FT                   /translation="MLKLEQVHTHYGAVEALAGVSIEVNKGEIVTLIGSNGAGKTMLMM
FT                   TVCGTPRASSGRVLFEGNDITAMSTHQIMRQGMAISPEGRRVFPSLTVLENLKMGGFFA
FT                   SRHEIDDGIEHVFKLFPRLKERATQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPTLG
FT                   LAPLVIAQIFDIIRTIRDEGVTVFLVEQNANKALGVADRGYVLETGRVVLADTGANLLA
FT                   NDRIKQAYLGG"
FT   gene            complement(445939..446790)
FT                   /locus_tag="Bcen_3353"
FT   CDS_pept        complement(445939..446790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3353"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0656 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78248"
FT                   /db_xref="GOA:A0A0H2XTE8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTE8"
FT                   /protein_id="ABF78248.1"
FT                   /translation="MPRTLDVDLLRTFHAVAKLGRFKDAAVHVNRSPSSVTAQIQKLEE
FT                   MVAQRLFTRNNQAVELTQFGHKLLSDTTEFLLSHDRLVESLSPQMLTGKLRLGIPDSYA
FT                   AHFMAEFLPRFAADRPLLELTVEARSSEELQQLFARGQLDITIAVVPKALPHAELLSKT
FT                   HPVWVAARTFKFNPDAPLPIAVQLQGCPYRDTALNALKKAKIAHRMLLESASSPAVEAC
FT                   IANGLAVGLIEHDRVSGNLTSHVAGIVLPDLPPHLITVLTDDSNRAALHLRDVLKSTFR
FT                   IG"
FT   gene            446923..447903
FT                   /locus_tag="Bcen_3354"
FT   CDS_pept        446923..447903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR2"
FT                   /protein_id="ABF78249.1"
FT                   /translation="MSINDFVVDALVRDRKLKAESVWTVENHEKYSTLHRTGDDARRRE
FT                   AGREVFALMRNLNELGVRSPALCADRDGKGSLREAIGALSERLATLSRGRHVHYIELGP
FT                   EPVKTTELMKAVSGGGPDHLRYTAVDINESSEDAMRHAIMPFLKTPGCFNYIADDYRNV
FT                   QWNHIDLGQDVTFITMLGFQEGNELPVTIGRLIRNLGGKSTYVVSEMQLLVEGREEPIY
FT                   DFYQNENMVRFSEIVSRQQGFEPLGKHHVSIVRLNLLGDQFHVAVTLQPVSKAGADGHL
FT                   ITNVCLKYTPEQFRHVRLSHGNCRVIDELHSGDGSVVYQIAQYKG"
FT   gene            447933..448919
FT                   /locus_tag="Bcen_3355"
FT   CDS_pept        447933..448919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78250"
FT                   /db_xref="GOA:A0A0H2XVH3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVH3"
FT                   /protein_id="ABF78250.1"
FT                   /translation="MNKGHALPVFARGFGRVTLALRTSLSVGANVGGTLDASTEPMRWS
FT                   GACLRDGYEVRYRRNLDDLGYRDVPMRGTRSDALNAVCHLRRLFSDEAVDALREIGRAL
FT                   ERSASSSNWIISKRVRAVTNRSRFIDDMMHDRAFLLRVSRLAGVPLIPYPMANARSQFN
FT                   YYYPTDQRDGKAQLGMWHTDGTSFVLNIVLSDRADYAGGNFLFYESRAETFDRHDPERR
FT                   HVRTANLDHAGDALLIYGSKLFHGVEPVEAGRRMSLVLSFHCPYTREDDNGFWHLASDD
FT                   GIARTAVNWLALRRALRDDAELQYRRLGLEPIRPDDLGDQRLASATF"
FT   gene            448933..449856
FT                   /locus_tag="Bcen_3356"
FT   CDS_pept        448933..449856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3356"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B0659 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78251"
FT                   /db_xref="GOA:A0A0H2XU98"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU98"
FT                   /protein_id="ABF78251.1"
FT                   /translation="MQLFLLQLVFVLSWSSGFIGAKLGAETAGAFNLLFWRFLLVTLCL
FT                   AIVLNRQLGRLTLEKICYHAVIGFLSQFLYLACVYVAIQHGLPPGIAAIVAALQPLITA
FT                   AMTSFGGSERSGARQWAGLVVGFVGVGIVIGGQYALPAGSVGIVMYLLPLVSAFGLSIA
FT                   TIYQRRRALTAARSNEDGLFLPLFVQGGVSLVLFAACGIVTGDLHVPTQPNVWVSVVWL
FT                   TVFSTFIAYLSLWALLKRMPATRVATLVYLEPPVTLLWAAWMFGDRIAVTTYVGIVVVA
FT                   VGVWLAGKPGARPARPRCADLETAGR"
FT   gene            449922..450272
FT                   /locus_tag="Bcen_3357"
FT   CDS_pept        449922..450272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3357"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B0660
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78252"
FT                   /db_xref="GOA:A0A0H2XVJ9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVJ9"
FT                   /protein_id="ABF78252.1"
FT                   /translation="MKVKRIVANVDTRSIDDAKRFYQRIFGLDLLMDHGWIATYGNAEQ
FT                   MDVQISFASHGGSGTPTPDLSIEVDDVDEALARVRAAGISVEYGPADEPWGVRRFYVRD
FT                   PFGKLVNVLAHR"
FT   gene            complement(450303..450710)
FT                   /locus_tag="Bcen_3358"
FT   CDS_pept        complement(450303..450710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78253"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTF0"
FT                   /protein_id="ABF78253.1"
FT                   /translation="MFDTKVALIVRDDLAAWQKLNVVAFLATGVAAGAPDALGEPYEDA
FT                   AGRRYSRMRGQPMLVFAADLNGLQAAHRQALSRELTIVPYVRAMFSTGHDAANRAAFRA
FT                   EDADNPDLVGLALHGPKKAVDKAVKGLALHA"
FT   gene            complement(450755..451612)
FT                   /locus_tag="Bcen_3359"
FT   CDS_pept        complement(450755..451612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3359"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   pfo:Pfl_2388 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78254"
FT                   /db_xref="GOA:A0A0H2XUR4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR4"
FT                   /protein_id="ABF78254.1"
FT                   /translation="MTTDAKAVGTTDHWLVARRDAETGIESLHAHFNGHAYDAHDHDDM
FT                   LVGFTEQGVQRFQCHRSLHTSVPGRAILIEPGAMHDGHAPEAGGFTYGMLYLPQAWVER
FT                   AARRLDLPGLGSVEATFGHTLVDDRGLVDAIRNAFFAIHDNEGRLARDQTLDRLLIRLG
FT                   SQLGGPLALESGVVPPAIARVRDLLHAHMDGNLGLDELASVAGIDRFRLTRMFQRAFGT
FT                   SPHAYLVRLRLRAARKLLAAGRTPAQAAADVGFADQSHLGRWFRRAYRITPAAYRQLCT
FT                   NVPD"
FT   gene            complement(451686..452663)
FT                   /locus_tag="Bcen_3360"
FT   CDS_pept        complement(451686..452663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3360"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0661 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78255"
FT                   /db_xref="GOA:A0A0H2XVI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVI0"
FT                   /protein_id="ABF78255.1"
FT                   /translation="MAGTVFATIDNPLFFCESPTMIDPLTEVVTLLQPGARYSKYVRGA
FT                   SPWAISRTVAGEPFYCAVLDGGCRIAIDGHAPIELLAGDFMLIPAAYGVAMSSLEPPPP
FT                   GVDTAPPVMLDHGEYRIGDPANPVDTRMMAGNCSFGSPDAALLVSLLPRFVHVRGEPRL
FT                   TTLVQLVRDESRAQRPAREIVLARLLEVLLIEAMRFTTGTHASPGLVRGLADSRLAAAL
FT                   RRMHERPAHPWTIVELAKEAALSRSTFFERFSRAVGVAPMEYLLTWRMALAKDLLRRNE
FT                   GRIAEIAARVGYSSASTFSVAFARHVGRPPAQYARDEQAMVSES"
FT   gene            452705..453454
FT                   /locus_tag="Bcen_3361"
FT   CDS_pept        452705..453454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3361"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_B0662 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78256"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUA2"
FT                   /protein_id="ABF78256.1"
FT                   /translation="MKTVLITGCSSGFGLEIARHFLARDWQVVATMRKPNDDVLPPSER
FT                   LRVLPLDVTNADSIRAAIDAAGPIDVLVNNAGVGAAAPAELLPLDTVRALFDTNTIGTI
FT                   AVTQVVLPQFRARGAGVVVNVTSSVTLKALPLVSAYRASKAAVNAYTESMAAELEPFGV
FT                   RAHLVLPGRAPDTRFSDNARANMHGFEHEAYADFVGKAVARMLDASGPITHAQDVAEAV
FT                   WRAATDPSSPMRMPAGADAQAWAAEAG"
FT   gene            complement(453528..454829)
FT                   /locus_tag="Bcen_3362"
FT   CDS_pept        complement(453528..454829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3362"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bur:Bcep18194_B0665 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78257"
FT                   /db_xref="GOA:A0A0H2XVK5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVK5"
FT                   /protein_id="ABF78257.1"
FT                   /translation="MSLNDDATFWRNARQHLVRYGGTFEPMIVERAKGSFVYDADGRAI
FT                   LDFTSGQMSAVLGHSHPEIVSVIGEYAGKLDHLFSGMLSRPVVELATRLADLTPAGLDR
FT                   ALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVG
FT                   SFAIPAPFTYRPRFERNGAYDPLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELP
FT                   NGYMAALKRKCEERGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLA
FT                   AMVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANTMGERLRRG
FT                   LLDLMERFDCIGDVRGRGLLLGVEIVKDRRTKEPADGLGAKITRECMKLGLSMNIVQLP
FT                   GMGGVFRIAPPLTVSDEEIDLGLSLLEQAIERAL"
FT   gene            454908..455792
FT                   /locus_tag="Bcen_3363"
FT   CDS_pept        454908..455792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3363"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0666 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78258"
FT                   /db_xref="GOA:A0A0H2XTF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTF4"
FT                   /protein_id="ABF78258.1"
FT                   /translation="MQARKGANTLALSLEIDLLRSFVVIAEVRALSRAAARVGRTQSAL
FT                   SQQMKRLEEVVDQPLFQRTGRGVVLTQPGERLLVHAQRILRLHDEAMADLCGTGLSGTI
FT                   RFGCPDDYAQVWLPSLLRQFSSQHPQAIVEVVCGPTPRLVEQLEKRAVDLAMISVPDDG
FT                   ATDDVIRREPLVWIGYPGLAPAHFDPLPLALSDRDTLDHLAACDALNRVGRDYRVAYAS
FT                   SSLAGLIALVRSGQAFAVMTQTAVPADLAIVNGDPRLPPLPAVGITLRFDRKRPSHLTA
FT                   AFADHIRQTLPLL"
FT   gene            complement(455806..457236)
FT                   /locus_tag="Bcen_3364"
FT   CDS_pept        complement(455806..457236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3364"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthases; PFAM: Anthranilate
FT                   synthase component I and chorismate binding protein; KEGG:
FT                   bur:Bcep18194_B0667 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78259"
FT                   /db_xref="GOA:A0A0H2XUR8"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR8"
FT                   /protein_id="ABF78259.1"
FT                   /translation="MNAGLPLLHDTFARAARAAATGTPTLASVSVPLRPLDFFDLIAAW
FT                   DDGVTPWCFHEAGDASVTLYGWDCAVELSATGDTRFAQIDARWRTLVSDAITAGPQPPR
FT                   LVGGFRFDSRGPRSAHWASFPDASMTLAKLLIVREGDAHWAVCQQVVAAHDDPTALAHA
FT                   CLARIESLGTLAPAAEDDAPHLLHTQALQAGEWQHEVRRAVDAIHDGAFGKVVLARDVL
FT                   EQYARPVAIAPLLRRLRRRDAHAHLFAVRRDGACFVGATPERLARVAAGDVRTHALAGT
FT                   IRRGATPDDDRALGAALMASAKERLEHALVVDAIRAALAPLSRALDVPDQPSLHRLPKL
FT                   QHLSTPIRATLNADATLLQVVAALHPTPAVAGHPRAPALDHIRAYEGFDRGWYAAPIGW
FT                   IDAHGNGDFIVALRSALIAGGACRLFAGCGIVADSEPVNEYQETELKLSGMQAAIRVRD
FT                   AAAERPGHTQASASSMVD"
FT   gene            complement(457233..457538)
FT                   /locus_tag="Bcen_3365"
FT   CDS_pept        complement(457233..457538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3365"
FT                   /product="Isochorismate pyruvate-lyase involved in
FT                   salicylic acid biosynthesis"
FT                   /note="TIGRFAM: Isochorismate pyruvate-lyase involved in
FT                   salicylic acid biosynthesis; PFAM: Chorismate mutase; KEGG:
FT                   bur:Bcep18194_B0668 isochorismate pyruvate-lyase involved
FT                   in salicylic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78260"
FT                   /db_xref="GOA:A0A0H2XVI4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008241"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVI4"
FT                   /protein_id="ABF78260.1"
FT                   /translation="MKTPDACTGLPDIREAIDRLDADIIDALGRRMQYVLAASRFKPNE
FT                   ASIAAPERVAAMLPDRRRWAEQAGLDADYVETLFAQLIAWYIAQQTQYWRQQRGLA"
FT   gene            complement(457535..458308)
FT                   /locus_tag="Bcen_3366"
FT   CDS_pept        complement(457535..458308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3366"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: bur:Bcep18194_B0669
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78261"
FT                   /db_xref="GOA:A0A0H2XUA7"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUA7"
FT                   /protein_id="ABF78261.1"
FT                   /translation="MSTHPTGSSWIRELRLSPCPRAQLVCFAHAGGTANFFRGWSRALP
FT                   WDVDLLALQYPGREERFGEPCLPSIDALAGPAADALQRYAHAPLVLFGHSLGAALAYEV
FT                   AVRLEARGAAPLYVAVSALPPPHRQRPSDLHLQSDDALVGDVARLSGEHAALLADPEMR
FT                   AIYLPMIRHDYRAIETYRRDRPPRIDAPLGVMLPLADPELDSDEAHAWQDVAARPIRVE
FT                   TFNGDHFYLRHQYPAVIAHLVERIDQSLRYGKEYT"
FT   gene            complement(458305..459957)
FT                   /locus_tag="Bcen_3367"
FT   CDS_pept        complement(458305..459957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3367"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bur:Bcep18194_B0670 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78262"
FT                   /db_xref="GOA:A0A0H2XVL0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVL0"
FT                   /protein_id="ABF78262.1"
FT                   /translation="MQSSPSSLAAAVPADAPDWPDDFARRYRDAGYWQDTTFFDALDAC
FT                   AERHPDALAVVDGTLRLRYRDLLARIRRLAGGLARLGLVRGDAVVVQLPNGARFIETCF
FT                   ALFQLGVRPVLALPAHRHYEIGAFCRFAGARAYLGASQLGDFDCRPLAAALQADCPTLE
FT                   HIVMAGDDHAFTSFDALYDAPPVLHCSARADDIACFQLSGDTTGTPKLIPRRHREYLYN
FT                   VRACSAASGFDADTVYLAALPMAHNFTLCCPGTIGALLAGGRVVTTARPEPDQSFALIT
FT                   QERVTHTALVPPLALLWLDEQPQRQTDLSSLRVLQVGGARLMDHAAERVTPVLGCRLQQ
FT                   VFGMAEGLICCTRLDDAPERIAHTQGRPVSEGDEVRIVDESGAPAAAGEIGELQVRGPY
FT                   TIRGYYRLAEHDATAFTADGFYRSGDRVRRTADGDLVVEGRDKDQINRGGEKVSAEEVE
FT                   NLLLAHPQVHDAAVVAMPDPILGERTCAFVVARAPAPSRLVLKRYLRDRGLAAFKIPDR
FT                   IEFMPRFPETGIGKTSKKSLRDLLRRQLEAAVA"
FT   gene            460175..461116
FT                   /locus_tag="Bcen_3368"
FT   CDS_pept        460175..461116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3368"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0671 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78263"
FT                   /db_xref="GOA:A0A0H2XTF8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTF8"
FT                   /protein_id="ABF78263.1"
FT                   /translation="MRSTSFASSRRHPPVLVPGNHPGVVHIDAGMKLMSGTLCSDSRDW
FT                   YEEPLEKGLKLVLVQSGQLRCRVPGQPEQCIKGPGLCVIANDGEFTTHQIYDRDVPLRY
FT                   TIVQLGLDALDRNLSLLPEKMLAPTGGDPRIVSCPASKALQALAVQIATCPFEGAVREY
FT                   YLKAKAFELTALSAQLLATQRQHAPADVRVTSSDVERVYAASDILTRELQHPPTLDALA
FT                   SRVGMNSRKLTAGFRKVFGTSVYAYLQEYRLRTAHAMLCAEDANVSTVAYRVGYSPAHF
FT                   SIAFRKRYGISPSDIRVSSNAIDNEELAGAAI"
FT   gene            461240..465613
FT                   /locus_tag="Bcen_3369"
FT   CDS_pept        461240..465613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3369"
FT                   /product="Amino acid adenylation"
FT                   /note="TIGRFAM: Amino acid adenylation; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: bur:Bcep18194_B0672
FT                   non-ribosomal peptide synthetase modules"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78264"
FT                   /db_xref="GOA:A0A0H2XUS1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUS1"
FT                   /protein_id="ABF78264.1"
FT                   /translation="MSQTVVDSTTDHSDPSCCSPTEFRARLVALIAELLDESVDEIASL
FT                   DDDEDLLSCGLDSIRLMYLQTRVNRLGHALTFDALARTPTLGAWTALLANAPRVARADA
FT                   VGAAEEVDVHAPFELSAVQQAYWLGRGDGEVLGNVSCHAFLEFRSRAIDPVRLDTACRR
FT                   VRERHPMLRARFDGGRQQILAESDAPVFAHADWRDRTAADAETEWASLRAFRSHECLDV
FT                   EHAQVFMMGLVQMPGGEDRVWLSVDLLAADVDSVRLLMQEIGVAYAEPSALPAAPSTWF
FT                   PAWLARRAAETRDARAAARDAWQARLATLPEGPALPLARAPETIRSPRFSRVAHKLSTD
FT                   ELTRLQARAAQHGITLSSVFGAAFAAVLARWSGRPAFLLNVPLFDRHGDAPDLGRVIAD
FT                   FTTLLLVECDVRADASAADAVRAFQQRLHGAIAQAAYPALDVLRDARRQGTPRAAPVVF
FT                   SCNLGDESFVPDAFAQVFGDLHDMISQTPQVWLDHQLYRVPGGALLAWDSVDGLFPDGM
FT                   IDAMFGAYVAFVQALCDRDWRLPIAVELPSAQRRVRDTLNALPAPGRARTLHHDFFALA
FT                   AREPAAVAVRCGDRAVTRGELAAQALAIAGGLRAAGIGHGDAVEISLPRGPEQVAAVFG
FT                   VLAAGACYVPLDIAQPVARKALIERAAGVKAVIGDTACAGGPLPHVGIAALSRHAPLAA
FT                   PLEVAPQATAYVIYTSGSTGVPKGVEMTHAAAINTIDAIDALLGMRADDRLLAVSALDF
FT                   DLSVYDLFGALGAGAQLVLPTQDEARDAARWIELIAQHRVTLWNSAPALLEMALAVPAA
FT                   SGACRSVRAALLSGDWIALDLPARLRARCGDACAFHALGGATEAGIWSNVQTVRDVPPH
FT                   WRSIPYGRPLPGQAYRVVDGDGRDVPDYVPGELLIGGDSLARGYRNDPELTAQRFVQHA
FT                   SGRWYRTGDRGRYWPDGTLEFLGREDRQVKVRGHRIELGEIEAALAAHPLIDGACASVV
FT                   HGEAARIVAAFVPNDCAAADTAPASLATADMADTMPAEAAVAHAVAGRLLDGDAGLPPS
FT                   LRAHWHAPRDASIALVDALGHLAWQATDLDDLTAALRALAADPDTAAQRVLLDPCVAPL
FT                   AFATRLPDGVRALREFAAALDAQAAAHTGALRVAVLDARAGQALDAGLGVLDDPRFDVT
FT                   LFDVSPGLLHNAQARFTRTMPALQAMQDGLLPARHLGAFDCVISFAAAHLRDDPRDTFR
FT                   IAAALLARDGRLLLADVLRDSPLRELVASVAGDASLPRPFAHDALAAAAHACGFALDAR
FT                   SWRSAAFACIDARRVGEPIEQAALADWLRDRLPDAMRPDALWCVLRWPLNANGKLDRRA
FT                   VGDALARALGDAPAAHDAFVPAGERHAILLACWEQALGRAANARDATFFALGGDSLLAT
FT                   RLLAQLRERLGVRIGMAAFYRQPTLAGLAAQLDELTPAAPADGDASVATIEEGVL"
FT   gene            465610..471087
FT                   /locus_tag="Bcen_3370"
FT   CDS_pept        465610..471087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3370"
FT                   /product="Amino acid adenylation"
FT                   /note="TIGRFAM: Amino acid adenylation; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: bur:Bcep18194_B0673
FT                   non-ribosomal peptide synthetase modules"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78265"
FT                   /db_xref="GOA:A0A0H2XVJ0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041464"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVJ0"
FT                   /protein_id="ABF78265.1"
FT                   /translation="MNFDDVLDLCRERQIELWCDDGGQLRYRAPAGALDADLAARIKAE
FT                   RDAFVRFLQGGAWRSDPAHQYERFALTPVQAAYVLGRHESFEFGGSACHLYVEYDEPKD
FT                   LDCVRFEAAWNACVARHPMLRAIVEDNAWQRVLPDVPWQPLTVHDLREADANAFDAHLN
FT                   RVRERLDHAVHALDRWPVLQPEVSLGPDGAVLHLSVDFTLIDYASLQLLLAEWRRRYDD
FT                   PQWQPAPLDATFRDYVLHEAQAETRAEHARDKAWWLARLDDLPARPDLPVVPAMRTDGR
FT                   PRFTHRHARLDRAQWAALSGHASRFGLSAASVALAAFAEVVGRWSQTPAFCLNLTVLNR
FT                   PPVHPRIDAVLGDFTALSLLAVDATHGRDFVERARTIGARMFDDLDHRAFTGVDVMREL
FT                   ARRRGKDAALMPVVFTSGIGSVGRLLGEQATRAEPPRTMISQTPQVWLDCQVTDQFGGL
FT                   EIGWDVRDDLFPDGMPAAMFDAYVALLGRLADDAEWWSRDGDIVLPSATPVADAHPDAD
FT                   THIAAGFAAQALRTPDAPVVIDALGARTYREVAQQAAALRTALEQAGVGVGDTVAVLMP
FT                   KCAHQLAAVLAIVQAAAAYVPVDSRQPALRQQAILRNARVRAVVSVQALAFENEGCVRI
FT                   DIDALPRDPQWPPRAACDIAPDALAYVIYTSGSTGEPKGVMLSHAAVCNTLADISARHA
FT                   VGAGDVVLGLAELSFDLSVYDFFGATARGACIVLPDPARGNDPSHWAELMARHRVTLWN
FT                   SVPAQGQMLIDYLEGEPALDVPGPRRVLWSGDWIPVTLPARWWQRWPDSALFSLGGATE
FT                   ASIWSIEHPIRPEDTQLASIPYGRALTGQTMEVLDALGRPCPPGVRGEIHIGGVGLATG
FT                   YANDPVRTAERFIRHADGRRLYRTGDLGRVRADGSLEFLGRQDDQVKIRGYRIELAEVD
FT                   AALTAHPLVGAAATIVLGEGAERRLASFVSLQSAEAPASARDDALRDLTTQVRTAFDTA
FT                   RWPAQVDVARSVAQLETACVASLAAWIVPAGGLTTDASTGFATLCERLRVPAARRHLLR
FT                   HWLAMLVAHGVLEADAEDGWRMRPRASLADAHACWDAFAQHASPELWPAVLVDYFRTSA
FT                   GCLDAQISGSVSPAGLMFPEGASHIAEAMYSDGEHARALHRGMAQAVRAVVAREPQRSW
FT                   RILEIGAGTAAATRAIVDALAPLVEAGTRIDYLFSDVSSYFLAAARERFAAYPWMRFVR
FT                   FDMNAPCDAQGIAPHSVDLTISSGALNNARDTVALIAGLRALSAADAWWVIQELTAEHP
FT                   EISISQGLMMETPDDARAASARLFVPHAQWLEWLQAEAGDRALGCVAPDTPLAALGYDI
FT                   LLAHVKRGAARIAPDTLLSFVAERVPNYMVPSQLRVLERLPVTANGKIDRRTLAGIADI
FT                   REPAPAVVRAVPAQAADPLLARLIGLWETVLDTRNVSPDQDFFAAGGDSLLIAQLVSRL
FT                   RGEEPLAHAHPFDRLLRWVLAQPTPAAFAQCLRDASEQPASATPTAAPAASRTLPASAV
FT                   VHAPAPRVRAGVRPIPLAPGDGVPRVIVHEGLGTVHAYRPVLPALARLGPVLGFAVRDA
FT                   QDYLDLPVRHLNATLGRRYADALWRNGVREVDVLGYCSGGLIALEMAKSLVQLGVAVRT
FT                   LDIVSSYRIPYLIEDERLVLFNFAATLGLPLDALGFPETYVLADALADALKADPTRLAP
FT                   GSLQAQLEIFGDRCEPLDGLRRRVLRAAAGLSLQDALAHPLLDERERLYRLFMHSVQAS
FT                   HWAGDAPYAGALRLFVPERCNPLIPQQRAALTDYWTAQALGGITAVDIPGGHFDCLNAA
FT                   FVDTRLKEAR"
FT   gene            471084..472136
FT                   /locus_tag="Bcen_3371"
FT   CDS_pept        471084..472136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3371"
FT                   /product="Thiazolinyl imide reductase"
FT                   /note="TIGRFAM: Thiazolinyl imide reductase; PFAM:
FT                   oxidoreductase-like; KEGG: bur:Bcep18194_B0674 thiazolinyl
FT                   imide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78266"
FT                   /db_xref="GOA:A0A0H2XUB4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR010091"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUB4"
FT                   /protein_id="ABF78266.1"
FT                   /translation="MKVHPLPVVVAGSRFGQFYAAGLAASGSYHVAGILGQGSARTAAL
FT                   AARVGAPVFDRVDALPDDVRIACVAVGGAARGAQGAALACRLLERGIDVVIEHPLLPDE
FT                   WASVLRTASRHGRRCLLNSFYPNLPVVARFIAVARRLRETSAPVHADVVCSVQASYAAL
FT                   DVLAAALQGVGPWSVEPIGPALSSMRECAMVLAETPVSLRVHNEMAAADDGRMSVLFGI
FT                   TLTTDAGTWTLASPHGPLWWAPALREPALDEDGLFPIFGEAAGDDLPSIQICDDAQETW
FT                   GEIHARCWPQAAVRAVDRLVSGEGLHACNQRSIDVARVWQQLTAQLGFPAQPPGDARAA
FT                   TLGMLLERAA"
FT   gene            472133..473857
FT                   /locus_tag="Bcen_3372"
FT   CDS_pept        472133..473857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3372"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0675 ABC efflux pump, fused inner membrane
FT                   and ATPase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78267"
FT                   /db_xref="GOA:A0A0H2XVL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVL6"
FT                   /protein_id="ABF78267.1"
FT                   /translation="MKGPLLSMLRPFAVPLVAAVALQALAGVASLVPWLALAHFADAWR
FT                   VAPQLDAAARGWLVAAVAAGAFWLGGQTVALHLTHRVDADLGDRLRKRLADHLQRLPLG
FT                   WFARAGSDRVARHVDQDVRALHQLVAHAPADLTQLVVVPCAALACLLYLNPVLLAFALV
FT                   PLVAGAALFRWMRSARFAPAFAARNAALERLMGDYAQLAQNPALVRQYPGAGIEAAALA
FT                   SAGHFSHAFAAWVGRIGGLGACTQVLLGTPFLLAWVVCGATWLTAGQLPVGTLCAFALL
FT                   IWAIAAPVRALGHGADALRDAHAAAARLDALLVQPGLQEPADGAAQAPRDASIELRGVQ
FT                   VDIDGEPILRDLDATIAAGTTTAIVGPSGAGKSTLLMLLARFMDPDRGTVRLGGADLRL
FT                   LASDTRREQVAMVFQQATALDDVSIAANIALYRPDADRDAIRAAARAACLDERIDALPG
FT                   GYDCVCGRDVRLSGGELQRLSIARALLSRAPLLLLDEPASALDPQTGRALRNALRADMR
FT                   TRVIVSHDLDAIRHADQILVMERGRIVERGTHAALLAAHGLYARLWRERSAAGGEAA"
FT   sig_peptide     472133..472213
FT                   /locus_tag="Bcen_3372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.949 at
FT                   residue 27"
FT   gene            473854..475620
FT                   /locus_tag="Bcen_3373"
FT   CDS_pept        473854..475620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3373"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0676 ABC efflux pump, fused inner membrane
FT                   and ATPase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78268"
FT                   /db_xref="GOA:A0A0H2XTG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTG5"
FT                   /protein_id="ABF78268.1"
FT                   /translation="MMTTSLKRLQCLPSDTRRALLRGLGWAVAAALLDGACGLLLVPLI
FT                   RAWFAGAQAAALRWTAVLGVLTLCHALVLYVAQRRGYRAGGALAVGLVERLVHHLPRIA
FT                   SWQAVRDSHRAGLLRGPVMQAMGIPAHLLGPLIGAVVTPLAVVAGLAWIDWRIALCLAA
FT                   AAVLLFALLERGGARTLAFEQARAAGDRDMAVQLQTFAAHQGLLRFAGRDGDARAALQR
FT                   AFDEQHRRTRALMRRSLPIELGFAGAVQGVFVAMLIGGAWAVAAGRLDAATAVAVLVLL
FT                   VRFIEPLAQLTQLDQALRGGWRALDTVLAVLHAPLFDSPERGTPVHDASVDALRVGYRS
FT                   AGGATLLDGIDLHCPAGGFVAIVGPTGAGKSTLLGLLARLDDPCAGRVLLGRADVRHLS
FT                   EATLAATRNLVFQDNGLFRGSLAWNVRMGRPDATDAELRAALDAVGLLRDAERLPDGLD
FT                   TDVGPGGQLLSGGQRQRACLARALLARAPVLMFDEPTASLDELSARRVRDSLVALRGQR
FT                   TRIVVTHQPALAAAADTIVVLDAGRVRATGTHAQLIETDAWYATFSRAGRPPDGAPPAG
FT                   ADAETRPAESEQ"
FT   gene            475734..477950
FT                   /locus_tag="Bcen_3374"
FT   CDS_pept        475734..477950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3374"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; KEGG: bur:Bcep18194_B0677
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78269"
FT                   /db_xref="GOA:A0A0H2XUS6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUS6"
FT                   /protein_id="ABF78269.1"
FT                   /translation="MRYEVREPERSMMQGARVARFGRWRPSLYLGLLIAAHPAAAFADA
FT                   APAAGAEVRRDKAAAAQPAGSELKAIAVNASRGVADDPSVATVGKMPLALREIPQSVSV
FT                   TTRERIDQQNLFSLDEVMQQSAGVTVQPYVLLTTAYFVRGFKVDSFEFDGVPVVIGDMA
FT                   SAPQDISVYERVEILRGANGLLHGSGNPAATVNLVRKRPQYQFSAHATASVGSWDRYRA
FT                   EADIGGPLNAAGTVRSRLVAAYEDRHFFYDHAKQDTRSIYSVTEVDVTRDTLLTFGAQY
FT                   QTTTSVPDMSGVPMARDGSSLGLSRSTFLDTAWGRFNWDTTRAFASIEQKLGAGWKAKV
FT                   SGEYQSVRSDLKYAGSFGAIDPATGAGGRLTGAAYQFSSYSRSIDANVQGPVHAFGLTH
FT                   DLLFGVTYANSSSGQMTAPLLGDVAGTPVNVYRWNPSSVPEPGIGPYQQSQQNDVSQKG
FT                   VYGLGRIKLAEPLTLVLGGRMSWWNQDSLGAHYNTGHQFTPYGGLIWDFARDWSWYASY
FT                   AEVFQPQTKSMWGGGILTPVKGRTYETGVKGELAGGKLDVSLAAFRIDLDNNPQVDLAH
FT                   PCAGPSCYYVNGGSVRSQGFEFEANGRITPWWSVWASYTYDTMRYADNLANAGSFAPLL
FT                   NPRHLFRLWTNYDLPWQERRWSIGGGVQVQSSYSAQANGVTMSQGGYALASVRLGYRYD
FT                   KHWSAALNVNNLFDRTYYLSLSQPGWNNRYGEPRNVMLTVRGQF"
FT   sig_peptide     475734..475865
FT                   /locus_tag="Bcen_3374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.684) with cleavage site probability 0.658 at
FT                   residue 44"
FT   gene            477950..478213
FT                   /locus_tag="Bcen_3375"
FT   CDS_pept        477950..478213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78270"
FT                   /db_xref="GOA:A0A0H2XVJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVJ5"
FT                   /protein_id="ABF78270.1"
FT                   /translation="MAAGWGARAAIAIGGVLPGAVALALTLARHYPDDGLNRLYAAVLL
FT                   TLVASVAALLWVLVAPGWRQAVWRAGAWLAVLVPCAMFWGGR"
FT   sig_peptide     477950..478024
FT                   /locus_tag="Bcen_3375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.625) with cleavage site probability 0.593 at
FT                   residue 25"
FT   gene            478215..479726
FT                   /locus_tag="Bcen_3376"
FT   CDS_pept        478215..479726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3376"
FT                   /product="PepSY-associated TM helix"
FT                   /note="PFAM: PepSY-associated TM helix; KEGG:
FT                   bur:Bcep18194_B0679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78271"
FT                   /db_xref="GOA:A0A0H2XUB9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUB9"
FT                   /protein_id="ABF78271.1"
FT                   /translation="MDASSRSRWRALHRGAGALFGVVLFVVLFSGTWSLAFDSMQGWWR
FT                   PPAVAVARPTLPLDALVARAASLGVALRDARIVLPRPDDPAIRFCDARQTCTLALDSAT
FT                   GAPLPDAARATLIVTLHKTLFAGFPGRIFVSLWGVVLLVLIVAGVVVHRKRWPDAARIR
FT                   RGHGLRVALFDLHAWIGLWGTPWLVLFAFTGVLSGLGALGTVSLAGVAYPGQPQRAFAE
FT                   LLGGPSPVEAGGPWRHAPDLDALLRRDAVRRPDFRPEAVVLHRWGDVNARVEIAGTTAG
FT                   LPSTAVFERHLYRATDGQWLADATSRGRGFWLRAFIAVQPLHFAQYGWVGAAGDGLRVL
FT                   HFLMGLAACALCATGLHLWIERRRAQRDRSADVLAATAVGVCGGLVLAGGALLFAGRAL
FT                   PDGMHVDHALAMLFWAVWGGAIALAACVADRAAWLRVLMRAAGVAYGLAGATHCALALL
FT                   DAGRPVYWPIDAALVAFGALLLRAARRPRRDAMQPARVPAGAEPF"
FT   gene            479749..480996
FT                   /locus_tag="Bcen_3377"
FT   CDS_pept        479749..480996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3377"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0680 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78272"
FT                   /db_xref="GOA:A0A0H2XVM1"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR014090"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVM1"
FT                   /protein_id="ABF78272.1"
FT                   /translation="MRDLLEHRRLVITITLLYLSQGIPIGIAMDAMPTLLRHDGAPLHA
FT                   LAFLPLVGLPWVVKFLWAPVVDNRWSPRIGRRRSWMLPMQTIVVLCLASLAQIGMTVAT
FT                   AGWAVGLLAVASLASATQDIANDGMAAEHFSGDTLARINAIQIAGVMIGFFGGGAGTLT
FT                   LIGLFGQPTAFLALAAVPLASLVCVLWVLPRDADRARIRPDHDASLVRFAKRPRSWSLL
FT                   SLALLSAMTAVSGFGLSKLFLNDAGWSLDAIGKLGMAGGVVTVVLGCGGGAWLVRALGL
FT                   WRAFTAGVSCAGAAALLWFAQASGWLPVSPSWAWLCTVLGSLATGITSVSIMTAGMRFA
FT                   GGSDQAGTDVTAVQSTRDLGELIASSTILSLTAKVGYTGGFLTGVALAVLAALIAMKLR
FT                   RREAAYAMKGDDALVS"
FT   gene            complement(481073..482398)
FT                   /locus_tag="Bcen_3378"
FT   CDS_pept        complement(481073..482398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3378"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xcb:XC_0313 MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78273"
FT                   /db_xref="GOA:A0A0H2XTG9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTG9"
FT                   /protein_id="ABF78273.1"
FT                   /translation="MAAVHFIYWTYTWPCARIRVFRRTSSAFMSSASISRSMPGTQNAA
FT                   PDALPAGVSPRSAAYKRIAFALFLAGFSTFSLLYCVQPLLPAFAHEFNVGAASSSLSLS
FT                   LSTGMLAVSILCAGALSERVGRRGLMFASMTLAALFNLLAAWSPNWHLLLVWRALEGFA
FT                   LGGVPAVAMAYLAEEIAADGLGFSMGLYVGGTAFGGMIGRIGMSALEEHFSWRTAMLSI
FT                   GVVDLLAAIAFVMLLPASRRFVKRTDLTLRHHLRLWHAQLRHARLPFVFAIGFLVMGAF
FT                   VTIYNYAGFRLMAAPFNLSPTACGLIFGAYLFGMVSSSSAGALADRLGRAPVLVSGIVV
FT                   FAAGLALTLSHSLVAIVVGIVLVTIGFFVAHSVASGWVGALAGAAKGHAASLYLLAYYV
FT                   GSSVLGSVGGAFWQRGAWTSVAAYVAVLLVIALLAARRLSRA"
FT   gene            482454..483326
FT                   /locus_tag="Bcen_3379"
FT   CDS_pept        482454..483326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3379"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bmb:BruAb2_0777 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78274"
FT                   /db_xref="GOA:A0A0H2XUT1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT1"
FT                   /protein_id="ABF78274.1"
FT                   /translation="MELRHLRYFLAVAAASNFTKAAEMLGIGQPPLSQQIKALENELGV
FT                   ELFKRTARGAELTLAGEVFAEEARRVLDDAERAARAARRAARGETGHLRVGFTGTAAFN
FT                   PKVSDLIRRFREAFPDAELTLQEATSGVLLEALEAGRLDVAIVRPERRVAATLRVADWD
FT                   EEPMFVALPVAHRLAQRRRIELAELADESFVQVPRAAGGALFDDIVAACQAAGFEPRMA
FT                   QPAPQMASAVTLVAAGLGVSVVPKAITQVQVPGVVYRPFAGNRFRARLAIASRCDEPSA
FT                   VVRNFLLLA"
FT   sig_peptide     482454..482519
FT                   /locus_tag="Bcen_3379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.781) with cleavage site probability 0.779 at
FT                   residue 22"
FT   gene            complement(483401..483485)
FT                   /locus_tag="Bcen_R0076"
FT                   /note="tRNA-Leu2"
FT   tRNA            complement(483401..483485)
FT                   /locus_tag="Bcen_R0076"
FT                   /product="tRNA-Leu"
FT   gene            483629..484942
FT                   /locus_tag="Bcen_3380"
FT   CDS_pept        483629..484942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3380"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein
FT                   kinase; KEGG: bur:Bcep18194_B0691 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78275"
FT                   /db_xref="GOA:A0A0H2XVK1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVK1"
FT                   /protein_id="ABF78275.1"
FT                   /translation="MTHTLEQLQAGQLSGARQLKLACGLTEFPREIFDLADTLEVLDLT
FT                   GNALSALPDDLPRLHRLRILFASGNRFTAFPNVLGACDQLDMIGFKANSIHTVPRGALP
FT                   RALRWLILTDNAIEELPADIGDCARLQKLMLAGNQLRALPAEMAACRALELVRLSANRL
FT                   DALPDWLSRLPRLAWLAVAGNPFGAVPEAAASAGPDVAEIDWAALSCEQKLGEGASGVI
FT                   YRAQWRADGHPPRTVAVKLFKGAVTSDGLPDCEMAACLHAGGHPNLIPVIGKLRGHPDG
FT                   THGLVMELVDPALTNLAGPPSFASCTRDVYAADARFEPAQALRIAHGIASVAGHLHARG
FT                   IMHGDLYAHNILHDGAGGALLGDFGAASLYDPTERTRGARFERLEARAFGYLLGELLER
FT                   CEPHVGALDALAAACVNEDVDARPSFDEITAALAARMR"
FT   gene            complement(484958..485587)
FT                   /locus_tag="Bcen_3381"
FT   CDS_pept        complement(484958..485587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3381"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B0692 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78276"
FT                   /db_xref="GOA:A0A0H2XUC2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUC2"
FT                   /protein_id="ABF78276.1"
FT                   /translation="MSIQTWMLFAAAYLATTLSPGPNVLLVIRNTVRYGAHGTAATIAG
FT                   NLVAQGVVVLLVALGVGAVLAAMPPLFVAMKVIGAAYLIFLGVRQLRGERKTAASSGAA
FT                   EIAVPDRRKLFREALFVSGSNPKTMIFLSAFMPQFIVHDRPLALQFVVMYATIACTVVV
FT                   VHSVYSAGVRRLHRGFGMSRAVRALKRASGLLFVGLGIKLLTARQA"
FT   gene            complement(485681..485854)
FT                   /locus_tag="Bcen_3382"
FT   CDS_pept        complement(485681..485854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78277"
FT                   /db_xref="GOA:A0A0H2XVM6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVM6"
FT                   /protein_id="ABF78277.1"
FT                   /translation="MKNRLPLADLIVRYRTPLNVAVLIVCGLWAAWIAWMTRPAAIDTP
FT                   PSIPAYCMRDAR"
FT   gene            complement(485884..486330)
FT                   /locus_tag="Bcen_3383"
FT   CDS_pept        complement(485884..486330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3383"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   bur:Bcep18194_B0693 protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78278"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTH5"
FT                   /protein_id="ABF78278.1"
FT                   /translation="MMKRSIPTGLLVALALHATATFAASTIQADACWIRTMPATVPSSG
FT                   YFTLKNHGDAPATLTGIDTPAYGMAMVHETQTSGSTAKMVHVDSVVVPAHGSVTFKPKS
FT                   YHVMLEEPRQSVTPGAKVPFRLHFADGSTVSVTCDAKAPTYAGQ"
FT   sig_peptide     complement(486259..486330)
FT                   /locus_tag="Bcen_3383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            complement(486420..486785)
FT                   /locus_tag="Bcen_3384"
FT   CDS_pept        complement(486420..486785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3384"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bur:Bcep18194_B0694 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78279"
FT                   /db_xref="GOA:A0A0H2XUT7"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT7"
FT                   /protein_id="ABF78279.1"
FT                   /translation="MKTTTFVRGALAALGFVVIHAAHAHALPKTQDPAPDATLSSAPPA
FT                   VTIEFGEALEPAFSSIAVTDSHGQSVVDGKSAVDAGNRKRMHVALASLKPGTYTVAWIA
FT                   VASDGHRTHGRYAFTLK"
FT   sig_peptide     complement(486711..486785)
FT                   /locus_tag="Bcen_3384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.938 at
FT                   residue 25"
FT   gene            complement(487078..487455)
FT                   /locus_tag="Bcen_3385"
FT   CDS_pept        complement(487078..487455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78280"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVK6"
FT                   /protein_id="ABF78280.1"
FT                   /translation="MLSRRLRKIGSLIGMLAILMTALAPTISQALTTQGRVDALLAGYC
FT                   SSAPAAGTPSADTATKSLQAHLHACGYCSLLAHTPALPAPELTFAARVHAIEHRAATRF
FT                   ESLRRAQPLTAAQPRAPPFTS"
FT   sig_peptide     complement(487363..487455)
FT                   /locus_tag="Bcen_3385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT   gene            complement(487548..488042)
FT                   /locus_tag="Bcen_3386"
FT   CDS_pept        complement(487548..488042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78281"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUC7"
FT                   /protein_id="ABF78281.1"
FT                   /translation="MVQPTDRIEKQTLLAASPDRVWAAVSNSGEFGQWFGVSFDGPFEA
FT                   GQSLFGRITPTRVDDDVAKAQEPYAGTVFEIVVDRIEPKQLFSFRWHPFAIDPEFDYAS
FT                   EPMTLVTFTLAPQAGGTLLTVTETGFDQLIEARRATARDMNDQGWAAQMTLIAKYLAQP
FT                   A"
FT   gene            complement(488101..488403)
FT                   /locus_tag="Bcen_3387"
FT   CDS_pept        complement(488101..488403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3387"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: bur:Bcep18194_B0697
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78282"
FT                   /db_xref="GOA:A0A0H2XVN1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVN1"
FT                   /protein_id="ABF78282.1"
FT                   /translation="MTDPDHPPLVRIEPLGATFDAPDSLTLLEAAAFARVSLPRSCRNG
FT                   TCRSCLCRIVSGSVRYTIEWPGLSREEKADGYTLPCVAVATSDLVLDVPDAVMLD"
FT   gene            complement(488486..490399)
FT                   /locus_tag="Bcen_3388"
FT   CDS_pept        complement(488486..490399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3388"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction region; SMART:
FT                   ATPase; KEGG: bur:Bcep18194_B0698 sigma54 specific
FT                   transcriptional regulator with GAF sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78283"
FT                   /db_xref="GOA:A0A0H2XTI0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTI0"
FT                   /protein_id="ABF78283.1"
FT                   /translation="MPQPYVLPATTGRTDLLAQAHARSTAVGLRAHERPDFSPLSRIAL
FT                   RELLDTNHTLFSHARPVMEDLHAQIAETQSLVLLTDADGVILHSIGDADFIEKANRVAL
FT                   CNGVSWAEGARGTNAIGTALASGQAVVVHGAEHFLRANHILTCACAPIVDPFGRTLGTL
FT                   DVSGDPRGASPHTLALVRMSAQLIENHLFANQCGEALRLRFHAHEDCVDSLFAGLVAFG
FT                   PDGGLIAANRSAQFQLGASFDALQHQASDALFGMRFGQLAQQAARAPGATFRLTLSTGV
FT                   RVLARCEFPEAQKTTVAVTPPAPAARVRAPDPDAITFATLDTGDARMAAVLERVAKIRG
FT                   RDLPLLILGQTGTGKEWLARALHQASPRADGPFVAVNCAALPDSLIEAELFGYEDGAFT
FT                   GARKRGSPGKIAQADGGTLFLDEIGDMPLAQQVRLMRVLQERAVMPLGGARAVPVDVRV
FT                   VCATHRDLRAMIAEGTFREDLFYRINGLAVTLPALAARTDLPALVERILARLARSEPMP
FT                   RRLAADVLDAFARHRWPGNLRQMTNVLRTAGMLAEDEAEITLAHLPDDFWLDCDDAPAT
FT                   PTGDTPAVSPASPGRREGTTLQSHQAAMIDAVLARHGGNVSAAARELGLARNTVYRYLR
FT                   RH"
FT   gene            490668..490859
FT                   /locus_tag="Bcen_3389"
FT   CDS_pept        490668..490859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78284"
FT                   /db_xref="GOA:A0A0H2XUU2"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU2"
FT                   /protein_id="ABF78284.1"
FT                   /translation="MVRAELRVVLAAIATFIMLGGIAVAIHGLLFDLTDAVRYGAAAIA
FT                   VGVTTAAIALNVWPTDPH"
FT   sig_peptide     490668..490745
FT                   /locus_tag="Bcen_3389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.633) with cleavage site probability 0.501 at
FT                   residue 26"
FT   gene            491099..491386
FT                   /locus_tag="Bcen_3390"
FT   CDS_pept        491099..491386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78285"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVL3"
FT                   /protein_id="ABF78285.1"
FT                   /translation="MQIHFTNEKPEYSGRDLMLAFTALVNGERVQCQITAEALEDHFGA
FT                   ASPRFEDMVGAFDQHRERIEAAARRLLSETRAQCVTLRSGYVRFYEANWR"
FT   gene            491617..493575
FT                   /locus_tag="Bcen_3391"
FT   CDS_pept        491617..493575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3391"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat; SMART: Tetratricopeptide region;
FT                   KEGG: bur:Bcep18194_B0701 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78286"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUD2"
FT                   /protein_id="ABF78286.1"
FT                   /translation="MEHRSGWGRARRLLAGAWLLAAGMSMADGAVGSDDDAIGRRAPGE
FT                   VDIVAGDVTTGGIVVAPGRVATPCHRLAGRPAFDIASADGRRLPARLVAGNQDRDICII
FT                   EATGLDVAAVPLTARSPEAATTAYLAGARFDRRDPVALRVCCHAWAADGGVHSGLLASP
FT                   NPAPPHLPEPGAGVYDEQGNLIGMVGVRADSAESLYMVLPVEWMATVAAKMPAVDLPLE
FT                   ATAWMSQARAYAVANDVDGLIRHDLAWTAARPQSAWAWNNLGNAYRTSRLPDRGALSLA
FT                   AYRRSVENDPSYAFGWSSLGNTYAELGQMDRALDAFHAGMRADPSDTMLRMNLGIAYLR
FT                   RGDKAGARPWFERGVHELSGSRQADAWSLLASTQPDAQATIGVLHDGLKAFPDDARLWY
FT                   ALGRAQYDLGHLADAIASYQHALKAQKGGDPAATALIQGALTQAYALQGQSGDASSAMH
FT                   SAVEAAPDNAEYWLRLGALYMTQSNYVDALSALDRSLKLNDSDARAWRMHGVTLAQLGQ
FT                   HVHAVASFRRAVALDESLAAGWVVLAGELNEIGQPDEASAAAAHALKLDPSNRLAREAM
FT                   GIAANRGKRPDAAVGIFEEMNRAYPDDAQIMANLAVAYRRTGRVDDAVQLYRRVKTLDS
FT                   TLAQRLYDAELKGVATP"
FT   sig_peptide     491617..491700
FT                   /locus_tag="Bcen_3391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.936 at
FT                   residue 28"
FT   gene            complement(493663..494964)
FT                   /locus_tag="Bcen_3392"
FT   CDS_pept        complement(493663..494964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3392"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bur:Bcep18194_B0702 xanthine/uracil/vitamin C transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78287"
FT                   /db_xref="GOA:A0A0H2XVN6"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVN6"
FT                   /protein_id="ABF78287.1"
FT                   /translation="MESIKRYFGFAEAGTDFRTEILAGVTTFLTMAYIIFVNPAILGDA
FT                   GMPKESVFVATCLVAALASIIMGLYANYPIACAPGMGLNAYFAYTVVKGMGFTWQAALG
FT                   AVFISGCLFLLVTLFRVREAIVNGIPKSLRISITAGIGLFLGIISLKTSGVIVGNPATL
FT                   VTLGDLHKHETILAIVGFFTIVTLDHLRVRGAILIGIIGVTILSFFFAGNQFHGVFSAP
FT                   PSIDATLFKLDIGAALSTGIINVILVFFLVELFDATGTLMGVANRAGLLVEGKMNRLNK
FT                   ALLADSTAIVAGSVLGTSSTTAYIESASGVQAGGRTGVTAITVAVLFLACLFIAPLAGV
FT                   VPAYATAPALLYVSCLMLREMVEVPWDDATEAVPAALTALLMPFTYSIANGVAFGFIAY
FT                   GGLKLLTGQGRTVKPIVWIIAAVFLFRFFYLGSE"
FT   gene            495123..495530
FT                   /locus_tag="Bcen_3393"
FT   CDS_pept        495123..495530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTI4"
FT                   /protein_id="ABF78288.1"
FT                   /translation="MPARERSGGPPVRRRRAFYRFARHGPAEMAETMETTRGRWEKRAD
FT                   ACATARRLRCARAVHDDMRLKRSARMLHERGAGGGCACPHVCCRRGYTARQRRAAAIRQ
FT                   ARRVQGSDYRAPKPSRPQPSFRDAGATVVSV"
FT   gene            495741..496019
FT                   /locus_tag="Bcen_3394"
FT   CDS_pept        495741..496019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU8"
FT                   /protein_id="ABF78289.1"
FT                   /translation="MLNWISRWAMRHAPTPEKTAASMLVTARMELFAAEQRVIDAKLQA
FT                   DYWRTRVSFLEEVQKQGIDPWVTSQAAQRPDLDSTPRSTGPRLAAST"
FT   gene            complement(496191..496565)
FT                   /locus_tag="Bcen_3395"
FT   CDS_pept        complement(496191..496565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78290"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVL8"
FT                   /protein_id="ABF78290.1"
FT                   /translation="MDQASPLFERRDRRPAGTIALPTVVIRFAVAPRTTMTWRAPQDAE
FT                   IRAHGAALWITRPPNVDDYWVQPGDVLRIARGERIWLGTDADRSAEATITTAYVRRGER
FT                   VRRMLAQVQRLLVGIGRRSG"
FT   gene            complement(496816..497103)
FT                   /locus_tag="Bcen_3396"
FT   CDS_pept        complement(496816..497103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUD9"
FT                   /protein_id="ABF78291.1"
FT                   /translation="MAMKKTDLEKNKALKLTHAMKQSSSARFGKGADEAAKLDRRAQRK
FT                   LDQEQGLVPFACKLNAELVEQLKARAATHPEGMTGLLSELLVNGLAQRDA"
FT   gene            complement(497183..498121)
FT                   /locus_tag="Bcen_3397"
FT   CDS_pept        complement(497183..498121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3397"
FT                   /product="metal-dependent hydrolase"
FT                   /note="KEGG: bur:Bcep18194_B0708 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78292"
FT                   /db_xref="GOA:A0A0H2XVP1"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVP1"
FT                   /protein_id="ABF78292.1"
FT                   /translation="MTAHDAAQGDNMTDTADYHKIKARHVKFDFSDTPVTWVPNDPGST
FT                   HIINTLNLLFPEGELWFCRVYNKALPLITDARLRDEAEGFLRQEAVHSRSHGGVLKHYY
FT                   DRHGIDTKPFTQKLNRLFTRVLGEQPLGLKIGHTRFWLRQQLAVIASLEHFFGYLGNWV
FT                   LNAHGLDEGRADPTMVDLLRWHGAEEVEHRTVAFDIYRHMGGTYPERCVRMAFVILLLL
FT                   YYITTGAKFMYRRDPDAGRYPGFVLAWWRGSRRGHLPSFWKVIGAALRYFKPGYTPHHE
FT                   GSTEQALAYLARSPAAQAAAHGGNWGAAKGA"
FT   gene            complement(498118..499905)
FT                   /locus_tag="Bcen_3398"
FT   CDS_pept        complement(498118..499905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3398"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78293"
FT                   /db_xref="GOA:A0A0H2XTI8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTI8"
FT                   /protein_id="ABF78293.1"
FT                   /translation="MQPLSDEAPLALFESVHSETAVASGDLTLAVRTWGDPARSPVVLV
FT                   HGYPDDSSVWQHVAPLLARRHYVIAYDVRGAGLSGVPTRTADYHLAKLTDDFVAVIDAL
FT                   CPGRAVHLVAHDWGSIQGWEFVTDPRLAGRIASYTSCSGPCLDHVGFWLRERVLHPTPA
FT                   SLAKLGGQLVRSWYVYLFHLPFIPELGWRLWLGRAWPSLLRRLEKTPAAPRPTQADDGA
FT                   HGVRLYRANFIRCLFAPRERYAHAPVQTIVPLGDKYVSPALSENLSRWVPQYYRREVAA
FT                   GHWLPLADPARFAALAEQLIDAVESGDEPPALANARRRATSGRFSGKVAVVTGAGSGIG
FT                   RCAALAFAREGATIVACDIDLASAERTALLIGLTGAQAHAKRVDVGSADEMEALAAWVG
FT                   SELGGADVVINNAGIGMAGGILDTSARHWERILHVNLWGVIHGSRLFAQQMAARGTGGH
FT                   IVNTASAAAFGPSRDLPAYATTKAAVLMLSECMRAELAEQGIGVTAVCPGFAETGIMAS
FT                   THYAGANAQDEARLRKRATKLYQMRGLKPETVAQAMVDGVLRNRPVVAVGGEAHALRFV
FT                   GRFMPWLGRMIARVSMASH"
FT   gene            complement(499947..500846)
FT                   /locus_tag="Bcen_3399"
FT   CDS_pept        complement(499947..500846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78294"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUW0"
FT                   /protein_id="ABF78294.1"
FT                   /translation="MTAHHPLPEVHLDELPQFRAVQQLAYRCVETVGAMLYPGITEKEA
FT                   ARLLTEWLQDNGVHDWLHKPFAWFGDRTAFEGFSGLKHMGGFNLAFFPSNRQLETDMPV
FT                   ILDVAPVLDGIVADVGYAHCLGRNPILEQLQDDLMDHRDMIVRLVKARRPMAEVAQEVD
FT                   ALCRRQGVEPRHKAYPFKVLAHRVAKIHKLSKPRFVARFGLNATRNLLLDQGRAAKQQG
FT                   WSPLWSIDRRSEHAPVPGLWAVEPHLGFAGVGAKFEELLVITDDDAYWLDEDLPHVRRW
FT                   QRRQAERAQAASTLSAAA"
FT   gene            501052..502635
FT                   /locus_tag="Bcen_3400"
FT   CDS_pept        501052..502635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3400"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   KEGG: bte:BTH_I0700 Tat (twin-arginine translocation)
FT                   pathway signal sequence domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78295"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVM3"
FT                   /protein_id="ABF78295.1"
FT                   /translation="MKGRNGGEALDFRRSGLDGRRLSVRPQQGSRQGSRQARLPHGPAC
FT                   RAGSTPRRVTVGRCQIAEIISSHHPPRFEAFAASRGRCVARRAGQRPKPIRHFNGETMQ
FT                   RRQFMNTLAAATAATPLMLKAGIAGAKSATAPDALDPGRWSPFNAARLQAVLDQHGVAS
FT                   ARYDAKRRPYAVFDWDNTCIMNDCEEALLMYQINHLQYKLTPDEFVAVMWKDVPKGAFM
FT                   KDYTTVDGKPVTMEDLAADVESDYRWLHANYQGFGGDKSLDEIRETDQFKDFRAKLYFM
FT                   YDAICDTHPLEIGYKWIIYFYQNMTTAELQAMAQASNNYGIGDALRKVRYESPKTLPGK
FT                   AGVVADTHFHGIRIHEEIRAVMHTLRANGIDVYVSTASLDDVVRVFAGNPNYGYGVPPE
FT                   NVIGLRLDMQDGKYTSTYPAGWHFNWGPGKTVGIRNVLVSKKGYGPLLVFGDSDGDAWM
FT                   LRDFKDTAAGVIVNRMKKGEIGADSKLAAEQIGNPDARFLLQGRDEHTGLMIPDEKSIK
FT                   YGKAERKLLA"
FT   gene            complement(502728..503501)
FT                   /locus_tag="Bcen_3401"
FT   CDS_pept        complement(502728..503501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3401"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: bur:Bcep18194_B0711
FT                   membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78296"
FT                   /db_xref="GOA:A0A0H2XUE4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUE4"
FT                   /protein_id="ABF78296.1"
FT                   /translation="MIGYTFGFSSVLVVFVVVLVASSIRIFREYERGVVFMLGRFWKVK
FT                   GPGLALIIPIVQQVVRIDLRTVVFDVPAQDVITRDNVSVKVNAVVYFRVVDPEKAVIQV
FT                   ARFFEATSQLAQTTLRAVLGKHELDALLAEREQLNADIQKTLDAQTDAWGIKVSTVEIK
FT                   HVDLNETMIRAIARQAEAERERRAKVIHAEGELQASEKLLQAAQRLALQPQAMQLRYLQ
FT                   TLTTIAADKNSTIVFPLPVDLLGALLDRLGPSREP"
FT   gene            complement(503498..505057)
FT                   /locus_tag="Bcen_3402"
FT   CDS_pept        complement(503498..505057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3402"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   bur:Bcep18194_B0712 membrane-bound serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78297"
FT                   /db_xref="GOA:A0A0H2XVP7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVP7"
FT                   /protein_id="ABF78297.1"
FT                   /translation="MRFHRHGPPPAPAAPDGRPRHPLSARVARAALFAALLVVCAAVAA
FT                   PPAADAPAAHPVVVIPVNGAIGPASADFIVRSLDRAAREHAPLAILQLDTPGGLDTSMR
FT                   QIIKAILGSPVPVAAFVAPGGARAASAGTYIVYASHVAAMAPGTNLGAASPVQFGIGGG
FT                   APPGANPGAPRPTGASGASGASGVSDAAAMLLTDTQSTEIRKAMQDASAYIRGLAQLRG
FT                   RNAEWAERAVREAVSLSANEARAQHVVDLIAQDPADLARQLDGRAVTTTAGTLHLATAH
FT                   APLVVLAPDWRSRFLAIIADPNVALILLTIGIYGLFFEFANPGFVLPGVAGTICLLVGL
FT                   FAMQLLPVSYAGLGLVLLGLGCLVAEAFLPTFGVLGFGGIVAFTIGALMLIDTDVPGYG
FT                   IPWPVIASLALGGALLVAGVSSVALRARRRPVVTGAEAMLGSIGEVLDDGLQPDQPPGA
FT                   AGAPSSAAGWARVHGERWRVASSTPLAAGCRVRVTGRHGLTLTVAPLYDAPAPAHPQGE
FT                   PS"
FT   sig_peptide     complement(504923..505057)
FT                   /locus_tag="Bcen_3402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.724) with cleavage site probability 0.622 at
FT                   residue 45"
FT   gene            complement(505181..506215)
FT                   /locus_tag="Bcen_3403"
FT   CDS_pept        complement(505181..506215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3403"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0713 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78298"
FT                   /db_xref="GOA:A0A0H2XTJ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTJ3"
FT                   /protein_id="ABF78298.1"
FT                   /translation="MKQEDKGTVAISLVAHSVSLATRRGVAAEPLLAQAGIAPALLAQP
FT                   RARVSAQQYGALWNAIARTLDDEFFGQDRHPMRSGSFIAMSQAALSARDGLHAMARAVN
FT                   FMHCVLDDLHAELDANPQRVRLRFVHRNNGATPAMFTYATYFIIVYGLTCWLIGRRIPL
FT                   LHASFRCDTPPADHEYPSMFCDDMRFNEPDSYVDFDPEFATLPVVQNAKTLKTFLRNAP
FT                   ASFIVKYRNPNALAQRVRAVLRGMPPAAWPGAGGMAARLHVAEATLRRKLHQEGHAYQS
FT                   IKDTLRRDLAFEALADPARTIADVAAATGFAEPSAFYRAFRKWSGRSPAEFREEALARG
FT                   GGAG"
FT   gene            506353..507486
FT                   /locus_tag="Bcen_3404"
FT   CDS_pept        506353..507486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3404"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   bur:Bcep18194_B0714 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78299"
FT                   /db_xref="GOA:A0A0H2XUX8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX8"
FT                   /protein_id="ABF78299.1"
FT                   /translation="MDELYTEDQRMIRDAARAFATEMLAPNAAQWDHDAHLPDAIVAQL
FT                   GELGLLGMIVPQELGGSYTDYVAYALAMEEVAAGDAACATMMSVHNSVGCGPILGFGTP
FT                   AQKDRWLADMAAGRVIGAFCLTEPHAGSEANNLRTRAELRDGQWVLNGAKQFVTNGQRA
FT                   GVAIVFAMTDPEAGKRGISAFLVPTDTPGFIVGKPEKKMGIRASDTCPITFENCAIPEE
FT                   NLLGNRGEGLKIALSNLEGGRIGIAAQALGIARAAFDKARRYAGERVQFGKPIAEHQAI
FT                   QQKLADMAVQINAARLLVHHAAKLRTAGLPCLSEASQAKLFASEMAERVCSDAIQIHGG
FT                   YGYLVDYEVERHYRDARITQIYEGTSEVQRMVIARQL"
FT   gene            507685..509391
FT                   /locus_tag="Bcen_3405"
FT   CDS_pept        507685..509391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3405"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bur:Bcep18194_B0715 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78300"
FT                   /db_xref="GOA:A0A0H2XVM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVM8"
FT                   /protein_id="ABF78300.1"
FT                   /translation="MTVQAFLDARDFLLRHRTDYDTAYRDFAWPVLDAFNWALDYFDPM
FT                   ARGNDQPALWIVDAATGTGDPYSFAQMSERSSRIANWLRSIGVGRGDRILLMLPNRVEL
FT                   WDAMLAAMKLGAIVLPATTQLSPDDVRDRVQIGGATYAIVDEHETAKFEQAGLGLKQKI
FT                   VAGVPREGWLAMNDGYAASAAFEPDAVTHANDPMLLYFTSGTTSKPKLVEHTHRTYPIG
FT                   HLSTMYWVGLQPGDIHWNISSPGWAKHAWSCFFAPWNAQACVFAFNYARFEPKVVLDAL
FT                   VKYRVTTLCAPPTVWRMLVQQPLASFDVKLREIVGAGEPLNPEIIERVKKAWNISIRDG
FT                   YGQTETTCLIGNSPGQPVVAGSMGRPLPGYRIALLDPDGAPVTEGEVALPIGDDVTRPV
FT                   GLMKGYANNPDATAHAMRDGHYRTSDIAMRRDDGYYVYIGRADDVFKSSDYRLSPFELE
FT                   SVLIEHPAIAEAAVVPSPDPVRLSVPKTFITLRQGYEESPALALEIFRFSREKLAPYKR
FT                   IRRLQFAELPKTISGKIRRVELRRREIERGDDATERMPGEYWEEDFANELK"
FT   gene            509388..511037
FT                   /locus_tag="Bcen_3406"
FT   CDS_pept        509388..511037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3406"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: bur:Bcep18194_B0716
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78301"
FT                   /db_xref="GOA:A0A0H2XUE9"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUE9"
FT                   /protein_id="ABF78301.1"
FT                   /translation="MTGCGPCAPLFFRRAARRLAEPNRPRVARRHAAHCKEKTLMNANP
FT                   TPRTGQDVPTVKLLIDGAFVESTTSEWRDIVNPATQQVLARVPFATVAEVDAAVQAAHA
FT                   AYATWKNTPIAARMRIMLKFQDLVRANQQRIAKTLTAEQGKTIPDAEGDIFRGLEVVEH
FT                   ACSIGTLQLGEFAENVAGGVDTYTLRQPLGVCAGITPFNFPAMIPLWMFPMAIVCGNTF
FT                   VLKPSEQDPMSTMELVELALEAGVPKGVLNVVHGGKEVVDAICTHPLVKAISFVGSTAV
FT                   GTHVYNLGSQHGKRVQSMMGAKNHAIVLPDANREQAINALVGAGFGAAGQRCMATSVAV
FT                   LVGQAREWLPDLVAKAKTLKVNAGSEAGTDVGPVVSRGAKARILSLIDMGIKEGAKLEL
FT                   DGRDVKVAGFEEGNFIGPTIFSGVKTDMTIYTHEIFGPVLVVMEVDTLDEAIALVNANP
FT                   MGNGVGIFTQSGAAARKFQSEIDVGQVGINIPIPVPVPFFSFTGSRGSKLGDLGPYGKQ
FT                   VVQFYTQTKTVTARWFDDDTTAGPVNTTIRLH"
FT   gene            511056..511955
FT                   /locus_tag="Bcen_3407"
FT   CDS_pept        511056..511955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3407"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: bur:Bcep18194_B0717 3-hydroxyisobutyrate
FT                   dehydrogenase TIGRFAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78302"
FT                   /db_xref="GOA:A0A0H2XVQ4"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVQ4"
FT                   /protein_id="ABF78302.1"
FT                   /translation="MKIGFIGLGHMGAPMALNLLKAGHDVHAFDLSADALRALQDAGAQ
FT                   VAASPRDAASGATFVITMLPAAPHVRSVLSGENGVLAGLGAGATVIDSSTIDPASAQAF
FT                   GALVREHGGAFVDAPVSGGTGGAAAGTLTFMVGGSDADFERVKPVLAGMGKNIVHCGAT
FT                   GMGQVAKVCNNLVLGISMAAVSEAMSLGVALGIDPKVLAGIVNTSTGRCWSSDTYNPYP
FT                   GVIETAPSSRGYSGGFGTDLMLKDLGLANDAAKQARQPVYLGALAQQLYQTMSSRGDGQ
FT                   LDFSAVIRLYQPATKKDA"
FT   gene            511955..512746
FT                   /locus_tag="Bcen_3408"
FT   CDS_pept        511955..512746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3408"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bur:Bcep18194_B0718 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78303"
FT                   /db_xref="GOA:A0A0H2XTJ8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTJ8"
FT                   /protein_id="ABF78303.1"
FT                   /translation="MIELDYVDDGAIACATLKRPPANAFTADGLQQLQATVAELNANPR
FT                   VRALVITGDGPKFFSAGADLNTFADGDRAVARAMAARFGAAFEALHDARVVTIAAINGY
FT                   AMGGGLECALACDLRIAETHAQMALPEPSVGLLPCGLGTQTLPWLVGEGWAKKIILTGA
FT                   RVDAATALRIGLVEDVVESGAAREAALALARNVARQSPHAVAYSKELIGLARRGVPRSA
FT                   ALAVERERFVDLFDTADPREGVAAFLGKRAPQWRTDGESQR"
FT   gene            512743..513882
FT                   /locus_tag="Bcen_3409"
FT   CDS_pept        512743..513882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3409"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bur:Bcep18194_B0719 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78304"
FT                   /db_xref="GOA:A0A0H2XUY3"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY3"
FT                   /protein_id="ABF78304.1"
FT                   /translation="MSTPVTNHDAFAEHAPEVLFRVVNRVALITLNRPAALNALSYAMI
FT                   GELAALFERCRHDDQIVAVVLRGAGEKGFCAGGDVRALYKMVAQRETWLPFFVDEYRLD
FT                   YAIHMFPKPVVALMDGVTMGGGMGLAQGAALRVATERSKIAMPETRIGLVPDVGATHFL
FT                   SGMPVELELYVGLTGAMLSGADALTAKLADLCVPSAWLDTFETRIESVKWDGDALPLLR
FT                   KVFEPPCNVVPHAALDSQMPWIVRHFDKRSSVERIVATLTQELTRDELAREHRQWLQAT
FT                   LDALASHSPTMLAVTREALLRGRQMTLAESFRMELGIVARAIEEGDFCEGVRAHLVDKD
FT                   RKPRWAPASLVELRAERVRHFLTSPWKLFAHPLADLGAA"
FT   gene            complement(513969..514922)
FT                   /locus_tag="Bcen_3410"
FT   CDS_pept        complement(513969..514922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3410"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0721 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78305"
FT                   /db_xref="GOA:A0A0H2XVN4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVN4"
FT                   /protein_id="ABF78305.1"
FT                   /translation="MDWGISGPNRCNAQPAMTDRLDGVTTFVQVVESGSFALAAERLDM
FT                   TRSAVGKAIARLEKRLGARLLQRTTRSQSLTDDGQAYYDRCVRALAELEAAEADLDCGR
FT                   HEARGKLRLSVPLAFGHHCVTPIVLDLARTYPHLRIDVSITDRFVDLVEEGIDLAVRIG
FT                   PLADSTSLAVRRLGTQYGSLGAAPSYLARHGTPQSLDDLKNHRTIAYSRSGVVQPWYLR
FT                   APDGSSVHIDMPHQLSFDDVQAIAAAGASGFGIAWLPSWLLDHYVKRGEMVVVLDRCFV
FT                   CEGDIHAIWPKTRYLPRKTRCVIDALVEAVPPMIER"
FT   gene            515060..516598
FT                   /locus_tag="Bcen_3411"
FT   CDS_pept        515060..516598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3411"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0722 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78306"
FT                   /db_xref="GOA:A0A0H2XUF4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUF4"
FT                   /protein_id="ABF78306.1"
FT                   /translation="MTLSDSRRNAVALAAVCLTSLMFGLEISSVPVILPTLEHVLHGDF
FT                   NGMQWIMNAYTIACTTVLMAAGTLADRFGRKRVYVIGTVLFGATSLLCGLAPNVPVLVA
FT                   GRLLQGASGGAMLICQIAVLSHQFREGRERGRAFGIWGIVFGIGLGFGPIVGGAIVALA
FT                   SWPWVFLVHAPLAAVALVLIGGAVQESRDPHAGALDVAGIVTLSLAVLGLAFYITQSAE
FT                   LGLTSAAGLGVLGATVLAVLGFVIAERASARPMFDFSVFRIRAFTGAIFGSMGMNFSFW
FT                   PFMIYLPIWFQVALGYDSVTAGLALLAYTLPTLIAPPFGERLALRYGPGVVIPAGLFTI
FT                   AAGFVLMRLGSAADHASWLTMLPGCVIAGIGLGLTNTPVTNTTTGAVPCARAGMASGID
FT                   MSARMISLALNIATMGFVLVAGIVASLKGGPAGAIGDAALRRLAQEIAAGRTDGLQAIA
FT                   PALAQADPSGAALHAALVHGFGWVMVYGAAGVALLATASAVAFAPARRGAAVCE"
FT   sig_peptide     515060..515146
FT                   /locus_tag="Bcen_3411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.802) with cleavage site probability 0.546 at
FT                   residue 29"
FT   gene            complement(516643..518022)
FT                   /locus_tag="Bcen_3412"
FT   CDS_pept        complement(516643..518022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3412"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT; PFAM: outer membrane efflux protein;
FT                   KEGG: bur:Bcep18194_B0723 RND efflux system, outer membrane
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78307"
FT                   /db_xref="GOA:A0A0H2XVQ9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVQ9"
FT                   /protein_id="ABF78307.1"
FT                   /translation="MAIMHSSPLHRLGAFACAAALLAGCAGARHDPLPAVAMPANWAAP
FT                   VAADAPAATGDWWRSFGDPQLDALIDDALRANNDLAIAAIRVYRAQLQAGLVDTNLTPN
FT                   VTLGANGAVSRTLDTHQMSRSSGVNGSLSYELDLWGRLAALRDAAHWEADATADDLEAA
FT                   RLSLIGTTAALYWQIGYLNRQIALGDANIAYAERTLALVRSRHTAGAVSGLDLAQAEQS
FT                   LAAQRAAQTQLIQQRTENRHALAILFDRPPQQRAAEPAALPDAAPPDVAAGLPASLLGR
FT                   RPDLRAAEFRLRESLAQVDATRTSFYPTFTLTGSAGTTSTSLERVLTNPVGTLGLGLAL
FT                   PFIQWNTMQLQIRVSKSQYEEAVVGFRQRLYTALAEVENALSARVQLEREAEQRTLSLA
FT                   QAQRAERLAAARFAAGATAVQPWLDQQQVLRSAQSADELTRLNRLNNQMKLYRALGGGT
FT                   S"
FT   sig_peptide     complement(517936..518022)
FT                   /locus_tag="Bcen_3412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.749 at
FT                   residue 29"
FT   gene            complement(518029..519150)
FT                   /locus_tag="Bcen_3413"
FT   CDS_pept        complement(518029..519150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3413"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bur:Bcep18194_B0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78308"
FT                   /db_xref="GOA:Q1BPZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BPZ6"
FT                   /protein_id="ABF78308.1"
FT                   /translation="MLGIIIGITSVVSIVAVGEGAKRYMLEEIGSIGTNTISLYPGSDW
FT                   GDSRADTIQTLVPADVAALAEQPYVDSATPETSRTLLLRYRNVDVHALVSGVGDSYFQT
FT                   RGMRFALGVPFDDDAVRRQAQVAVIDQNTRRKLFGATRNPVGEAILVDNVPCVVIGVTA
FT                   DKKSAFGSVKSLNVWVPYTTASGRLFGQRYLDSITVRVRDGQPSAAAEKSLEKLMIQRH
FT                   GRKDFFTYNMDSVVKTVEKTGQSLTLLLSLIAVISLVVGGIGVMNIMLVSVTERTREIG
FT                   IRMAVGARQSDILQQFLVEAVLVCLLGGTIGIALSFGLGALFSVFVAQWKMVFSAGAIV
FT                   TAFVCSTLTGVIFGFMPARNASRLDPIDALARD"
FT   gene            complement(519153..520073)
FT                   /locus_tag="Bcen_3414"
FT   CDS_pept        complement(519153..520073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3414"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78309"
FT                   /db_xref="GOA:Q1BPZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BPZ6"
FT                   /protein_id="ABF78309.1"
FT                   /translation="MRQPLLKLAAVTRRFPAGDKDVVVLNNVNLSIGAGEIVAIVGASG
FT                   SGKSTLMNILGCLDHPSEGTYTVGGRDTHMLDSDELAQLRREHFGFVFQRYHLLPHVDA
FT                   VANLEMPAIYAGTPRADRHARARELLARLGLADRAHHRPGQLSGGQQQRVSIARALMNG
FT                   GQVILADEPTGALDTKSGQDVIRILHELNALGHTIVIVTHDKAVARHARRIIEISDGEI
FT                   VADRPNRHYAEAFAEVGVGAAATTETAADTRSAPASGDAPPPANNDTAADPAPAPDASP
FT                   PAPAVSPKHAGWRGSRSCRTGCARC"
FT   gene            complement(520076..521269)
FT                   /locus_tag="Bcen_3415"
FT   CDS_pept        complement(520076..521269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3415"
FT                   /product="secretion protein HlyD"
FT                   /note="PFAM: secretion protein HlyD; KEGG:
FT                   bur:Bcep18194_B0725 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78310"
FT                   /db_xref="GOA:A0A0H2XTK4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTK4"
FT                   /protein_id="ABF78310.1"
FT                   /translation="MTQKTHRRRRIVLATLAVVAIAVGITLKACAPTKHPQYLSAPVTR
FT                   GDLENAVLATGALQAFRQVDVGAQVSGQLKTLKVKLGDKVTKGQWLAEIDPVISENALR
FT                   QARASEESLRAQQRSTAAQLTQAELAFRRQQAMLPDDATSRESFEAAKATLDVQRATLA
FT                   SLAAQIRSARIQIETAQANLGYTRIVAPIDGEVVAIVTQEGQTVIAQQQAPVILKLANL
FT                   DTMTVKAQVSEADVIRVSAGQTAYFTILGEPDKRHYGKLRAIEPAPQNYADAQSALGGG
FT                   AGGGAKPNAAVFYNALFDVPNPEHRLRIAMTAQVNIVLGNARNALSIPAAALGEKRKDG
FT                   TVAVRVLRADGSTETRHVRIGINNNVRVEVLAGLKDGERVVIGEASADERAPLSDVV"
FT   sig_peptide     complement(521180..521269)
FT                   /locus_tag="Bcen_3415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.846 at
FT                   residue 30"
FT   gene            complement(521678..522259)
FT                   /locus_tag="Bcen_3416"
FT   CDS_pept        complement(521678..522259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3416"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="KEGG: bur:Bcep18194_B0727 metal-dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78311"
FT                   /db_xref="GOA:A0A0H2XUY8"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY8"
FT                   /protein_id="ABF78311.1"
FT                   /translation="MNPDTIHARLAFLREAERLKDVLRSSHTSAGRPESTAEHSWRLCL
FT                   MALVFTDALPGVDALKLLKLCVVHDLGEALHGDIPAIEQAAHPDKSAHERDDLLTLTAS
FT                   LDRAVRDEIVALWDEYEAAASPEARAAKALDKLETIVQHNQGSNPPDFDYAFNLGYGRR
FT                   YTDAAPLFRAIREIVDADTQRKIDAGGERA"
FT   gene            complement(522338..522904)
FT                   /locus_tag="Bcen_3417"
FT   CDS_pept        complement(522338..522904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3417"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bur:Bcep18194_B0729 transcriptional regulator,
FT                   XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78312"
FT                   /db_xref="GOA:A0A0H2XVP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVP0"
FT                   /protein_id="ABF78312.1"
FT                   /translation="MPHPPLHPSSLGPQLKRWRALHRVKQSHAAELFGVAQSTISRWEA
FT                   GLQQMSPAERATAERLLAARLDSAGDHALARLIAGSAGRMHLVCDLTHRLLASSPARAA
FT                   EFSQPLSTLLGTSLWRYATPEIVRMEAALDPFGWHDRAGPPSVEFDTGANASRVVPIRG
FT                   SRCRWTRMTLSDSSAVRLVETLDAH"
FT   gene            523353..524756
FT                   /locus_tag="Bcen_3418"
FT   CDS_pept        523353..524756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78313"
FT                   /db_xref="GOA:A0A0H2XUF9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUF9"
FT                   /protein_id="ABF78313.1"
FT                   /translation="MVRLVLLLLGIEYLRTRWRGLTVLGWLWVAAGIGIFVDALDGALH
FT                   FPIELFAWLFLIEGLATLAVAGSGVGGQRILRYVKGIAVVMAAGLVFAGHHHGHFLLSM
FT                   IFGTLFLVDGLLQCTSAWMVRYRRWHVAFAWGVVEILLAIFFFQPYPTHYAGTVPYCLG
FT                   LLLMFGGMHMLSLAARVRRLTRNPAFATSPTPALAPDLDDAPDQPQFAQSEWDGPPADG
FT                   ERALTVHVWTPTGTSKAEAQRYPVIDRYIAAVDVNGVISTGHAALESPEGIYISLYPGV
FT                   EIDRSPDEFTRILRATRENDVPGLFQPDYATESKAWCPSTVRVRIRNYDPAKLDAFWSS
FT                   YRQNTTYNLTYRNCSSTVSNALEAALDGAVWRLKGARAGWGAFVRLLLTPELWVAAQIR
FT                   KRAVTMAWTPGLTLDYARALSMLADPRPFAWWKVARSAVSAIMASRRAWREQDSAALSP
FT                   GGSEAVSMK"
FT   gene            524808..525434
FT                   /locus_tag="Bcen_3419"
FT   CDS_pept        524808..525434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVR4"
FT                   /protein_id="ABF78314.1"
FT                   /translation="MRPADIARDKNPRTTTMNETTAFRILIPAALTLALASASFAQAGT
FT                   DEVPRMSNDVYRTSVSFCSNVPAAERIACQGDMIAAGSRIVAAIGGLPPASATAIDEGA
FT                   RSKLPPDERNGLAPVEPGAIDKDDTLAGLAGMVRLCDVYEPEPASRARHHAALQQKAPD
FT                   VAPRVEALLADASTAARRRVSIGVWQILALEGPEASARACTQLGT"
FT   sig_peptide     524808..524939
FT                   /locus_tag="Bcen_3419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.814 at
FT                   residue 44"
FT   gene            525562..526293
FT                   /locus_tag="Bcen_3420"
FT   CDS_pept        525562..526293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3420"
FT                   /product="ribonuclease T2"
FT                   /note="PFAM: ribonuclease T2; KEGG: bur:Bcep18194_B0733
FT                   ribonuclease T2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78315"
FT                   /db_xref="GOA:A0A0H2XTL0"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="InterPro:IPR039378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTL0"
FT                   /protein_id="ABF78315.1"
FT                   /translation="MLKTLARAAAALAVASVSLHAAAQTSYDYLLLAASWEPGFCASHD
FT                   TPECTNLAGSYAATSLSLHGLWPNRYDGNQPFYCGVPQNDIDLDNAHQWCSMDAYPISS
FT                   ATRNTLSTYMPGVASCLDKHEWFKHGTCSNSATPDAYWNQASGMISRLGNTSFNAFLQA
FT                   NAGKTVTRNQLLSAFEGAFGSNTRSAVSLKCTKTNGVSYFTEAWIAVKTNATAQFPSAA
FT                   SLVTDGNTQGTCPTSGVFIAK"
FT   sig_peptide     525562..525627
FT                   /locus_tag="Bcen_3420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.710 at
FT                   residue 22"
FT   gene            complement(526319..526972)
FT                   /locus_tag="Bcen_3421"
FT   CDS_pept        complement(526319..526972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3421"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   bur:Bcep18194_B0745 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78316"
FT                   /db_xref="GOA:A0A0H2XUZ5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUZ5"
FT                   /protein_id="ABF78316.1"
FT                   /translation="MNEETAPDIEMATHTPAHGDNTPAQSTLYQIPPIAPSKTALLVMH
FT                   YQTDILGLFPSVAPELLANTRRLCDAARAAGVGVWFANLRFSPGYPEVSPLNKNGQGIK
FT                   QLGLFIDDAPCPELAKRPDEPLIVAHRASVFFGTDLQARLIAQGVDTLIMVGIASTGVM
FT                   LSSIAHASDADFRLYTIKDCCYDPDPIVHEHLFATAFESRTTVLSLADALRLLA"
FT   gene            527218..527838
FT                   /locus_tag="Bcen_3422"
FT   CDS_pept        527218..527838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVP5"
FT                   /protein_id="ABF78317.1"
FT                   /translation="MENQAMPERFDISVTLERSVSLAERQEIVFSLAKICTPFFDAFHE
FT                   VSVLDFKTGSEVRKEWADGEGLAGWRAGEDELLFVYGAKSTQFTGARGCMRIEEREWGA
FT                   QFSISLPLSADADSFRLESLLVDIKDYAAHQSPMFIVAAGWELDCDIDAGIDGMVKDAL
FT                   SDGSLCQWLATPAPIVPDRPNDWQETNESGGITCLKRKSVRWA"
FT   gene            527957..528673
FT                   /locus_tag="Bcen_3423"
FT   CDS_pept        527957..528673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3423"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: bur:Bcep18194_B0513
FT                   alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78318"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUG5"
FT                   /protein_id="ABF78318.1"
FT                   /translation="MPLPLVFLPAMPCDGRMYADQLERLNDLVVPSVRMLAYPTFAESA
FT                   ERLLASIDGPFIIAGTAYGGCIAMEVVACAPQRVRGLWLMNCQPGLPPYPDRVRDTSRR
FT                   IREGEHEQVIAEFAENAIPPVDIRSRAAFVQMARDTGADMFARQSDATLTRSDHWSTLA
FT                   TSAIPTLLIWGEADRFVPVDVGRRIARMMPHARFETLEGCGHFPALERPSICTDIARRW
FT                   LIEQVIGSPVDGIAAT"
FT   gene            528800..529243
FT                   /locus_tag="Bcen_3424"
FT   CDS_pept        528800..529243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVS0"
FT                   /protein_id="ABF78319.1"
FT                   /translation="MTTIYDTIVWLQSDTSAEQFPIVEFSADTDMATLGWVSLTSTDQP
FT                   EIVVTQVTAEEFRAIAKGTDGYLAVEHRVNAALKRLDLKCSWLVRVDDGPNVAGGSFQM
FT                   FREAYRPPKLFFRDIFSDALAQEASRTTRAEFERNGGKVIVLQ"
FT   gene            529285..529767
FT                   /locus_tag="Bcen_3425"
FT   CDS_pept        529285..529767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3425"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG:
FT                   bur:Bcep18194_B0904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78320"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTL5"
FT                   /protein_id="ABF78320.1"
FT                   /translation="MSRPDFIKHWTELEEPDAHSYRGDTEPMAFDAPLSAALGITRIGI
FT                   HHVRLLPGRRTSYPHAESTEQEFVYVLEGKPDVWIDGVLHPIAEGDSVAFPAGTGICHT
FT                   FINNTKDEVRLMVIGERPRDDNRIRYPLNEAYELTRADRWVDWPDRPLGDHDGMPD"
FT   gene            complement(529905..530279)
FT                   /locus_tag="Bcen_3426"
FT   CDS_pept        complement(529905..530279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78321"
FT                   /db_xref="GOA:A0A0H2XV01"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV01"
FT                   /protein_id="ABF78321.1"
FT                   /translation="MKILLIASLGVSLFSQTSQAFADSDNGKKIFLARCAMCHGADARG
FT                   TGPLANKSNPPTPDLTTPAFKKRLSDYPGVIVSSVILRPNGDLIPKTLRENGVKLPPHP
FT                   WTVKDFRDLNQYMTGLISKK"
FT   sig_peptide     complement(530211..530279)
FT                   /locus_tag="Bcen_3426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.820 at
FT                   residue 23"
FT   gene            530809..531714
FT                   /locus_tag="Bcen_3427"
FT   CDS_pept        530809..531714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3427"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mbo:Mb2286 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78322"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVQ0"
FT                   /protein_id="ABF78322.1"
FT                   /translation="MYKPLDQRGRRIVITGANSGTGKEATRRLVAAGADVIMAVRSESK
FT                   GDAARRDIRKEFPGTSIEVRTLDLSSLASVRNFGRQLLEEGRPLDVLVNNAGIMMPPTR
FT                   VLSSDGFELQLATNFLGHFALTNLLLPLLLEAKSPRVATMTSSAAMGATINFDDLQGER
FT                   SYKPMTAYAQSKLACLLLANRLAEIARERGWPLLSTSAHPGHTRTNLQTSGPNMGTDST
FT                   RKRLSFRLVPSMDVEWATDSLLRAAVDPTATQGAFYGPRFLLVGNSHVAKQPRSAKSAD
FT                   SIRLWQVAEALTATRPPQVG"
FT   gene            complement(531948..532862)
FT                   /locus_tag="Bcen_3428"
FT   CDS_pept        complement(531948..532862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3428"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: glutaminase; KEGG: bur:Bcep18194_B0751
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78323"
FT                   /db_xref="GOA:A0A0H2XUH0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUH0"
FT                   /protein_id="ABF78323.1"
FT                   /translation="MNYQSILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTL
FT                   DGNVYTVGDAYERFSIQSISKLFACTLAFQLLGDELWERVGREPSGTAFNSLVQLESER
FT                   GKPRNPFINAGALVVTDVLCRRFVKAETALVEFVRRLIGSNDIDYDSRVALSELQHAER
FT                   SRAMAHFMASFGNMQMPPDTVIDAYCRQCAIEMNCVELATAALFLANGGIAPATGERVV
FT                   DSSSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDA
FT                   NGNSLAGTLALEWLTTYTERSIF"
FT   gene            533082..533792
FT                   /locus_tag="Bcen_3429"
FT   CDS_pept        533082..533792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3429"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_B0752 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78324"
FT                   /db_xref="GOA:A0A0H2XVS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVS5"
FT                   /protein_id="ABF78324.1"
FT                   /translation="MSFRILLVEDDTRLSTLIAGYLRKNDYEVDTVLHGDAAVPAILSI
FT                   RPDLVILDVNLPGKDGFEICREARKQYDGVIIMVTARDEPFDELLGLEFGADDYVHKPV
FT                   EPRILLARIKAQLRRAPARAAESTAPQPERYAFGKFSIDRTDRTVVLPDGSTPDLTSAE
FT                   FDLLWALVCHAGEVVSRDDLMLQLRGVEFDGLDRTIDGRISKLRRKLRDDASNPQRIKT
FT                   IRSKGYQFSKHAWE"
FT   gene            533857..534987
FT                   /locus_tag="Bcen_3430"
FT   CDS_pept        533857..534987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3430"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bur:Bcep18194_B0753 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78325"
FT                   /db_xref="GOA:A0A0H2XTM0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTM0"
FT                   /protein_id="ABF78325.1"
FT                   /translation="MIRRTRSHPDAPPLPTLRYVKWRWLHFRRAWTDTRADRIPSWSRL
FT                   YLRTYLHLLGLVLLTALVPALALCVELSPQVVWHAFDSLPGDIWIVLAFVFTAPALAAY
FT                   RWMRPVWSDLVMVRERAIDFTGGRFNTRARESHSVIIGPLARTLNALAMRMERLIAAQR
FT                   DLTNGISHELRTPLARVRFALEMLREPGSAAEYQGALDSIAQDVTELEELIDMSLTYAR
FT                   LEYSSLQSNLEMTAPVAWFEHQVNDAQLLYPDRAIESRIEIGADLRVKMDRRLMSYAMR
FT                   NLLRNASKYAKSRIVVGISLVHGNVGIFVEDDGPGVPESERERIFDAFVRLDRRTGGYG
FT                   LGLSITRQVLHAHNGRIAVVDPVELGGARFEISWPV"
FT   gene            complement(535087..537498)
FT                   /locus_tag="Bcen_3431"
FT   CDS_pept        complement(535087..537498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3431"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: bur:Bcep18194_B0755 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78326"
FT                   /db_xref="GOA:A0A0H2XV06"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV06"
FT                   /protein_id="ABF78326.1"
FT                   /translation="MTATAFFRWAPLGPLCTTLVAFWCCTLAAQPLPAAESAAAQTVAA
FT                   AANAPAAATPTAPAASAHTCTADGGPAGRPSIGLVLSGGGARGYAHLGVLKVLEDNRIP
FT                   IDCIAGTSMGAVVGGLYASGMAADEMQRRLSEVNLADIAFDVTDRADLPQTSREDERLY
FT                   INGLTLGFGKKGVKAPVGLVQGNRLQALLANWTAAVPTNQPFDQLPIPYRAVATDLQTG
FT                   QMVVLDHGSLPLAIRASMAMPGLFAPAEINGRALVDGGLVSNLPVDTARQMGANVVIAV
FT                   DIGSQLRPLDALASPADVMQQMVGILIRQNVTAQRKQLDARDVLLTPDLGSLAFADFQN
FT                   AKQAIAAGAAAATAALPKLRRFALTPEQYAAYRSSHAQPLPPPIRITRIDIKTSGGVPK
FT                   RVVSNALHVKPGDIYDPKTVSQDLLGLTTGGNFESVTQQIVSRGDDNVLEIDAREKYWG
FT                   PNFLLFGLGMSSSSTDEGGFRLHVGYRRPRLTESGLEFRADTTIGSDLQSARVELRQPL
FT                   STAYGVYLSPYAEYQRRYANLYDDSGDVKITQYLMQTARAGIDLGLPIARLGDFRIGLG
FT                   YVTGHGSPTYNLPFDDGSGQALLWPSFTSQALIARARLVIDQLDDPMFPRKGYFGELRV
FT                   ERSLVSRNGGSAQDFADGISNAPYTEIYGKAMIAQQFGRHSVSATIEGGKSIGGTNLIN
FT                   AFNFTLGGFQHLSAYAADQLNGNELAYGQITYMNQLMTFNASPIKALSVGASAEVGNVW
FT                   SSGQKIGGGALKQSYTFFTSLSTAFGPVYIGVALAPSGRRNFYLQLGRTY"
FT   sig_peptide     complement(537409..537498)
FT                   /locus_tag="Bcen_3431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.636 at
FT                   residue 30"
FT   gene            537770..538804
FT                   /locus_tag="Bcen_3432"
FT   CDS_pept        537770..538804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3432"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: bur:Bcep18194_B0756 cell shape determining protein
FT                   MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78327"
FT                   /db_xref="GOA:A0A0H2XVQ5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVQ5"
FT                   /protein_id="ABF78327.1"
FT                   /translation="MSTPLFGKLFAQPVAIDPGTASTRIYTHERGVVLNQPSVVCFRKG
FT                   GASDARPTLEAVGELAKALLGREPGHLEAVRPMRHGVIADAHAAEQMIRSFIDMSRTRS
FT                   RFGRRVEVTLCVPSDATAVERRAIREAAFAAGVSEVELIEESLAAGLGAGLPVTEPVGS
FT                   MVIDIGGGTTEVAVIALGGIVYREAIRVGGSQFDAAIVNHVRNLYGVLLGEQTAEHVKK
FT                   AIGSATSAVPRTSTRAVGRSIGDGLPRSVELSNHDVADALAAPLKQVIGAVKSVLENAP
FT                   AELVTDIANRGVVLTGGGALLADLERLLYDETGLVARIADEPATCAVRGAGEAMGRLAM
FT                   CPVD"
FT   gene            538972..539664
FT                   /locus_tag="Bcen_3433"
FT   CDS_pept        538972..539664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3433"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   bur:Bcep18194_B0757 protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78328"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUH5"
FT                   /protein_id="ABF78328.1"
FT                   /translation="MRPTTPERPNTLKYRTKRSFAARAGRVLAVVACVWAAAAAAIVIH
FT                   GMRMPSNPADVAVIFGNALDDTGAPKPVLAARLDVGVRCYRAGQCPAFLVSGAIDGPGL
FT                   NEATAMRDYLVARGVPADRIAVDDQGDNTLATAQHTLAYLHAHRLSRVLIVSQYYHLAR
FT                   ARLAFERVGIARSNISAAYPRRFQWRDVYSSWREVPAYAVYAVRLWVNPDARPVSFRPM
FT                   LYLMRLFS"
FT   sig_peptide     538972..539094
FT                   /locus_tag="Bcen_3433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.435 at
FT                   residue 41"
FT   gene            540376..543157
FT                   /pseudo
FT                   /locus_tag="Bcen_3434"
FT   gene            547637..549859
FT                   /locus_tag="Bcen_3435"
FT   CDS_pept        547637..549859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3435"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /note="PFAM: Amylo-alpha-1,6-glucosidase; KEGG:
FT                   bur:Bcep18194_B0759 amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78329"
FT                   /db_xref="GOA:A0A0H2XVT0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVT0"
FT                   /protein_id="ABF78329.1"
FT                   /translation="MPNHAEATTTQAPQVAPVPPTPASGPAFIAPEADPQVLARNNQYV
FT                   LKSGDAFVVSDALGDIGGHDDGLFVDDMRVLSKWRLTFGGRAPSLLSGATSADNASFTA
FT                   HLTNRPLPPLGGHETPEGVIHIERLRVLAGDVLYEALTLTNYGASEAEVPLSLSFAADF
FT                   KDMFEVRGTQRPKRGTVGAPRVDAGAVRLRYDGLDGVERNVTVHFSPAPDALSVDRADY
FT                   TLTIPAQACVSIYLTVDATLGPAQAEGPGCGRVALRTALVGVHREMRTRRESMARVNTG
FT                   NPLFDAWLDRSLADLGLLTTQLDTGPYPYAGIPWFSTPFGRDAIITSLQMLWLQPSLAR
FT                   GVLRFLAEHQARETSAFRDAEPGKIMHEFRRSEMAATGEVPFALYYGGVDTTPLFIVLA
FT                   GAYVERTGDDALIDELWPALERAAQWVIDKCDRNPYGLLDYQRTSERGLANQGWKDSHD
FT                   SVFHADGRFPDGPIALVEVQAYACAALDAMSACSHRRGHAADATRYALRVKTLRDQVDA
FT                   LFWMPEGDFYGIALDGHGELCRVFASNAGHLLAFGLPDAERGAAVAGVLGSALFQTGWG
FT                   IRTLAAGQPRFNPMAYHNGSVWPHDNALIARGLARYGDKTAAVNLLRALFEAAVSFEMR
FT                   LPELFCGFPRRRGEPPTAYPVACLPQAWAAGAPFMMLQACLGVSIDASRHEVRVERPAL
FT                   PEGVDWLRIDALRVGDETVSLTFRRVDGQVVAAAEQPGRVKVVAVL"
FT   gene            549956..550207
FT                   /locus_tag="Bcen_3436"
FT   CDS_pept        549956..550207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTM6"
FT                   /protein_id="ABF78330.1"
FT                   /translation="MTTDNRPDDGEHKLEHLEAAVDHLHKSIESQSIAVGAAKGILFSL
FT                   IETLGALIGDPDLPEHARSGYEALRDKASELRGGLDRH"
FT   gene            complement(550690..551580)
FT                   /locus_tag="Bcen_3437"
FT   CDS_pept        complement(550690..551580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0761 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78331"
FT                   /db_xref="GOA:A0A0H2XV11"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV11"
FT                   /protein_id="ABF78331.1"
FT                   /translation="MTKLRPHLPLNALRAFESSARHLNFTRAGLELSVTQAAVSQQVRS
FT                   LEERLGCTLFTRLPRGLGLTDEGRALLPVLSDAFSRIETVLKQFDGGRFHEVLTLGVVG
FT                   TFALGWLMPRLKQFGDTHPFVELRLRTNNNVVDLAAEGLDFAIRFGVGNWPATRNERLL
FT                   DAPLTALCTPDIARRLAQPADLANETLLRSYRTDEWLGWFDAAQLEPWAVNGPVFDSSR
FT                   LMVEAAMQGAGIALAPACMFARELQLGLLARPLDIDVRAGGYWLTSLKSKPLTPAMTLF
FT                   RDWIVAEAASAAPTE"
FT   gene            551717..552655
FT                   /locus_tag="Bcen_3438"
FT   CDS_pept        551717..552655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3438"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: bur:Bcep18194_B0762 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78332"
FT                   /db_xref="GOA:A0A0H2XVR0"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVR0"
FT                   /protein_id="ABF78332.1"
FT                   /translation="MTYSSKRRTLLLAAATAPLVLTVTACASRQGAAPDEATRAAAAAA
FT                   DAIAPAAAATTLADLERDAGGRLGVCAIDTASGRIIEHRAGERFPFCSTFKAMLSAAVL
FT                   AQSVERPGLLQQRVTYTKADLVNYSPVSEKHVGSGMTVAALCEAAIQYSDNSAANLLMK
FT                   LIGGPSAVTAYARSIGDDTFRLDRWETELNTALPGDPRDTTTPAAMAASLRVLTLGDAL
FT                   PAAQRAQLVAWLRGNKVGDKRIRAGVPAGWVVGDKTGTGGYGTTNDAGVIWPTSRAPIV
FT                   LAVYYTQTRADARAKDDVIASVARIVAQTFG"
FT   sig_peptide     551717..551800
FT                   /locus_tag="Bcen_3438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.450 at
FT                   residue 28"
FT   gene            complement(553138..553338)
FT                   /locus_tag="Bcen_3439"
FT   CDS_pept        complement(553138..553338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78333"
FT                   /db_xref="GOA:A0A0H2XUI3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUI3"
FT                   /protein_id="ABF78333.1"
FT                   /translation="MEHFTAWQLLISLVLVAIVVYPYVRIVRRTGHSGWWILTMFVPVL
FT                   NFVMLWVFAFARWPAVGDRQP"
FT   gene            complement(553917..554285)
FT                   /locus_tag="Bcen_3440"
FT   CDS_pept        complement(553917..554285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3440"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bur:Bcep18194_B0764 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78334"
FT                   /db_xref="GOA:A0A0H2XVT5"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVT5"
FT                   /protein_id="ABF78334.1"
FT                   /translation="MPQFKPMDPAFPIQQQIAIDADPVVLVNVFTLAAADEADFLAVWQ
FT                   DDAAFMKRQPGFISTQLHRALGDSPTYLNYAIWESTDAFRAAFTHPEFVAKLSAYPSSA
FT                   IASPHLFQKVGVAGICTA"
FT   gene            complement(554321..554890)
FT                   /locus_tag="Bcen_3441"
FT   CDS_pept        complement(554321..554890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3441"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG:
FT                   bur:Bcep18194_B0765 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78335"
FT                   /db_xref="GOA:A0A0H2XTN1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTN1"
FT                   /protein_id="ABF78335.1"
FT                   /translation="MFACASTLQYRSPFVCRLSPVNLTTSCPLRKVVVNLRIEPDMTKS
FT                   DKLTAIALSVFRLNGLLIEWGNTFAGPHGLTSARWQVLGAISMAPDAPNIPQIANAMGI
FT                   TRQAVLKQINVLTDEGLVLSLPNPAHKRSPLYALTPRGEAAYQAVVEQWQRHVRDIAGD
FT                   FSSTDLDAALRVLSAMSGAHGQDGHA"
FT   gene            complement(555091..556458)
FT                   /locus_tag="Bcen_3442"
FT   CDS_pept        complement(555091..556458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3442"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bur:Bcep18194_B0767 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78336"
FT                   /db_xref="GOA:A0A0H2XV16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV16"
FT                   /protein_id="ABF78336.1"
FT                   /translation="MQRAVARWRNASLRRRLLTWLLPAACVIGLVASAGTYWGALRELD
FT                   DLLDDQMRSMSKQIVVGPNGELSFSNHAKGKHGFEASDPDAVLLQVWRNGTLVYSTDRD
FT                   SKLPAPAQQGIASVDVGGQPWRTYVTERGGTTIRLAQARHARWEAIAGIAVHLLWPVFS
FT                   MLPLLALGLWFGIGAGLRPLRAIASGLKRRNANNLEPVDVASMPNEVRPLAEAINDLLA
FT                   RLDRSFTLQRHFIADAAHELRTPIMGLSIQSQLLRRAATVEEREHILAQIQAGTTRLGH
FT                   LAEQLLTLARLEPDAQAAVAASAPVDLAALCRSVVSDRARVADAHRIDLGAIVDAPVIA
FT                   AGNADTLRVLLNNLVDNAIRYAGEGARVDVSARIDGTTPVLEVADDGPGIPEAERTDVW
FT                   ERFYRGEGAQAATSSGSGLGLSIVKRIAEQHRASVALGTTRGGRGLTVTVRFPPPA"
FT   sig_peptide     complement(556354..556458)
FT                   /locus_tag="Bcen_3442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.946 at
FT                   residue 35"
FT   gene            complement(556464..557126)
FT                   /locus_tag="Bcen_3443"
FT   CDS_pept        complement(556464..557126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3443"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_B0768 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78337"
FT                   /db_xref="GOA:A0A0H2XVR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVR6"
FT                   /protein_id="ABF78337.1"
FT                   /translation="MRVLLVEDDPLIGSGLEQGLKQEGFAVDWVKDGDAASLALRATGY
FT                   GLLLLDLGLPNRDGLSVLAALRRRDENLPAIIITARDGVPDRIAGLDSGADDYLVKPFE
FT                   LDELLARIRAVNRRHAGRAQTTLAIGPLRLDPVKHLVWLDDDEVPLSPKEFVLLHELMR
FT                   EPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHDMIRTVRGVGYRIGDGT"
FT   gene            557361..557714
FT                   /locus_tag="Bcen_3444"
FT   CDS_pept        557361..557714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3444"
FT                   /product="conserved hypothetical protein 156"
FT                   /note="PFAM: conserved hypothetical protein 156; KEGG:
FT                   bur:Bcep18194_B0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78338"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUI9"
FT                   /protein_id="ABF78338.1"
FT                   /translation="MKHLARILAVALVALPAAVYAQYTGPSALTTTTVKELLANGKDDQ
FT                   HVQLQGRIVKHVGGEDYEFADATGTIRVEIDHKLWAAGQPVSDKNEVKLTGEFERKWSG
FT                   RVKVDADHVEVLR"
FT   sig_peptide     557361..557426
FT                   /locus_tag="Bcen_3444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            557770..558630
FT                   /locus_tag="Bcen_3445"
FT   CDS_pept        557770..558630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3445"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; KEGG:
FT                   bur:Bcep18194_B0770 transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78339"
FT                   /db_xref="GOA:A0A0H2XVU0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVU0"
FT                   /protein_id="ABF78339.1"
FT                   /translation="MAANFDELASRIRTQFSELSPQFQAGAAFLLDHPDEVATSSMRKV
FT                   AQRAQVQPASLVRLAQQFGFPGWNELRDLCVARVRTRPEPLTQRARSLVRPDAKASLAH
FT                   DLLAAQQHNLSATAAQNEHALADAAKLIRKASHVHVAGFRSCYPVAFGFVYGYRLFRPT
FT                   VSLLNGVAGSLEMELRTIAKQSVTVIVSFAPYSAEATRVAQAAKAQGSKIVAITDSAVS
FT                   PIALHADAQLIFTHDSPSFFPSLVAAHAMAETLVAQLLALEGSDAIAALERTEAELHAK
FT                   GAYVV"
FT   gene            558688..559113
FT                   /locus_tag="Bcen_3446"
FT   CDS_pept        558688..559113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3446"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0771 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78340"
FT                   /db_xref="GOA:A0A0H2XTN6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTN6"
FT                   /protein_id="ABF78340.1"
FT                   /translation="MTLTYAVTDAADAEVRKQIVAPLVRFNERQAGPADFRPLAVIVTD
FT                   AAGAVVGGLWGGTAFGWLHVDLLVVPEAARGQGAGTRIMDLAEREAVARGCHSAWLDTF
FT                   DFQARPFYEKRGYVRFGELPDYPVGHTRIFLTKKLAG"
FT   gene            559297..560964
FT                   /locus_tag="Bcen_3447"
FT   CDS_pept        559297..560964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78341"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV21"
FT                   /protein_id="ABF78341.1"
FT                   /translation="MKKLPPDAHPDHLKKQAKALLRLYRQGDAGAVARFVASLPAAVHR
FT                   THDETLALGLRLHDAQSCIAREYGFASWADLGVFVETHALTRQSRSLLSRRWLDLAYGA
FT                   DVTGGFGAARPRVAAQLLRDHPDLVSVDPVIACAAGDLDAVKAALAADPGWIARAGGAL
FT                   KLPPLVAVTHSRLGQLPEFAPRLRACARHLLDAGADPNQRIGNRYPPASLAEPDASAPL
FT                   SALYGAAGVNRDPALTAMLLEAGADPNDGESLYHSVENPACTRLLLEHGARVGGTNALR
FT                   RALDVPDAAALELLLAHGGDPNEPAGEGPTKTWGAPLLRAIAVRCPARHVAALLEAGAD
FT                   PRARTAAGVSAYRLAMQAGLSDVAALLRAAGAEETLDAQDAFVAACARADADDARRIQA
FT                   KHPELPGALSDDRLRLLPDAAAWGSREAVKVMVELGWPIAARGGDWDASALNHAVFRGD
FT                   AELLAFLLARGASWRELHGFGSDALGTLSWASVNEPEGVGDPDWEACARVLIAHGVPQA
FT                   VRDPSNPDRVLIDGRAMRFSEAVSDVLLGIDGGASAST"
FT   gene            561110..561970
FT                   /locus_tag="Bcen_3448"
FT   CDS_pept        561110..561970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3448"
FT                   /product="PEP phosphonomutase"
FT                   /note="KEGG: bur:Bcep18194_B0773 PEP phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78342"
FT                   /db_xref="GOA:A0A0H2XVS1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVS1"
FT                   /protein_id="ABF78342.1"
FT                   /translation="MTRSDQQARHAEAFRALHTRPGAFIIPNPWDAGTARLLAMAGFEA
FT                   LATTSAGYAFSKGRPDNAIDRDAMLDHIADLVAAGGLPVSADLENGFGDAPDTVAETIR
FT                   LAAEAGAVGGSIEDATGRADTPIYARDASVERIAAAVDAARALPFPFTLTARCENYLHG
FT                   RRDLDDTIARLVAYRDAGADVLYAPGITDADEIAAVTRAVGAPVNVVMGLQGGLLSLDE
FT                   LAALGVKRVSVGGALARAALGAFLRAATEMRRDGTFTFSRAAVAGSDINRWFAAPDNSP
FT                   ILSDE"
FT   gene            562315..562581
FT                   /locus_tag="Bcen_3449"
FT   CDS_pept        562315..562581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78343"
FT                   /db_xref="InterPro:IPR019226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUJ4"
FT                   /protein_id="ABF78343.1"
FT                   /translation="MTIRENHRVRFRVGDVVTLKTGGPRMTVTYAGPVVFDDDDWLICQ
FT                   WFDESGEFRQEMFHHDTVVPEPRAISAGRVRLRMQSHRYRSAA"
FT   gene            562683..563852
FT                   /locus_tag="Bcen_3450"
FT   CDS_pept        562683..563852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3450"
FT                   /product="cytochrome P450-like protein"
FT                   /note="KEGG: bur:Bcep18194_B0775 cytochrome P450-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78344"
FT                   /db_xref="GOA:A0A0H2XVU6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVU6"
FT                   /protein_id="ABF78344.1"
FT                   /translation="MNPTDPIAAVTHRDPYPYYAALVDGPPLAFDATLGLWVASRAAAV
FT                   TAVLCHPACRVRPLDAPVPPALRGTTAGALFGELVRMNDGASRHDVPKQALRAAFAPID
FT                   TEALRDRAEVLAARRLPAPGDADALNAWCMTVPVCAVADLLGFDETQLDDIAARVVEFV
FT                   AALSPLSDAAALARASDAARHLLDRMTERVAQSRAHDGTLVAAVQQADRASGWHASGAL
FT                   VANLVGLLSQTCEATAAWLGNALVAWNGDVGDSGGVPDAVALDAFVAEVGRFDTPVQNT
FT                   RRFVAARTTIEGVSVEAGDAILVVLAAANRDPAVHRDPHRLTPGRPAGPNFGFGTGPHG
FT                   CPGERIARAVTAGAFAARLRAGGWPPRDALKWDYRASTNVRMPKFDANR"
FT   gene            complement(563868..564194)
FT                   /locus_tag="Bcen_3451"
FT   CDS_pept        complement(563868..564194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78345"
FT                   /db_xref="GOA:A0A0H2XTP2"
FT                   /db_xref="InterPro:IPR016410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTP2"
FT                   /protein_id="ABF78345.1"
FT                   /translation="MHDAVLIQVAGSVAAIALYFLPAVIADRRGRHDKLTIAMFNALFA
FT                   WTGIGWLMTLYWACQPNPRTDVAQTILAKRRGVSMRTFSTGLVERVQRRVAAQEQWAEK
FT                   QGCR"
FT   gene            complement(564285..564704)
FT                   /locus_tag="Bcen_3452"
FT   CDS_pept        complement(564285..564704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3452"
FT                   /product="Rhodanese-like protein"
FT                   /note="PFAM: Rhodanese-like; KEGG: bur:Bcep18194_B0777
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78346"
FT                   /db_xref="GOA:A0A0H2XV26"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV26"
FT                   /protein_id="ABF78346.1"
FT                   /translation="MSHVTDVPAADNAAALAHFEASLRFETDCWDVHDAFASGTPDFVL
FT                   LDVRGPDQFAAGHVPGARNLPRRKIIESKLAGYPADTLFVVYCAGPHCNGAARAAIQLA
FT                   RLGRPVKLMIGGVTGWLDEGFALSNDVQPVDAEAA"
FT   gene            564819..565781
FT                   /locus_tag="Bcen_3453"
FT   CDS_pept        564819..565781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3453"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0778 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78347"
FT                   /db_xref="GOA:A0A0H2XVS6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVS6"
FT                   /protein_id="ABF78347.1"
FT                   /translation="MHNHLVVALAYDRLCTFEFGCVVELFALERPELGVDWYRFAVCAS
FT                   EPGPVRAAGGITVAAPYRLATLDRADTIVIPGWRDPDELPPEPLLKKLRAAHRRGARLC
FT                   SICSGVFVLAAAGVLDGLTVTTHWRYAERLQARYPALRVNPDALYVDEGQIVTSAGSAA
FT                   GLDMLLHLVRRDHGGAIANRVAQRLVLPPHRDGGQAQFVPRPVAPGGTDRLAKLIDWMR
FT                   AHAAEPHTLASLAAQAAMSTRTLQRQFADATGMSPLAWLIRERVNVAKDMLEAQPALSL
FT                   AQVAARAGFGSEESLRRHFRRVAATSPAAYRRGMDRGGT"
FT   gene            565868..566938
FT                   /locus_tag="Bcen_3454"
FT   CDS_pept        565868..566938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3454"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   bur:Bcep18194_B0781 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78348"
FT                   /db_xref="GOA:A0A0H2XUJ9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUJ9"
FT                   /protein_id="ABF78348.1"
FT                   /translation="MTMLPSRLPLIQAPMVGSLSPLAIAVCEAGGLGSLACAALGPQQL
FT                   RDEIAAIRARTAAPFNVNFFCHAPPAPDAEVDARWRAALAGYYAEAGLDPADVKGGPGR
FT                   APFDDAMCAVVEELRPAVVSFHFGLPHDTLLDRVRRTGAQVVSSATTVEEARWLDARGV
FT                   DAIVAQGAEAGGHRGMFLTDDIHAQPGLFALLPQIVDAVRAPVIAAGAIADGRGIAAAF
FT                   ALGASAVQIGTGYLLTPQAGRSAQHRAAVRAARDDGTRITNLYTGRPARGLLTRFMREQ
FT                   GPMSALAPAFPLATAAVDPLRGAFERQGRDDFSLLWSGEAAALAREEDAGELTRRLWRD
FT                   ALACAAGLRDAFPNAG"
FT   gene            567016..568470
FT                   /locus_tag="Bcen_3455"
FT   CDS_pept        567016..568470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3455"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; KEGG: bur:Bcep18194_B0782
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78349"
FT                   /db_xref="GOA:A0A0H2XVV3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVV3"
FT                   /protein_id="ABF78349.1"
FT                   /translation="MTSVDTTPVLDHDKLVTFIERKWNDEILHALTDYIAIPAKSPAFD
FT                   PDWAKRGYLERVVTDAAQWAERQPVKGLKLEIVRLPGRTPVIFFESPATRSGSTDTILL
FT                   YGHLDKQPEFDGWRADLGPWTPKFENGKLYGRGGADDGYAIYASLAALGALDEQGIERP
FT                   RCVGLIETCEESGSYDLLPYVDALRDRLGQVSLVVCLDSGAGNYDQMWLTTSLRGLVSG
FT                   DLQVEVLEEGIHSGVYGGIAPSSFRVMRQLFERLEDAKNGNLLPGAFHCEIPSSRVREA
FT                   EAAAAILGDTVWKGLPWACGQDGKPVLPTTTDPREALLNSTWRPSLSVTGAAGMPALAD
FT                   AGNVLRPRTAFKLSLRLPPLVDAAQAVQQLKELLELDPPYNAKVTFKPDAGAATGWSAP
FT                   DLAPWLASSLDAASRRHFGADCAYMGLGGTIPLMNVLQEGFPAAQFMVCGVLGPKSNAH
FT                   GPNEFLHVPYAKKLTAAVADVIATAR"
FT   gene            568531..569640
FT                   /locus_tag="Bcen_3456"
FT   CDS_pept        568531..569640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3456"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   bur:Bcep18194_B0783 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78350"
FT                   /db_xref="GOA:A0A0H2XTP7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTP7"
FT                   /protein_id="ABF78350.1"
FT                   /translation="MTALPTPDTAPLRMRAEPLHAFVAALWERAGSNPREATLVADHLV
FT                   GANLAGHDSHGIGMIPNYVASWREGQLQLNGHASIVRDGGAVLTIDGGRGFGQVIAFEA
FT                   MVEGIERARRMGICAIGLRDVHHLGRIGHWAEQCAHAGLVSFHFVNVPGDLLVAPLHGT
FT                   DPRFGTNPFCAAYPRAGKPPLLLDFATSAIAYGKTRVAYNQGKRVPAGSLIDHRGQPTD
FT                   DPAVMHEQPFGALLPFGLHKGYALAAMCEIFGGALVGGHTTYGDTLQKTSAIVNGMLSV
FT                   LIDPKAFDAADAECEADAFVAWAKASPQAGDTPVQVPGEPEEASRAARGTSGIPVDRTT
FT                   WRQIRESAAAVGFDAAELDAWTRRCEASA"
FT   gene            569637..570296
FT                   /locus_tag="Bcen_3457"
FT   CDS_pept        569637..570296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3457"
FT                   /product="TfoX-like protein"
FT                   /note="PFAM: TfoX-like; KEGG: bur:Bcep18194_B0784 TfoX-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78351"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV31"
FT                   /protein_id="ABF78351.1"
FT                   /translation="MSWQAEKAHGEEIAYQLAPLGTVAVARFFSGAALRLDGVMFGFMS
FT                   RGSLFLRVDDVNRPAFVAAGMGPFSYARPTRTVSLEGYYETPADVLEDAGALFDWCRSA
FT                   YRAALLAGPPKRKARAASKTVSGAGPKAAPKTAVKAAPKPASKSSTNPATKPATKPLSK
FT                   PATKPATKPATKPASAQKTKQAAKSTSKPASAQKPKPASKSSPAPAPKRVAKRKQT"
FT   gene            570599..571177
FT                   /locus_tag="Bcen_3458"
FT   CDS_pept        570599..571177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3458"
FT                   /product="NnrU"
FT                   /note="PFAM: NnrU; KEGG: bur:Bcep18194_B0785 membrane
FT                   protein, NnrU-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78352"
FT                   /db_xref="GOA:A0A0H2XVT1"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVT1"
FT                   /protein_id="ABF78352.1"
FT                   /translation="MLVLILGLAIFLGVHSIRIVADGWRSATIERIGEKGWKGGYAIAS
FT                   IVGFVLIIWGYGIARAGATLLWVSPVGVRHLTGMLTAVAFVLIAASYVPRNRIKTLVGH
FT                   PMLAGTMVWAVAHLLVNGTVHAVVLFGAFFVWSIVDFVVSRARDRRDGVRYPAGGLAGD
FT                   VATVVAGLVAWAVFARFLHGPLIGVRPFG"
FT   gene            complement(571211..572590)
FT                   /locus_tag="Bcen_3459"
FT   CDS_pept        complement(571211..572590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3459"
FT                   /product="gamma-aminobutyrate:proton symporter, AAT family"
FT                   /note="PFAM: Spore germination protein; KEGG:
FT                   bur:Bcep18194_B0786 amino acid tranporter; TC 2.A.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78353"
FT                   /db_xref="GOA:A0A0H2XUK4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUK4"
FT                   /protein_id="ABF78353.1"
FT                   /translation="MQDNTLRQSLKQRHITMIALGGVIGAGLFVGSGAIIATAGPAAIL
FT                   SYLIGGVIVTLVMFMLGEMASRNPDSGSFSTYASSYLGEWAGFAVGWLYWFKSMMTITV
FT                   EAILLGAILHDFLPWLPVWGGALFMLVTLIASNAYSVRSFGEAEYWLSFAKVATIIVFM
FT                   ALGASILLGFQPRIPAPGLVNLTDHGGFMPNGISPVLAGVMVVIFSLGGSEIAAVAAGE
FT                   SENPSRNVIRAIKSVIVRVMVFYVGSVSILILCMPWTDKANLKSPYVSLFGMAGFTGAA
FT                   VAMKIVLFVSFMSVMNSFLFSNSRMLFSLSQRGHAPAMFGRTNAKGVPMNALVLCLAIC
FT                   VSILGIHFVSGGDLFLMLAKSSGAFVMIVWIFIVVAHFAMRRQTKHEQRDPTAFRAWFY
FT                   PVSNWVALLALVAVLGSQAFNPDSRFQFWFTVLTALAIVAAYFLRRRQPSFGQAAGAKS
FT                   R"
FT   sig_peptide     complement(572471..572590)
FT                   /locus_tag="Bcen_3459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.706 at
FT                   residue 40"
FT   gene            complement(572880..573617)
FT                   /locus_tag="Bcen_3460"
FT   CDS_pept        complement(572880..573617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3460"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bur:Bcep18194_B0791 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78354"
FT                   /db_xref="GOA:A0A0H2XVV7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVV7"
FT                   /protein_id="ABF78354.1"
FT                   /translation="MLALVIIAGLWAGLQNALAGGGSFVTLPALIVSGMSPLAANITST
FT                   VALFPGQVTTGWASRNMVSGVGRLPFRALFAISVAGGALGGLLLLKTPSSIFSHLVPWL
FT                   VLFATIVFAWGSFFRKPGAGAQHLGPVAAGVSQFLIAIYGGYFGGGIGFLMMAALTMAG
FT                   LPPRHAMSTKNALAGVMNASAVVLFVTSPHLHWRAAIALGGGAIVGGLLGAWALHRVNE
FT                   RVLRIAIVCIGALLTIGLFVKPI"
FT   sig_peptide     complement(573558..573617)
FT                   /locus_tag="Bcen_3460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.888) with cleavage site probability 0.877 at
FT                   residue 20"
FT   gene            complement(573738..574322)
FT                   /locus_tag="Bcen_3461"
FT   CDS_pept        complement(573738..574322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3461"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   bur:Bcep18194_B0793 protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78355"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTQ3"
FT                   /protein_id="ABF78355.1"
FT                   /translation="MTLPFYTIGHSNRTLDEFVDLLDAVEITLLADIRKMTRSRTNPQF
FT                   NEATLPDALAAADIAYEHIAELGGLRGKSHGVPDDVNDFWTNRSFHRYADYALSPAFHA
FT                   GLDQLIAQGHEQRCAIMCSEAVWWRCHRRIVSDYLIARGETVLHIMGRNRVELARLTAG
FT                   AVVRDDGTIVYPNVDDDHDDAAPAKGAQPDA"
FT   gene            complement(574319..574552)
FT                   /locus_tag="Bcen_3462"
FT   CDS_pept        complement(574319..574552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78356"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV35"
FT                   /protein_id="ABF78356.1"
FT                   /translation="MTTPFRLGDHVRWNSEAGYVTGTIIAIHTADFDYKGHRHRHRASP
FT                   DDPQYEIKSDRTDHVAAHRGRVLERIAGKDDA"
FT   gene            574839..576128
FT                   /locus_tag="Bcen_3463"
FT   CDS_pept        574839..576128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3463"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B0802 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78357"
FT                   /db_xref="GOA:A0A0H2XVT6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVT6"
FT                   /protein_id="ABF78357.1"
FT                   /translation="MFVQSDRHVASYYAGTYPAPIPHRPALDERVDADVLVVGAGFSGL
FT                   HTALRLALAGKRVVMLEASRVAWAASGRNGGQALLGWSCDMQPLEDALGRDGARLLWDS
FT                   MRWAAAEVRELPARHGFDIDYRPGSLWAAVRPRRVAMLAHARDEAAERWGYDRLRMIER
FT                   DEMPEWIGGTRYLAALHDPEAGHLNPLKLALGLARTIERAGGRIFERSRVLDWRETASG
FT                   YVARTARGEVRADVLVLACNAYVDRLDRDLARRLLPVGTYQVATAPLAADVAHALLPRN
FT                   SCVIDNQFVPDYFRLSPDNRLLFGGGCTYLGGIPADIAAATRPHLERVFPQLAGVPLDY
FT                   AWGGHIDISMRRTPDIGRHGQRFWLQGFSGHGVLPTLAGARAVADAVLGDARLLAQYQR
FT                   IRNPRFPGGDRLAAPLEAIGKAWYRLRDTV"
FT   gene            576151..576708
FT                   /locus_tag="Bcen_3464"
FT   CDS_pept        576151..576708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3464"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif; KEGG:
FT                   bur:Bcep18194_B0803 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78358"
FT                   /db_xref="GOA:A0A0H2XUL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL0"
FT                   /protein_id="ABF78358.1"
FT                   /translation="MNEQEEIESLAILIRDLRKHRKVTLNDLAERIGRSVGFLSQVERG
FT                   LSRPTVADLTAIGEALGVPTTYFYSLSKPRSVRWVTRPDERRTVYYAAGITDILVSPNM
FT                   RARFSILESHLEPGASSGERPVDDSDEQGGFVLEGELTIWIDGDDTPVTLGPNDAFQLP
FT                   AHKRFRYANLTDAPTRVIWVFT"
FT   gene            576866..578212
FT                   /locus_tag="Bcen_3465"
FT   CDS_pept        576866..578212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3465"
FT                   /product="glutamine synthetase, catalytic region"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   bur:Bcep18194_B0804 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78359"
FT                   /db_xref="GOA:A0A0H2XVW2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVW2"
FT                   /protein_id="ABF78359.1"
FT                   /translation="MADVVPALVSEVRAFRQAHPEIRYVDLICLDLPGHFYGKRYPIDA
FT                   LEKVAAGSLLKLPQNCILLGTQGGLYKIGDYCFNDGDPDAVRRLIPGTLKPVTWEKQPL
FT                   GQMLITTDGTDSPVEFEPREVLARVLKRLARRGIRPVVAFELEFYLFAAQLEEGMPKYP
FT                   RDRLSDDRDDQPNMHIERLSRFSDVLHEMVDVACAQGIDATVITAELGPGQFEINFGHC
FT                   DDGLRAADWSAMFCRSTRGVALQHGYRASFMGKPYLHAPGSGMHVHVSLYDDAGNNLLA
FT                   ADDQRPLRHAVAGCLALLPHCMPVFAPNHNAFRRYGSMVNAASRASWGFEDRDACIRIP
FT                   ESDARNLRIEHRLASADANPYLVLAAILSGMEHGLDAKSEPIAPLNDDRGSGIDFPKEM
FT                   LSAVAAMQDHPAVRDGLGSEFVMVYCENKRQEELDFRNEIGAREYRWFL"
FT   gene            complement(578236..579414)
FT                   /locus_tag="Bcen_3466"
FT   CDS_pept        complement(578236..579414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3466"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bur:Bcep18194_B0809 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78360"
FT                   /db_xref="GOA:A0A0H2XTQ8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTQ8"
FT                   /protein_id="ABF78360.1"
FT                   /translation="MNIAILGAGVAGMSTALALAGRGHEIRLYERRPAESTMGAGVVLW
FT                   PNAGFVLTQLGVLPDIVEAGGRLHAMRRIDRHGTLLKATEIGALDHRMGFPTVSILRRD
FT                   LQAVLTRHLAARGIEVHFGHGATAIDTGADGRAVVRFDNGTTIAPDLVIGADGRMNSVA
FT                   RRHVVGDNTPVYQGFVNWIGIAQSNAPLVDEVSIFDYWGTRERFGIVALDRHRVYWAAA
FT                   WPEADGCDAAEDDPHGMLERRFAPWPAPITDVIRATPADTLTKIRVHDLDPVDVWHRGN
FT                   VLLIGDAAHAPLPTSGQGACQALEDAWHLARCLDEYDSANGGALDAALAAFTLRRSGKT
FT                   ASITERAREFAHLLFSDDVSDSARQRIDPVAEIEALTNAWGAHLPMEQARGR"
FT   sig_peptide     complement(579358..579414)
FT                   /locus_tag="Bcen_3466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.500 at
FT                   residue 19"
FT   gene            579559..580494
FT                   /locus_tag="Bcen_3467"
FT   CDS_pept        579559..580494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3467"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0810 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78361"
FT                   /db_xref="GOA:A0A0H2XV43"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV43"
FT                   /protein_id="ABF78361.1"
FT                   /translation="MRSKLDLNAVRVFVTVVDEGSFAGAARVLALPGSNVSRYVAQLES
FT                   RLGVRLLERSTRHLRMTEAGRLLHERARPMLDALTQAECELTSQQTELRGVLKLCVPGE
FT                   IGPRMLGPIVAEFASHHPRVEIDCDTSLAGVSTLRDDIDLSIIVNRGKLDDSAFVVRPL
FT                   VSLPSVVVAAPSLVARVGMPGLTEQLKQLPCITTLSTLKGQPWQFADRDGRIHKIPVAS
FT                   RYRVNSGEMAGLAAVNGIGFAILVERACAVELAEGRLVRVPLEMAPAPLQLHAAYASRN
FT                   SVNAKIRALLQLMQQRLATEEALPSSRPLR"
FT   gene            complement(580474..581067)
FT                   /locus_tag="Bcen_3468"
FT   CDS_pept        complement(580474..581067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3468"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0811 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78362"
FT                   /db_xref="GOA:A0A0H2XVU3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVU3"
FT                   /protein_id="ABF78362.1"
FT                   /translation="MNPAGSSAAYGNRPHGRHMAPNTTTIDIRAATSADAPAIASIHVA
FT                   SWQATYTGIMPAQFLADLSVEKRTAAWRETLDAGRPHVALAFANHAPTGWIAYGPTRDA
FT                   DKDGAWGEIEAIYLHPSHCGQGIGARLVDHACRALHDAGHASVSLWVLAKNRRARMFYE
FT                   REGFVAEADIKTFEIDGTPIEEVRYWRALPKRSR"
FT   gene            complement(581064..581642)
FT                   /locus_tag="Bcen_3469"
FT   CDS_pept        complement(581064..581642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUL5"
FT                   /protein_id="ABF78363.1"
FT                   /translation="MRHEFSEVLNDLIDYFLVGDLLLLKRYKDEHGLPDDVASAFTTGD
FT                   SGDHAVLEGIVIPLAGIENHPYTVIFTLDDDTPELLKAGSRLQHRRGGYVLRVEHRAVM
FT                   LYTWRILERFTDDTVNALLARYREPGRPVIEVDNGWYDVEILGGEIARDGWFEPAFEFV
FT                   LKKTDAPGDASHVDIHYRFAIEGSLGPAA"
FT   gene            complement(581708..582097)
FT                   /locus_tag="Bcen_3470"
FT   CDS_pept        complement(581708..582097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3470"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   bur:Bcep18194_B0813 protein of unknown function DUF1311"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78364"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVW7"
FT                   /protein_id="ABF78364.1"
FT                   /translation="MKKKNLLASCALLALAVPFAGHAAGCGKPRSAFDQVYCTSTQFSQ
FT                   SDRDLNDEYGRLRKQLSGDQQATLKTGQLAWLKQRDAQCSETRGSSYLVDIQCANDMTQ
FT                   SRLSFLRERERECSSTGCVTSKLGE"
FT   sig_peptide     complement(582026..582097)
FT                   /locus_tag="Bcen_3470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.929 at
FT                   residue 24"
FT   gene            complement(582152..582913)
FT                   /locus_tag="Bcen_3471"
FT   CDS_pept        complement(582152..582913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3471"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   bur:Bcep18194_B0814 cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78365"
FT                   /db_xref="GOA:A0A0H2XTR3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTR3"
FT                   /protein_id="ABF78365.1"
FT                   /translation="MTNRTLRRLPLVRAAARVLACAPLLCAPLALHAADVATTTVTEPA
FT                   SGHYIVVDTGHTPAHPGSTGASGRVEYLYNLDLSGAVADKLAAHGDRVLHTSADGREIK
FT                   LDQRSTQAPDANLFVSIHHDSMQQQFIDAGRQREFRGFSVFVSERNPHYAESLRCAKAI
FT                   AERLVAAGERPSLYHAQPIRGENRPLIDPQLGIHRFDDLVVLRTAPIPAVLVEAGVIVN
FT                   PDEEARLARRETIQRLSAAIASGIDACTTPQ"
FT   sig_peptide     complement(582812..582913)
FT                   /locus_tag="Bcen_3471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            complement(583038..584657)
FT                   /locus_tag="Bcen_3472"
FT   CDS_pept        complement(583038..584657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78366"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV49"
FT                   /protein_id="ABF78366.1"
FT                   /translation="MDRRTFLVASAAASLAACGRTGWIETTPQVGYPGMREGHALRDHA
FT                   TLPAPSGTIETDVAILGAGAAGLSCAWQLARAGHTRFTVLAGPEFGGNAAGGHFGDLGY
FT                   PKGAHYLPLPSLESAHLRDMLADLGVIESAPFSVRPVYDERALVHAPDERLFIGGQWQD
FT                   GIVPTTGLDADALAQQARFFAYTDGLRTARGADGRKVFCIPIAESSRDPRWRALDRRSF
FT                   RQWLRDEGYTAKALHWYLNYCCRDDYGAGYEHVSAWAGLHYFSSRGGHAGDASDGAVLT
FT                   WPDGLHTMVTKLSDSITARTGSNAWSRDGFAVRATERAGGVDVLCARVGHDGTLSTFTL
FT                   KARRVVCAMPLFVAARVFPQLATYGFEPARDLPPRAPWLVSNFLLDGMPAEEAGVPLAW
FT                   DNVVYDGAGLGYVVSTHQLIRMSPPTRSVFSAYQALSTQTPDDTRRWLAQAKPDALREQ
FT                   AALDLQAVYGRELWKHATALEITVRGHAMATPDVGFLSRPGLLALRDADGPVVFAHADL
FT                   SGLSLFEEASYWGMLAAHRVLA"
FT   sig_peptide     complement(584598..584657)
FT                   /locus_tag="Bcen_3472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.906 at
FT                   residue 20"
FT   gene            complement(584657..586171)
FT                   /locus_tag="Bcen_3473"
FT   CDS_pept        complement(584657..586171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3473"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: bur:Bcep18194_B0816
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78367"
FT                   /db_xref="GOA:A0A0H2XVU9"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVU9"
FT                   /protein_id="ABF78367.1"
FT                   /translation="MLHKRALVLSILVLASCGLGYELISSALSSYLLGDSILQFSSVIG
FT                   CYLFAMGIGSWLAKFVEDDDVLDRFVDIELLVGLLGGVSAALLFVVFAWLAAPFRAALY
FT                   ALVLALGLLIGMEIPLVMRAFQQRRQAFRHTVSEVLTFDYLGSLAVSLIFPLVLAPRLG
FT                   LLRTSFLFGLLNAFVALWTTHLFRDEIRNVRGKLMRASLVIGLLVAGFALSDRITHWAE
FT                   HGVYGDETIYSETTPYQRIVLTQWHDDMRLYLNGNLQFSSRDEHRYHEALIHPAIEALP
FT                   WAKRVLVLGGGDGLAVRELLKHRNLEQITLVDLDPAMTKLFSTSAPLVKLNQGALKDPR
FT                   VHVINDDAVRWLESNADVYDAIVVDFPDPTNFGLGRLYSVPVFRLLARHLSENGYTVIQ
FT                   STSPYFAPHAYWTIIATLHEAGLNTWPYHCYVPSFGDWGFVIAGKRRDFTVPTHYSVPT
FT                   RWLDAQTAAEMFHFPADMPALSMSPNELNDQPLVRRFDDDWKHVLR"
FT   sig_peptide     complement(586109..586171)
FT                   /locus_tag="Bcen_3473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.884 at
FT                   residue 21"
FT   gene            586293..586679
FT                   /locus_tag="Bcen_3474"
FT   CDS_pept        586293..586679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3474"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   bur:Bcep18194_B0817 protein of unknown function DUF350"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78368"
FT                   /db_xref="GOA:A0A0H2XUM0"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM0"
FT                   /protein_id="ABF78368.1"
FT                   /translation="MNSAYLYAVHLLSAFVLLLVFAAVYLKVTPFDELALIRDGNAAAT
FT                   LSFGGALIGFCLTLASSIAHNSTLGEVVIWAVGAMIVQLITYAVLTRVMPGMNHAIEDR
FT                   NVAMGGLMGTASLVVGIINAACLT"
FT   sig_peptide     586293..586361
FT                   /locus_tag="Bcen_3474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.728) with cleavage site probability 0.431 at
FT                   residue 23"
FT   gene            586707..587747
FT                   /locus_tag="Bcen_3475"
FT   CDS_pept        586707..587747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3475"
FT                   /product="putative virion core protein"
FT                   /note="KEGG: bur:Bcep18194_B0818 putative virion core
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78369"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVX2"
FT                   /protein_id="ABF78369.1"
FT                   /translation="MSLGSFIRKQFIDVLQWTEDTDGVLAWRYPMEDQEIQYGGKLTVR
FT                   ETQVAIFVNEGKVADVFQPGLYTLETRTLPVLTNLKNWDKFFQSPFKSDVYFFSTRLQL
FT                   GRRWGTAQPVTIRDREFGFVQLRAFGIYSYRIVDAAAFHREVSGTRAAYTVDDLEQQLR
FT                   NLVVTAMSTTFGSADVPFVDMAANQSLLSQRVAEALVPVFTRYGLALDAFAVESVSLPA
FT                   KLQKALDLRIGAGMAGDLARATQYQTAQAIPLAAQNPGGIAGVGAGLAAGAAIGQAMAG
FT                   QIAGAAQPAQAAPPTPVAAPVAAAAAESTDYVQRLEQLKALFDKGLVTEDEYSRAKAEI
FT                   LAKLTR"
FT   gene            587757..589274
FT                   /locus_tag="Bcen_3476"
FT   CDS_pept        587757..589274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78370"
FT                   /db_xref="GOA:A0A0H2XTS0"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTS0"
FT                   /protein_id="ABF78370.1"
FT                   /translation="MFRTSCPQCGAPVEFRSAAAVMAVCAFCRSTLLKRGTEVERIGEL
FT                   ATVLDDASPIQIGTAGRYDKRAFTVLGRIQMTYDAGAWSEWYVVFDDGAFGWLSDASGQ
FT                   YAITVREPDDASGGAWPAFDTLEPGMRIDHGGRAYLVSDVRTARCTGGDGELPFRVDAG
FT                   WEARVADLRTGNAFATCDYSDAGSNGGSPAVYAGEALEFDALAFTGLRDIENDTREKRG
FT                   AELVPFACPSCGAPLSYAPNVADYVVCGSCHAGVQCTAEQQTVFAARRKLESVKGALEL
FT                   GAIGTFDGVKYTVIGMMRCRVPGDDETWDEYLLLNPKRGFLWLVQSEGRWERVQVLDHW
FT                   PTIGSESGNVTEGGKTYRLREEYESEVVYVVGAFNWRVQAGDRTSIIDYGWQKDKLTRE
FT                   RSDAEIVWSRARPLSGGALAERFGTPALAAATTAATGATESMGLFGSKGPHSFAPLPFM
FT                   FSALLVIFNLGSLFSFTGRSVYVLVGLLVLWLPEWLWKRFASDGGNA"
FT   gene            589417..589800
FT                   /locus_tag="Bcen_3477"
FT   CDS_pept        589417..589800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3477"
FT                   /product="S-adenosylmethionine decarboxylase related"
FT                   /note="PFAM: S-adenosylmethionine decarboxylase related;
FT                   KEGG: bur:Bcep18194_B0820 S-adenosylmethionine
FT                   decarboxylase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78371"
FT                   /db_xref="GOA:A0A0H2XV54"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV54"
FT                   /protein_id="ABF78371.1"
FT                   /translation="MTARDGIAPPCATLGSHVLADLAGIDAALLRDAARLEAILTDAAR
FT                   WAGARVIGAHFHHFGGEHGVTGVVLLAESHITIHTWPEHRFAAVDAFMCGAARAADAVD
FT                   AIAAALGTHAQVRQQMARGSALA"
FT   gene            complement(589922..590374)
FT                   /locus_tag="Bcen_3478"
FT   CDS_pept        complement(589922..590374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78372"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVV5"
FT                   /protein_id="ABF78372.1"
FT                   /translation="MRISVSRTVGVDRRRLFTWSQDYGRRLVWDNFLSDAYLLDGTTAD
FT                   VGVDAFCRSQSGATMVSRYISYRPPQVAAVEMVEGPKVLERFSGSWNFVEHTPGSTEVK
FT                   FTYHFRAQPSWLRWLLEPLIGAFYLVQTRRRLDSFKRWAEAEALPR"
FT   gene            590566..591606
FT                   /locus_tag="Bcen_3479"
FT   CDS_pept        590566..591606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3479"
FT                   /product="Cytidyltransferase-related"
FT                   /note="TIGRFAM: Cytidyltransferase-related; PFAM: NUDIX
FT                   hydrolase; KEGG: bur:Bcep18194_B0825
FT                   cytidyltransferase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78373"
FT                   /db_xref="GOA:A0A0H2XUM5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM5"
FT                   /protein_id="ABF78373.1"
FT                   /translation="MSTQQNRRFDALVFIGRFQPPHRGHLNVLKSALSRAERVCVLIGS
FT                   TDKPRTIKDPFSFDERRQMLASLLDASERDRVTIAPLQDSTYNDGDWVRWVQDAVAVAL
FT                   GDVAQRKVGLIGHEKDATSYYLRMFPQWELVDVDATEDIFATEIRDQYFAERTNSFVQW
FT                   AVPEPVFGWLERFRTQPEFAQLKSEAEFIAAYRKAWAAAPYPVTFVTVDAVVVHSGHIL
FT                   LVRRRSEPGRGLWALPGGFVNQDERLDAACIRELREETGLKLPEPVLRGSIKDRQVFDH
FT                   PTRSLRGRTITHACLFNFPTGELPRVKGSDDADKARWVPLNEFAQMRNVMFEDHFDIAY
FT                   HFLGKL"
FT   gene            591680..593113
FT                   /locus_tag="Bcen_3480"
FT   CDS_pept        591680..593113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3480"
FT                   /product="Nicotinate phosphoribosyltransferase-like
FT                   protein"
FT                   /note="PFAM: Nicotinate phosphoribosyltransferase and
FT                   related; KEGG: bur:Bcep18194_B0826 nicotinate
FT                   phosphoribosyltransferase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78374"
FT                   /db_xref="GOA:A0A0H2XVX6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041529"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVX6"
FT                   /protein_id="ABF78374.1"
FT                   /translation="MQNDPGGFAAVLANPILNTDSYKASHFLQYPPDASAMFSYVESRG
FT                   GRYDRTLFFGLQMLLKEYLCKPVTHAMIDDARDFFTVHGEPFNEAGWRHIVERYDGYLP
FT                   VKIRAVPEGSIVPVHNVLMTVECDDPQVFWLASYLETMLLRIWYPVTVATRSWHLRQTI
FT                   RRFLERTDDDLAQLPFKLHDFGARGVSSAESAAIGGAAHLVSFMGSDTVLGVLAANRFY
FT                   REPMAAYSVPAAEHSTITSWGREGEADAYRNMIKRFGLPGAIVSVVSDSYDLFAALDLW
FT                   GGELRQAVIDSGATLVVRPDSGDPVTIVLQTVRALDASFGSTVNGKGRRVLNHVRVIQG
FT                   DGVDEQSIEAILVALDEAGYAAGNVMFGMGGALLQRVNRDTQRFAMKCSAIRRGDVWHD
FT                   VRKDPVTDQGKRSKQGRLTLLRNWRSGEYRTVTLPVAWDDRALEGEWDEALETVFDTGR
FT                   LLVDTSFAEVRARAHAGEV"
FT   gene            complement(593156..594631)
FT                   /locus_tag="Bcen_3481"
FT   CDS_pept        complement(593156..594631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3481"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   bur:Bcep18194_B0828 transcriptional regulator, GntR family
FT                   with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78375"
FT                   /db_xref="GOA:A0A0H2XTS4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTS4"
FT                   /protein_id="ABF78375.1"
FT                   /translation="MRHSAPIPAPPAPSRTRVETVMDTLRARIASRALMPGARVPSIRM
FT                   MADALSVSKSTVVDAYERLASEGVLVARRGSGFYVSGHAPPLALAELGPRLDRELDPLW
FT                   LSRQSLEAAPTSVKPGCGWLPSSWLPDESLRRALRAVSRDEADALTDYATPLGLPALRQ
FT                   QLAWRLAQHGVHAEPAQIMLTDGGTHALDLVCRLLLEPGDTVVLDDPCYFNFQALLRAH
FT                   RARIVSVPFTPNGPDLVRFEQVLAEHRPRLYITNAALHNPTGATLAPPVAHRLLTLAAE
FT                   HGLLIVEDDIFADFESTPAPRLAAFDGLSRVVSIGSFSKTLSAAIRCGYVAARPEWIDA
FT                   LVDLKLATSFGNAQIGANVVHRLLIDGTYRRHLDSLRARLADAMGETIRRLGRAGLAIW
FT                   TEPRGGLFVWAELPNGLDAARVARHALDHDVVLAPGNVFSASRSATSYLRFNVSRCKGP
FT                   AVFDALARAMEATRVGERGGAPADAGSPVLTGK"
FT   gene            594756..595643
FT                   /locus_tag="Bcen_3482"
FT   CDS_pept        594756..595643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3482"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B0829 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78376"
FT                   /db_xref="GOA:A0A0H2XV60"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV60"
FT                   /protein_id="ABF78376.1"
FT                   /translation="MQKTTDGWLSGLLGVIIFSGSLPATRVAVQGLDPLFLTFARATIA
FT                   GALGLLLLVVLKQKRPSRAEAVSLAIVALGVVVGFPLLTALALKHVTSAHAIVFVGLLP
FT                   LATALFGVWRGGERPRLPFWIFSIVGSGAVAAFALRNGGQASVVGDALMLAAIVACGLG
FT                   YAEGARLSRQLGGWQVISWALVLSLPLMLPLTWLTWPASFDGVAAAALWGLAYVSLFSM
FT                   LIGFVFWYRGLALGGIAGVGQLQLLQPFFGFLLAAGLLHETVPPSMVVVTVVVVGCVAG
FT                   AKYFSKMAPVQRAG"
FT   gene            complement(595837..597075)
FT                   /locus_tag="Bcen_3483"
FT   CDS_pept        complement(595837..597075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3483"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: bur:Bcep18194_B0837
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78377"
FT                   /db_xref="GOA:A0A0H2XVW0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVW0"
FT                   /protein_id="ABF78377.1"
FT                   /translation="MSLDSRQLAALAQQYGTPLWVYDADVIRDRIAQLRQFDVIRYAQK
FT                   ANSNVHILKLMRDEGACVDAVSLGEIERSLAAGFSPSGEPEGVVFTADLIDRPTLAAVL
FT                   KHGVTVNAGSLDMLARIGEHAPGHRVWLRVNPGFGHGHSNKTNTGGPQSKHGIWIDDVP
FT                   RAIEIVRQYGLKLVGIHMHIGSGVDYGHLSQVCDAMVDLVTSLGHDIDAISAGGGLSIP
FT                   YRDGEPRVDVGHYFNQWDAARKRIERHLGHPVRIEIEPGRFLVAEAGTLVTEVQAVNRR
FT                   PKHDFVLIDAGFNDLMRPSMYGSYHAVSVHAHDGALPAGRPLVDLAIAGPLCESGDVFT
FT                   QDAGGVVTHRKLAQPQIGDLLFLHDAGAYGASMSSNYNSRPLAPEVLVDRGTPRLIRRR
FT                   QTIGELLALETFE"
FT   gene            597184..598098
FT                   /locus_tag="Bcen_3484"
FT   CDS_pept        597184..598098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3484"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0838 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78378"
FT                   /db_xref="GOA:A0A0H2XUM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUM9"
FT                   /protein_id="ABF78378.1"
FT                   /translation="MLTHRHIEVFRALMVTGSTTRAAEMLYTSQPTISRELARMEQVVG
FT                   FALFERAHGRLRPTMAALTLFDDVRLAYVGLERVAATAARLREFRDGQLSVIALPAFSH
FT                   AILPGACRRFHDAHAGVSVSVATQESPVLEEWLTAQRYDLGLTEHDVAPAGTVLTPLLE
FT                   VDEVCVLPDGHPLLAQDAIDLLDLVDRPFVSLSLNDPYRIMIDEAFAQLGVAPRSVVDT
FT                   PSAVSVCAFVRQGLGAAIVNPLTALDFVGRGLHVRPLTRSFPYRVSVIVPEHRPKSLLV
FT                   DAFADALRGEAKAIRRRLAAHLG"
FT   gene            598111..598758
FT                   /locus_tag="Bcen_3485"
FT   CDS_pept        598111..598758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3485"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0839 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78379"
FT                   /db_xref="GOA:A0A0H2XVY3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVY3"
FT                   /protein_id="ABF78379.1"
FT                   /translation="MMGVSPPSPSFSGNPVMTDASSFLEQPTLTGERVVLRPLAASDRQ
FT                   ALLDAAADGELWNLKVTVVPGAQTVDAYIDTALQGRAAGTVMPFVIADRASGRAIGSTR
FT                   FWKIDRGNRKLEIGHTWLSESAQRTRANTEAKWLLLAYAFDTLRCVRVQFTTDELNEKS
FT                   RAAILRLGAKQEGIVRHERIMPDGRKRNSVRFSIIDDEWPDVRARLEAKLAT"
FT   gene            complement(598880..599458)
FT                   /locus_tag="Bcen_3486"
FT   CDS_pept        complement(598880..599458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78380"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTS8"
FT                   /protein_id="ABF78380.1"
FT                   /translation="MNRFPHISRLALSAAGLLLVAVTATAQTAQPAPAASAAPAATATR
FT                   IHEADQTFITDGTKTVSTQHDAARIADSRTSDSQVKAFAQRVSTDDAKIIQAMRAASPR
FT                   GVDVPANDPDTTVLNSIKSLRGAEFDKAYIEQVALAGQQKTISAFQAEIASGRDTKLKE
FT                   VARQALPILQAHYADAQKLAQRHHLASAQ"
FT   sig_peptide     complement(599378..599458)
FT                   /locus_tag="Bcen_3486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.700 at
FT                   residue 27"
FT   gene            complement(599865..600488)
FT                   /locus_tag="Bcen_3487"
FT   CDS_pept        complement(599865..600488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3487"
FT                   /product="Haloacid dehalogenase-like hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase-like hydrolase; KEGG:
FT                   bur:Bcep18194_B0841 haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78381"
FT                   /db_xref="GOA:A0A0H2XV65"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV65"
FT                   /protein_id="ABF78381.1"
FT                   /translation="MTYRLIAFDFDGTLADSLDSFLAALSEASRLHGFRDATPELRPAL
FT                   RGMSARDIIRALDVPMWKVPRVTIDMRRLMRPRIANVRLFPGVDETFDALAARGIRIAI
FT                   ATSNTEEIVRDRLGPRAGARVDHFACGIPLFGKARRLRALVHEAGVRADEVLYVGDEIR
FT                   DADAARHARIAFQGVAWGYTAPDALQAHCATPLLPRLDALLDRV"
FT   gene            complement(600538..600804)
FT                   /locus_tag="Bcen_3488"
FT   CDS_pept        complement(600538..600804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3488"
FT                   /product="Addiction module toxin, Txe/YoeB"
FT                   /note="PFAM: Addiction module toxin, Txe/YoeB; KEGG:
FT                   bur:Bcep18194_B0843 addiction module toxin, Txe/YoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78382"
FT                   /db_xref="GOA:A0A0H2XVW5"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVW5"
FT                   /protein_id="ABF78382.1"
FT                   /translation="MSVRRVLFTSDAWDDYVYWQGQDRKTLKRINQLIRETQRTPFEGI
FT                   GKPEPLKANLSGFWSRRIDDTNRLVYEADDLQISIVSCRYHYE"
FT   gene            complement(600801..601061)
FT                   /locus_tag="Bcen_3489"
FT   CDS_pept        complement(600801..601061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3489"
FT                   /product="Prevent-host-death protein"
FT                   /note="TIGRFAM: Prevent-host-death protein; PFAM: protein
FT                   of unknown function DUF172; KEGG: bur:Bcep18194_B0844
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78383"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUN5"
FT                   /protein_id="ABF78383.1"
FT                   /translation="MRTIHFSDARGNLKTVIDQVVDDADVTLITRRDAPNAVIMSQDYY
FT                   DSLMETVHLLRSPANVAHLERSIAQLRKGKAKEHKLAEDDE"
FT   gene            601248..601727
FT                   /locus_tag="Bcen_3490"
FT   CDS_pept        601248..601727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3490"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_B0845 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78384"
FT                   /db_xref="GOA:A0A0H2XVY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVY8"
FT                   /protein_id="ABF78384.1"
FT                   /translation="MLRLPPSNRRTDVPAATPATLRFSTDKRELDIDAIFDFLHRDAYW
FT                   SQGIPRDVVERAIEGSLCFGAYVGDRLVGFARLVTDHATFAYLCDVFVLPAERGNGYGR
FT                   ALIDHIFAQEMVQGLRRIMLATTDAHALYRPVGFGPPANPERLMEIRRPDIYTKR"
FT   gene            601785..602003
FT                   /locus_tag="Bcen_3491"
FT   CDS_pept        601785..602003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3491"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   bur:Bcep18194_B0846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78385"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTT4"
FT                   /protein_id="ABF78385.1"
FT                   /translation="MTEQEAEQLATHRHYKGGLYRYIGVARHSETEESVVVYEHLWPHA
FT                   RGLWVRPEAMFNGNLEDGTPRFRKLRD"
FT   gene            complement(602026..602484)
FT                   /locus_tag="Bcen_3492"
FT   CDS_pept        complement(602026..602484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3492"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: nmu:Nmul_A0311 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78386"
FT                   /db_xref="GOA:Q1BPR9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BPR9"
FT                   /protein_id="ABF78386.1"
FT                   /translation="MKTSMKLDIVSVEAALYAGDAHFVVVPGESGELGIYPHHAPLLTR
FT                   IRPGVVTLVDAPTGEHRRLLVAGGVLEVSRDGVTLIADHALRTPELDELRTREARHAAD
FT                   DWRQRYAHENRRAFDFASARAELMEEIRRFFAMALRQQAPHDKPGSAG"
FT   gene            complement(602495..603370)
FT                   /locus_tag="Bcen_3493"
FT   CDS_pept        complement(602495..603370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3493"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: tbd:Tbd_2798 F-type H+-transporting ATP
FT                   synthase, gamma subunit TIGRFAM: ATP synthase F1, gamma
FT                   subunit; PFAM: H+-transporting two-sector ATPase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78387"
FT                   /db_xref="GOA:A0A0H2XV70"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV70"
FT                   /protein_id="ABF78387.1"
FT                   /translation="MHIREIRSKIASTSSTRKITKAMEMMARTKMASAQRRAREFRPYA
FT                   ARIGAMAERVLRERPDHVSALMARRDTVRRVGLIVVSTDRGLCGPLNARLLVECVDALE
FT                   RWDRAGVACELSVIGARGLAPLVRHGATIAARASGLAAEPHFEQLLGALLVPLTAFVNG
FT                   ELDEVHVAYNRLTSPLAYEPRIDAMLPIAGLDTGADAPTDGAPASDYLYEPAPKPVVDT
FT                   LLLRYVEATLYQAVVENYACEQCARMFSMQTATDNADRVLRELRHLYQKTRQAQITTEL
FT                   CELVAGAAAV"
FT   gene            603517..604485
FT                   /locus_tag="Bcen_3494"
FT   CDS_pept        603517..604485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3494"
FT                   /product="Phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   reu:Reut_A0626 phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78388"
FT                   /db_xref="GOA:A0A0H2XVX0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVX0"
FT                   /protein_id="ABF78388.1"
FT                   /translation="MTELRTHQKYEALIARCRALRPVTVAVAHPCDEVSLHAAAAAARA
FT                   GIIVPVLVGPVARITMLAATLGVDLSGYRLVDAPHSHASAARAVELVRAGDAQALMKGS
FT                   LHTDELLAEVVRADTGLRTGRRLSHVFIMDVPTYPKPLFITDAAVNIRPTLEQKADIAQ
FT                   NAIDLVHALGIARPKVAILSAVETVSSKLPSTLDAAALCKMAERGQITGALLDGPLALD
FT                   NAISPEAARLKHLDSAVAGDADILLVPDLEAGNMLAKELTFLANADAAGIVLGARVPVI
FT                   LTSRADSERTRLASCAVAALVAAARTAAVPVAAPTVAADAH"
FT   gene            604496..605704
FT                   /locus_tag="Bcen_3495"
FT   CDS_pept        604496..605704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3495"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: reu:Reut_A1203 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78389"
FT                   /db_xref="GOA:A0A0H2XUP1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP1"
FT                   /protein_id="ABF78389.1"
FT                   /translation="MRHPVLVLNAGSSSLKFSVYDTHEDCSLDAGLHGQVENLHDTPHL
FT                   FVTDAHGATLADSAVARPGHQGAIEALHAWFAAHVGREAALDGVGHRVVHGGPYFTAPV
FT                   RIDARVLDAIAALAPLAPLHQPHHVDAIRAVAAVAPNLPQVACFDTAFHATVPALEREF
FT                   ALPRALTEQGIVRYGFHGLSYEYIATALAALDPSWMQHRTVVAHLGNGASLCALANGRS
FT                   VATTMGFTAVDGLPMGTRTGALDPGVILYLQRHTGRSLDEVEHLIYAESGLLGVSGVSS
FT                   DMRTLLASDAPSAAHAVELFAYRAARELAALAGVLGGLDTLVFTAGIGEHAPRVRERIC
FT                   RRAAWLGIVLDDAANAAGLPVMSSDASRVTVRVIPTDENLMIARHTRRVLDDAIPSTPY
FT                   PTR"
FT   gene            605712..606833
FT                   /locus_tag="Bcen_3496"
FT   CDS_pept        605712..606833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3496"
FT                   /product="PHB de-polymerase-like protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:bll4548
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78390"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVZ3"
FT                   /protein_id="ABF78390.1"
FT                   /translation="MTARDTPSPAVSAPALPIFWPMAAATAMFAAGAEIAARNLRFLAE
FT                   EEKLHFEAHPALASPNRPLLELRTMTFRDYSAAPAHGLPTIVDAPYAGHSAMIADYQPG
FT                   QSLMQTLREHGVTRVYLTDWRSATEDMKDLEIDQYLAELNVCVDELGGRVNLVGLCQGG
FT                   WMSAMYAARFPHKVASLVLAGSPIDTDAGDGPIKRMVHTYPTAFYDELVAMGGGLMRGR
FT                   FMLRGWKNMHPDQHYLAEHIDLYEHLDDPEYLRKREVFANWYESPIDLPGRWYLQAIVQ
FT                   IFKENRLAKGTFVALGRTLDLKDVACPVYLLAGEADDITTPEQVFGARDLLGTPASRIE
FT                   SRLVPGGHIGMFMGTRTLATVWPDIARWIAAQR"
FT   sig_peptide     605712..605813
FT                   /locus_tag="Bcen_3496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.475 at
FT                   residue 34"
FT   gene            606862..607662
FT                   /locus_tag="Bcen_3497"
FT   CDS_pept        606862..607662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3497"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="KEGG: bur:Bcep18194_B2636 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78391"
FT                   /db_xref="GOA:A0A0H2XTT8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTT8"
FT                   /protein_id="ABF78391.1"
FT                   /translation="MTLRHKRGLVVGIANGQSIAWGCARAFCRAGATLAVTWQSDKTLP
FT                   HVEPLFAQLDAPIRMPLDVGRSDQMAAVFDAIAVQWGAIDFVLHSVAYAPKADLQGRVV
FT                   DSSPEGFSLAMDTSCHSFIRMARLAEPLMTRGGSLMAMSYLGAEQVVANYGVMGPVKAA
FT                   LEASVRYLAAELGGAGIRVNAVSPGVLPTRAASGLPDFGRLLDDTARRAPLHHALDIDD
FT                   VGAFCAFLAGDGARAITGGTHYIDAGMHVLGQGQRKPVMSVNEP"
FT   gene            complement(607684..608895)
FT                   /locus_tag="Bcen_3498"
FT   CDS_pept        complement(607684..608895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3498"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   bur:Bcep18194_B0847 protein of unknown function DUF1006"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78392"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV76"
FT                   /protein_id="ABF78392.1"
FT                   /translation="MLTLSPASARTLHLAAQGLLTPPRRKATKADVLDTIRRMAQLQID
FT                   TIHVVARSPYLVLFSRLGDFSPHWLDEHLAEARLFEYWSHEACFLPIEQFGLMRYKMLD
FT                   PSGMGWKYAAEWHEQNRPEIERLLARIREEGPVRSADFAREDGVKGNGWWDRKPEKRHL
FT                   EVLFTTGDLMVSERRNFQRVYDVRERVLPDWDDTRDLPPREAVLPALLDYTCRALGVVR
FT                   ADWVADYYRLPRRSYRAELERLADAGDLIPVQIDDWKEPAYVHRSLDALLPAAAADTLR
FT                   STVTTLLSPFDPVVWDRRRASTLFGFDYTIECYTPEHKRRYGYFCLPVLHRGRLVGRVD
FT                   AKAHRTRGTFELKAVHVEPGVRFGAGLAADVAKAVKKLAAWHGTPEVTVAHAPPALVQA
FT                   FART"
FT   gene            complement(609251..610666)
FT                   /locus_tag="Bcen_3499"
FT   CDS_pept        complement(609251..610666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3499"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0848 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78393"
FT                   /db_xref="GOA:A0A0H2XVX5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVX5"
FT                   /protein_id="ABF78393.1"
FT                   /translation="MASLPRAQPMSPVFLAPLIVACALFMESVDANIIVTALPAMARDF
FT                   GHNPVTLNIAITAYVVGLGVFIPICGWLADRFSARAVFRTAIGIFVVGSLMCAASNSLG
FT                   VLTFARFIQGVGGAMMVPVGRIIIFRAVPRADLVRAMNYLAIPALFGPTVGPLVGGFIT
FT                   TYLHWRMIFFINVPIGIYGIYLASKHIANTHEPDPGPLDWFGFLLSASGAALLLMGLTL
FT                   IDGSLTSRSNAIIMCAAGAAMLALYVPYARRKERPVLDLSFLKIPTYHASVVGGSLFRI
FT                   GLGAVPFLLPLALQEGLGMSAFHSGLITCASALGGAVSRSTATHTLRRFGFRTVLIYNA
FT                   AFAGLAIAAYGVFHPGMATWAIWLIVLVGGIFPALQFTSLNSMIYADISPRDAGRATSL
FT                   GSVVQQMSLGLGVTVAGLVLHVSHWLQGHQAMVWSDFWPAFLVVGLCSFASIPITRRLP
FT                   PGAGDEVARGKRA"
FT   sig_peptide     complement(610571..610666)
FT                   /locus_tag="Bcen_3499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.732) with cleavage site probability 0.724 at
FT                   residue 32"
FT   gene            complement(610691..610954)
FT                   /locus_tag="Bcen_3500"
FT   CDS_pept        complement(610691..610954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP5"
FT                   /protein_id="ABF78394.1"
FT                   /translation="MFAHARHRDQRVAGAPRNASIRDRRADILAHPEQRAHVPPRQHRA
FT                   VRRPPGGDTHEQPVDRMGAVVLSAPPAGKDDCCNMRNNCCRT"
FT   gene            611066..611695
FT                   /locus_tag="Bcen_3501"
FT   CDS_pept        611066..611695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3501"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_B0850 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78395"
FT                   /db_xref="GOA:A0A0H2XVZ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVZ8"
FT                   /protein_id="ABF78395.1"
FT                   /translation="MSDSSSRMPLSPREAPRQRRSVATVDAIVEAAARILERDGFDGYT
FT                   TNAVAALAGVSIGSLYQYFPNRDALTAALVERESAHLLDDVERAAALSSCDDVLRALVR
FT                   GAVAHQMRRPVLARLIDFEEARLPLGARTERVADRIHATLLHALGARDAPRVAAPDVVA
FT                   HDLLAIVKGIVDAAGARGETDANALEARAWRAVRGYLRESREPKLA"
FT   gene            611832..613550
FT                   /locus_tag="Bcen_3502"
FT   CDS_pept        611832..613550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3502"
FT                   /product="Alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="PFAM: glycoside hydrolase, family 37; KEGG:
FT                   bur:Bcep18194_B0851 alpha,alpha-trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78396"
FT                   /db_xref="GOA:A0A0H2XTU5"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="InterPro:IPR023720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTU5"
FT                   /protein_id="ABF78396.1"
FT                   /translation="MTSRRAAPLASRFPSRQSPPAPRLRWAAALAIAYLAVAGCAAQAD
FT                   NANQAAAQAASQSALLATTAAAPAPASGTLLPPPSQLYGDLFVAVQTAQLYPDQKTFVD
FT                   ATPDTDPATIVQLYQQQKSQPGFSLKAFVDQHFTPPPAGGVTPPPNQTLREHIDWLWPQ
FT                   LTRTSTTAPPYSSLIPLPKPYVVPGGRFREGYYWDTYFTMLGLQVSGREDLVDDMLDNF
FT                   AYLIDTVGHIPNGNRTYYASRSQPPFFAYMVTLAAQVEGDKVYQKYLPALRKEHAYWMQ
FT                   GETTTPRGQAARHVVAMPDGAVLNRYWDARDTPRDESYLEDVTTAKSVPSRPANEVYRD
FT                   LRAGAESGWDYSSRWFGDGKTLATIRTTSIVPVDLNSLMFHLETTIVKGCAVTRDIACV
FT                   ADFSARAGKRAAAINHYLWNRHGYYGDYDWQLRKPRDGVTAAALYPLFAGVAWPERAKA
FT                   TAHEVRKTLLQPGGLATTTENTGQQWDAPNGWAPLQWIAIDGLRRYGEPALAKDIGTRF
FT                   LSDVKHVYATEGKLVEKYVVEGTGTGGGGGGEYPLQDGFGWTNGVTLKLLGLYGE"
FT   sig_peptide     611832..611966
FT                   /locus_tag="Bcen_3502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.940 at
FT                   residue 45"
FT   gene            complement(613675..615219)
FT                   /locus_tag="Bcen_3503"
FT   CDS_pept        complement(613675..615219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3503"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /note="PFAM: Carbohydrate-selective porin OprB; KEGG:
FT                   bur:Bcep18194_B0852 carbohydrate-selective porin OprB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78397"
FT                   /db_xref="GOA:A0A0H2XV79"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV79"
FT                   /protein_id="ABF78397.1"
FT                   /translation="MRPASRSRFLSLTNQTANGTRMKQLSSVPRKLRVDALAALLLSLA
FT                   AASAFAQASAPATEPAAGTNDAAAPAQPAADAATPAPIGLWERSNLLGNMGGLRDVLDE
FT                   HGVTLSLQETSEYLYNTSGGTGRGGAYQGLTQFGFDVDTGKAIGLPGGTFNVSGLQIHG
FT                   TNLTQRYLQTLQTATGIEANSTTRLWELWYQQSLLDGKVDVKVGQQSVDQEFMVSQNAA
FT                   TFMNATFGWPVLPSTDLPSGGPAYPLSSLGVRLRVKPADAWTAMVGVFDGNPAGRSDGD
FT                   AQVLNAHGTNFNLRSGAFVIGEVQYALNAPPADPKAPQPAGLPGTYKLGFWYHSQHAND
FT                   PRYGTDGLSLADPASNGMPATHRGNYGFYAVADQMVWRPSADSPRSVGVFARVMGSPGD
FT                   RNLVDFAANAGVTLKAPFVGRDNDVAGIAVGYAKIGSHARGLDGDTGAYTTPGYPVRRA
FT                   ETVIEATYQYQIAPWWQVQADLQHFFRPGGGIPNPNAAGARIGDETVVGVRTTITF"
FT   sig_peptide     complement(615058..615219)
FT                   /locus_tag="Bcen_3503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.541 at
FT                   residue 54"
FT   gene            complement(615247..615513)
FT                   /locus_tag="Bcen_3504"
FT   CDS_pept        complement(615247..615513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78398"
FT                   /db_xref="GOA:A0A0H2XVY2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVY2"
FT                   /protein_id="ABF78398.1"
FT                   /translation="MFFPSFAVRLKRVVHVACDCSFSGRSPLARAFGHWRGVALAHVPA
FT                   APRPLDWVLIAATAAALALAALLCSVAPHVGFAQVWRVGGWLP"
FT   gene            complement(616184..616375)
FT                   /locus_tag="Bcen_3505"
FT   CDS_pept        complement(616184..616375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUP9"
FT                   /protein_id="ABF78399.1"
FT                   /translation="MRAGIRAPGERMRERGRLPGGGETGQRMRERITLTGANQGARREW
FT                   LRNTAARTVCPGDKRRLR"
FT   gene            complement(616525..616764)
FT                   /locus_tag="Bcen_3506"
FT   CDS_pept        complement(616525..616764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW01"
FT                   /protein_id="ABF78400.1"
FT                   /translation="MRMPRRARRFFSVDQRFQLAQQAGEHPRTGVERQHRVVVGARFRD
FT                   VRKVRQQKAEVHGLAPCGDGSVPAASWARGQPGA"
FT   gene            616854..618500
FT                   /locus_tag="Bcen_3507"
FT   CDS_pept        616854..618500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3507"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: bur:Bcep18194_B0855 Mn2+ and Fe2+
FT                   transporters of the NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78401"
FT                   /db_xref="GOA:A0A0H2XTV0"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV0"
FT                   /protein_id="ABF78401.1"
FT                   /translation="MSTPSNVSPPIAADRSAVLDEAHLGDIRGALGTIAHHDTGARGTW
FT                   WARLRTLLAIIGPGLIVMVGDNDAGAFGTYTQAGQNYGTTLLWTLLLLVPVLYVNQEMV
FT                   LRLGAVTGVGHARLIFERFGKFWGAFSVIDLFLLNALTIVTEFIGITFVLDFFGLPKVA
FT                   GVCVAAALTMAAVSTGDFRRFERFAIGLCVLSLLLVPVLVSIHPSAAQMTRDFFVPNWP
FT                   AHAKLSDVMLLVIGIVGTTVAPWQLFFQQSYVIDKRITPRFMKYEKADLWIGIAFVLVG
FT                   AVAMIGFSSALFAGHPEAGNFADAGGIIAGLEKYAGRTSATLFAIALLDACIIGAAAVS
FT                   LSTAYAIGDVFKIRHSLHRGVTDAKGFYLVYFGIVAAAATLVLIPGSPLGLLTEAVQTL
FT                   AGVLLPSATVFLLVLCNDRQVLGPWVNSTKLNVFTGAVIWVLVLLSIILTASVMYPDIS
FT                   GEAIVDVLVGGTVLAIAGYLATVLIRRNKRVVEPGIDRSLRDTWRMPPLDTLEPQNMTL
FT                   ATRIWMAVLRGYLVIAVGLVIVKVVQMTLLK"
FT   gene            complement(618637..619545)
FT                   /locus_tag="Bcen_3508"
FT   CDS_pept        complement(618637..619545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3508"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG:
FT                   bur:Bcep18194_B0856 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78402"
FT                   /db_xref="GOA:A0A0H2XV85"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV85"
FT                   /protein_id="ABF78402.1"
FT                   /translation="MSDIALHEEAVAPTTLPRASRGLNACADALRERPVQVVWCDDVKR
FT                   GDDAQPHAPKLGVADTLAHAQSTAERNRIVTSLLHLTGFSTFAYFALEFARERVESLYL
FT                   HEAFTPATYRGDYVRHNHHDVDPRTLGARVCNMPIVWDLQQLRREHRERDDAPSVSPAA
FT                   LDGFLQTMQDDGMCSGIMYSMAVPGTRLHAFMSFTAPRRTREWITPATIEQALSIGLSV
FT                   HKFASPQLISTSRERAVNGLTPFEQELLLGIAEGASDKEIGRRLDTSAHNVDYHLRKLR
FT                   KRFGVANRIQLTYLTSKLELI"
FT   gene            619829..620662
FT                   /locus_tag="Bcen_3509"
FT   CDS_pept        619829..620662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3509"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG:
FT                   bur:Bcep18194_B0857 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78403"
FT                   /db_xref="GOA:A0A0H2XVY7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVY7"
FT                   /protein_id="ABF78403.1"
FT                   /translation="MTYADGAPRVEWFSQADIAAAAAYSNEYHAIERDVFTGIQIAPGK
FT                   TDLASFDFSQCHARLRQIGFSTLGYGAYEMIGRRILRAHLLRDLAPATFMQPFIEGMLY
FT                   DSDPRFAQVRQSGFPVAWRLDEIEAAAQGSGDRKVLALAGHLRAHAMNSGVIFSLSAPR
FT                   LDLRVAVNLTSETHGTEWIDDRVIGGALSVSLAVHRVALPFLEARVARMRGFALADEQQ
FT                   EVLDRLVHGLSDQEIASALRTSLHKVGHHIRSLEKLFNVQNRAQLAYLAARRLPS"
FT   gene            620913..623132
FT                   /locus_tag="Bcen_3510"
FT   CDS_pept        620913..623132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3510"
FT                   /product="type III secretion FHIPEP"
FT                   /note="PFAM: type III secretion FHIPEP; KEGG: rso:RSp0863
FT                   hrp conserved hrcV transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78404"
FT                   /db_xref="GOA:A0A0H2XUQ3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ3"
FT                   /protein_id="ABF78404.1"
FT                   /translation="MAEPKALPRDWQRLFSAGRGVSGRRLGGASPRADLFLAAFIVAVV
FT                   ALFILPLPQAALDGMISLNLAASVVLLTVSTYVPSAVSFSSFPALLLFTTLFRLALNIA
FT                   SCKLILLHANAGHVIDAFGRLVVGNNVVVGGVVFLVIAVVQFIVIAKGSERVAEVGARF
FT                   SLDAMPGKQMSIDADLRAGIISADEARERREKLEQESQMHGAMDGAMKFVKGDAIAGLV
FT                   IAFINIVAGIAVGTLMHGMDIGEALQRYAILTVGDGMASQIPSLLVSIAAGIVTTRVAT
FT                   RDARQRQLGEQLGEQLGAHPRALLIAAFVLSGFLVVPGFPKWSFALIALGLGAFAFSQL
FT                   KRKTSAPSFNLIHVAGRVGAADDGQPAKVSHAAGVTSLIAVSLSDDLRTGLNLAQLQAA
FT                   LSSAKARVDADIGTVFPRITLNDDEGAPAGTYRIYLQDVLVAHGALKPGWLLWDGVAPL
FT                   PERAERQPAEAFGPFATALWIKPDGAAPDGKWLSSESALAAHVEQIVRQHADELLGIQE
FT                   TQALVHLVRRDHPELVGELTRLVPLQRVTEVLRRLLAEQVPIRNLRVIFESLITWAPNE
FT                   PDDVIALVELVRVDLRRMITDRHAGTARQLRVVLFEQNLQERIESAVMRTKQGNFLALS
FT                   SAVKQDIGEQVRAIVQAAQAAGPGGHGNAQGGAHGGARLAVMVALGARRYVKTILQPVL
FT                   PELAVLSYQEVEEDVQLHTVGWVKNPPDDGTVGAGADVRAPGAVQ"
FT   gene            623129..623407
FT                   /locus_tag="Bcen_3511"
FT   CDS_pept        623129..623407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3511"
FT                   /product="Type III secretion protein HrpO"
FT                   /note="TIGRFAM: Type III secretion protein HrpO; PFAM:
FT                   export protein FliQ, family 3; KEGG: pae:PA1692 probable
FT                   translocation protein in type III secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78405"
FT                   /db_xref="GOA:A0A0H2XW06"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW06"
FT                   /protein_id="ABF78405.1"
FT                   /translation="MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQ
FT                   DANIGIAVRLIAVMVALVLLSGWLGGEVLRFAQQALERMFVSSTGVL"
FT   sig_peptide     623129..623251
FT                   /locus_tag="Bcen_3511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.362 at
FT                   residue 41"
FT   gene            623407..625452
FT                   /locus_tag="Bcen_3512"
FT   CDS_pept        623407..625452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3512"
FT                   /product="Type III secretion system outer membrane pore
FT                   YscC/HrcC"
FT                   /note="TIGRFAM: Type III secretion system outer membrane
FT                   pore YscC/HrcC; PFAM: type II and III secretion system
FT                   protein; KEGG: bma:BMAA1602 type II/III secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78406"
FT                   /db_xref="GOA:A0A0H2XTV4"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV4"
FT                   /protein_id="ABF78406.1"
FT                   /translation="MRRRVASIRFQPRSLQRAALAVCATALLTASLCMAPAQHARAADL
FT                   RWRNKPFTIVANGKKIGDFIRELASSQGVTAVVDPKVDGVISGRFSGTPQQTLDTICST
FT                   YGLTWYYDGSFLYVDPADQSQTQMIPIPPNASGEIGRALQAMQIPDKRYTLVINDRANS
FT                   VYVAGPRRYVELVRQAVGSVGDPAANGAHADIRAFRLKYGWASDFTINRSGKEVTVPGV
FT                   ATILRRLFGKGGGTTAAPSSTPLGQAARQVKLGSGLTIAVPRLDFPDISGGPRQGGYGG
FT                   ADSGMGGGFSPFANNGGGDTLPQIVADPAINAVIVRDLPENMYRYQSLINQLDERPRIV
FT                   EINVTIIDINEDSLDSLGIDWRLHTTHGDVQIGNGQNALNGNTQYNGVGNPPLTFGIGT
FT                   SETGQTGTFMPTGIALTASIGGSLRNYLLTRVNALAQKGQAQLRSKPKVLALDNTEAIL
FT                   ENLTQFYVQVPGYQDSSLYSVTTGTSIKVTPMIVDEAIRNAAAVSGNPQSVMMSIDIQD
FT                   GNIVPGQAVSNVPVIQQRNIVTKTMIDEGKSLLIAGFNDDEVKLNKSGVPWLSDIPLIG
FT                   NLFKYTDKSGNHMERFYLLTPRVVTNASMYAPDGSPVNPGVDGPASQEGMSMYRPPDND
FT                   VAVPLTPKPLPGTKFGPPALPAPPKDAASQPVATTAGAPTHVDEHH"
FT   sig_peptide     623407..623535
FT                   /locus_tag="Bcen_3512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.750 at
FT                   residue 43"
FT   gene            625449..626792
FT                   /locus_tag="Bcen_3513"
FT   CDS_pept        625449..626792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3513"
FT                   /product="Type III secretion system YscD/HrpQ"
FT                   /note="TIGRFAM: Type III secretion system YscD/HrpQ; PFAM:
FT                   Forkhead-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78407"
FT                   /db_xref="GOA:A0A0H2XV90"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV90"
FT                   /protein_id="ABF78407.1"
FT                   /translation="MIRTATAHCPAAREARGGGSAALASPWNLCFLSGPMYGRTMSLAR
FT                   GANWVGTAADCEVILPDREIGAKQVCLQVGALAVTVQNHGGDTGAPVLFNDEPLGSGRR
FT                   SLTPNDVVTVGSIRLGIARHAQASVAVPDETDAPDAAREAAWLGWLTGGLRRLGSRRLV
FT                   IALVALWIGVLLGALGYGFVAWSGRLPWQHESVLARTHRLQQLLHAYPELAVAPRDDGV
FT                   IVSGYVSDPAAREHVAQIVAGVDNAALGNIYVVSDLVATAQTYFSDTALTVTYLGRGRI
FT                   ELTGTAARAQIEPRIRNYMKDARPALEVVDHVRDADAAAPRTATTLGGTAGIPEITTVF
FT                   AGDGDQRYIETVDGSRYFEGARLKEGASVVSIGPDEVVFERNGQRITMPLGGPSARVPE
FT                   QAPAPPVAPLASGAAAGVAQPVPGPTLLPDAPATPAVAAAGASKGATH"
FT   gene            626935..627147
FT                   /locus_tag="Bcen_3514"
FT   CDS_pept        626935..627147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVZ1"
FT                   /protein_id="ABF78408.1"
FT                   /translation="MGTSAAGGVTNTGDVQKQADDLTKTQLELTKINFQVQQSTATFET
FT                   SNAVTAQEGTANAQVAQHLSSAGRA"
FT   gene            627272..627748
FT                   /locus_tag="Bcen_3515"
FT   CDS_pept        627272..627748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUQ8"
FT                   /protein_id="ABF78409.1"
FT                   /translation="MSVTGVGAAPPGAAALASAAQQAGTASDPVQVRQFDALMQPGASP
FT                   AAPPSSSGVAMSRAPADAAPAVQMTPAQANQSSLVERLRTYGNDLDSRYANIDKHRSEM
FT                   LTSMADSRSDPLMTMVKAMDFQWTATTTISEYQLSLSVAQAANGFTHTVLKTQE"
FT   sig_peptide     627272..627343
FT                   /locus_tag="Bcen_3515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.381 at
FT                   residue 24"
FT   gene            627804..628682
FT                   /locus_tag="Bcen_3516"
FT   CDS_pept        627804..628682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3516"
FT                   /product="type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family"
FT                   /note="TIGRFAM: Type III secretion system lipoprotein
FT                   HrcJ/YscJ; PFAM: secretory protein YscJ/FliF; KEGG:
FT                   bte:BTH_II0747 lipoprotein transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78410"
FT                   /db_xref="GOA:A0A0H2XW11"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW11"
FT                   /protein_id="ABF78410.1"
FT                   /translation="MTTIDSTPRMHAWRSRAARALLAGLLVLLAGCQKELYSGLSERDA
FT                   NQMVAVLGDAGISASKDNDARDTSDRNAWLVSVADGDMQAALTVLQANGLPKPSYASLG
FT                   ELFQKQGLVSTPAEERVRYLYGVSQDLSRTLQDIEGVVVARVQVVIPENDPLADKIKPS
FT                   SAAVYIRYRPGVDLRAMAPMVKDLVAHSIEGLQYDNVSLFLQPAAARATRVDGIGSAVS
FT                   DILRLRSPLGWLVFALILLTCAVIALSAARRGMFGARLAGLLGASRGASGATAQNAGGG
FT                   LRTPDGARDGA"
FT   gene            628679..629428
FT                   /locus_tag="Bcen_3517"
FT   CDS_pept        628679..629428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB1626 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78411"
FT                   /db_xref="GOA:A0A0H2XTV8"
FT                   /db_xref="InterPro:IPR009510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTV8"
FT                   /protein_id="ABF78411.1"
FT                   /translation="MSEPHALPPGEASVAAEAATLPWLHPLAPPPVARAATFHALVCDF
FT                   NLRPDRYLHVTRVPADWPARYRSPDAFGAAGRKLLARHLLDLNGVADRHDFDVANPCAR
FT                   LALLPGAALEQLAAYAGLLLHRAWLRDVLAGRRIRAEVAARLGGDALELALERAPEFGA
FT                   LAETLEPWRADPAALPVVIRARGGRLLADFIGVAGDAVARRVRLKFNRAIDDEAPYWLN
FT                   RAQRDQFGELMFLFLIPERLASWDWLF"
FT   gene            629410..630039
FT                   /locus_tag="Bcen_3518"
FT   CDS_pept        629410..630039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3518"
FT                   /product="Type III secretion system HrpE/YscL"
FT                   /note="TIGRFAM: Type III secretion system HrpE/YscL; KEGG:
FT                   bpe:BP2246 putative type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78412"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XV97"
FT                   /protein_id="ABF78412.1"
FT                   /translation="MGLAFLITSDNLQLLSERKVLKEREYAALLDASAVIATAHEEAAR
FT                   IVADAQREFDKRQAAGYDEGMRRAQREQAAQAYTQALAATRTMETMKDAMADIVVKAVR
FT                   AIVGEMSTQKLYEAALARIAPLVRDEAFLIVRIAPGRKDEMRDALDGAFAGQSNRQKIR
FT                   IVEDAQLERHACTVETPSGRIDASLDLQIDALRQAIRRDALKGAAR"
FT   gene            630036..631412
FT                   /locus_tag="Bcen_3519"
FT   CDS_pept        630036..631412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3519"
FT                   /product="ATP synthase FliI/YscN"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: xoo:XOO0091 HrcN TIGRFAM: ATP synthase
FT                   FliI/YscN; PFAM: H+-transporting two-sector ATPase,
FT                   alpha/beta subunit, central region; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78413"
FT                   /db_xref="GOA:A0A0H2XVZ7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVZ7"
FT                   /protein_id="ABF78413.1"
FT                   /translation="MNAPLDDPPPFGDDDGAPFDRGRLVGELDAGLAFFSPVSVQGRVN
FT                   HAVGQILNATGIRARLGEICELRTPNQPTLLAEVVGFSRQTTLLTPLGDVAGLSPETTV
FT                   VPSGREHVFPVGEGLFGRVLDGLGRPLDDRGPVTGAAWVSTQQDPPNPLARKMIDTPFP
FT                   TGVRVIDGLMTLGIGQRVGIFAPSGVGKSTLLGMIARGAQADVNVIALVGERGREVREF
FT                   IEHSLSPEVRARSIVVVSTSDRPAMERVKSALVATAIAEHFRDAGKRVLLLVDSLTRFA
FT                   RAQREVGLASGEPPTRRSFPPSTFAVLPRLLERAGQGAHGSITALYTVLVEGGEESDPI
FT                   AEEVRSILDGHIVLSRKIALANRYPAIDVLASLSRVMPLVASRAHQHAAARVRELIAKY
FT                   QEIELLVQIGEYREGSDRLGDLALRARDAIGAFCAQASDEDVRFDALLAKLTKLANDHV
FT                   "
FT   gene            631405..632085
FT                   /locus_tag="Bcen_3520"
FT   CDS_pept        631405..632085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3520"
FT                   /product="mucin-associated surface protein (MASP)"
FT                   /note="KEGG: tcr:506599.50 mucin-associated surface protein
FT                   (MASP) PROSITE: ALA_RICH GLU_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR3"
FT                   /protein_id="ABF78414.1"
FT                   /translation="MSEADDRLVLATLARLKRVREMRSQIARVAAARQQGIAAQSRRAL
FT                   AAAQAQLAQQVAAKAAIQTRLADDVREARALQNAAADTRTFDRHIGTANASVSEAAHVH
FT                   RGHEATLADLQRAARKAKAAEDKLEKAGEKALHARAARVERDADDIADGYAVRRFATGG
FT                   TWVAGAGDAAAGHASTPPEAAAAFDAAMTEAETDADIATETDASAASASPDDPAPPAAA
FT                   ERRC"
FT   gene            632079..632888
FT                   /locus_tag="Bcen_3521"
FT   CDS_pept        632079..632888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3521"
FT                   /product="Type III secretion protein SpaR/YscT"
FT                   /note="TIGRFAM: Type III secretion protein SpaR/YscT; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   rso:RSp0872 hrp conserved hrcT transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78415"
FT                   /db_xref="GOA:A0A0H2XW17"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW17"
FT                   /protein_id="ABF78415.1"
FT                   /translation="MLDQAAGFNDVAGMLRPLLYVMPRLLPIMFVVPVFNEQIITGLVR
FT                   NGIAVVIAAFVAPTIDAAQVAALPFLMWCLLVAKEAMVGMLLAGAFSAVLFAIQGVGYL
FT                   IDFQTGSGSAAFFDPMGGHEGGPTSGFLNFVAIALFVTAGGLQVLVQLFAQSYAWWPIG
FT                   SLGPDFSSMLQTFIVRQTDTIFEWMVKLAAPVTIVLVLVELGVGLVGRAVPQLNIFVFS
FT                   QPLKSALAVLMMILFLPVVYASLHSLLSPDSGLMALLRALFAAHGGG"
FT   gene            632905..633936
FT                   /locus_tag="Bcen_3522"
FT   CDS_pept        632905..633936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3522"
FT                   /product="type III secretion exporter"
FT                   /note="PFAM: type III secretion exporter; KEGG:
FT                   hch:HCH_05114 type III secretory pathway, component EscU"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78416"
FT                   /db_xref="GOA:A0A0H2XTW2"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTW2"
FT                   /protein_id="ABF78416.1"
FT                   /translation="MAEKDQKPTAKRLREAREKGDVPKSAETVSSAFFVGVCVALAVGI
FT                   GSLFARVQALFRLVFDAVGAADPSARLAALIDGAARDWATLSAQIVAAGLLAGLLAGFV
FT                   QVGGVMAWSRLVPQLSRLNPAEGMKNLWSLRNLVNLAKMLLKTALLVATLGWLIVESLD
FT                   PSVQSGFTRPASILALIVKLLMLLFGWAALIYIVMALIDIVHQRHEFNQKMKMSIDEVR
FT                   REHKEDEGDPHIQAKRRQLAREAQFASLPDRIGYASVVVYSPRVAVALYYGGMGSLPWV
FT                   LARGEGDAGERIVRLARDALRPTLANVGLAQALYETTPENGTIQPQHFRAVAQLLKWAT
FT                   GAA"
FT   gene            634207..636177
FT                   /locus_tag="Bcen_3523"
FT   CDS_pept        634207..636177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3523"
FT                   /product="Asparagine synthase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: bur:Bcep18194_B0858 asparagine synthase,
FT                   glutamine-hydrolyzing TIGRFAM: Asparagine synthase,
FT                   glutamine-hydrolyzing; PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78417"
FT                   /db_xref="GOA:A0A0H2XVA0"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVA0"
FT                   /protein_id="ABF78417.1"
FT                   /translation="MCGIDGFLNSVAFDEETARGTLARMTASLAHRGPDGQGIWVDPDA
FT                   GIALGHRRLAIVDLSVHGRQPMASACGRYVLVFNGEIYNHRELRAELERAGRAPAWRGH
FT                   SDSEVLIAAIVAWGVEATLRRATGMFAFALWNRASRVLTLARDRIGEKPLYYGRIGDAL
FT                   VFASELKALRGYPGFDGTVDRDALCLYLRQSSVPAPYTIYRGIRKLPPGTYIQFEHARD
FT                   TPRLRAYWTLEQAIEAGRAQPFEGSADEAVGQLDTVLRQAVARQMEADVPLGAFLSGGI
FT                   DSSAIVALMQAQSATPVDTFTIGFHEAGYDEAGYAKAVARHLGTRHTELYVTADHALGV
FT                   VPKLPSIYDEPFSDASQIPTFLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWRK
FT                   LHRVPAAVRARIAAALHALRPDHADQLAAVAQGAWGGGVEARESASRIGDRLHKLGHVM
FT                   TAESRIGLYRLLMSSVHHPERLALSGQEPPTPLDTVSAWPAHLSFAEQAMAIDTLTYLP
FT                   TDILAKVDRAAMAVSLETRMPFLDHHVVEFAWRVPASVRLPEGQSKALLRRLLDRYVPS
FT                   ALIDRPKQGFCAPVDHWLRGALRDWADALLRPSRLREEGFFDAAAVERLWRQHQTGRMN
FT                   WQHQLWTVLMFQAWLEHQRAA"
FT   gene            complement(636234..649763)
FT                   /locus_tag="Bcen_3524"
FT   CDS_pept        complement(636234..649763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP1772 cell wall surface anchor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78418"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW02"
FT                   /protein_id="ABF78418.1"
FT                   /translation="MLLIDGLGLGVNWQRFLSETLNLVVAPPPPPPPPPKKDDPAAGPA
FT                   NPTAAPPIPVTASLATDPSKPTNAEIQSATSLIQSMAAQYTAPPPDITVENDKTRAVQK
FT                   AIQDAQTKYDNASQTLQGAQNVLHLVNRDPESTADDRKTAQADYAKARTTADTAQRELN
FT                   VTTDAGYMILYGEQANADMPAGMKIDDSGKVTDPGDAQHAADQQFKTLLDAFPDHANDP
FT                   NWVPQPGDCKNPLQIRLYDDWQTASAKAAVGASKYFADVANSNLAYTQFQSYLADPDYK
FT                   AALDAGVGRLNDALQPLELQVTMPDAPASQDAAQQAVTSAAKDANYANAAYGAANDSLS
FT                   LTNAQQRYDSASGKEGPTVIVPNAVSDAKTALARAQTAANTSGGYLQMLSAQRQVDTLQ
FT                   ADYTKKLDASSAWHKANPHAMIKDPQVDLDLGDAYAKLDQAKQQASIAHDGFVVAYGAT
FT                   LAQQYDDQASQIKARVNAQSVFTKPTLQPPLLTPSLSTANGLPGLPASSLSTATSAAPT
FT                   GTPTLPSASPQASPTLPGSNGASSLPASPLLDSPFLLPQSSGPSAAQAGPTMLDVKRMQ
FT                   TVAGAIRAADSRMSDSVNERATQLALSQAHIKQTQAKSTLESVQKKYDDWAAANPPPMR
FT                   FRTVAGDDMIPAPSAPRPNLYQVELDKAKAAVTQADNAVQRLQLLSETSHQQVLMDRFD
FT                   AGLDERLRYAAPGSDAENDYKKALHDFYEAHRGELSNSLLDAASASTNNGGTIAFGKLT
FT                   DNEQRNLIGVALGMQPDVQNDAASGDDSDPVSPTKDDVARYTDKDKLKTINSVRDKLLS
FT                   IGGGATTQVSVLPMVYAAKDAGMTTSALFKVSGKDGTQYVDETASNYDDINDYIDNNEL
FT                   STDGTVDIATGHNADGTLQLVSKAAHHESGFDSFLNTLTSTGLNIGMMVGGMALEGLGT
FT                   LLDGTGIGAIVGVPLNILGAGMMYTAIGATMTSAGLDLANRADHGRSLNPFTDAGARAD
FT                   FINLVPMGAAGAAKLAGSKLFTRAVTALTRTPKVASVLATGARTTAVVTGVGGAVEAFG
FT                   EAGYEYFVTGDKKAAGEQLKSGITNVALMAAGGLKERAVTSVRTRIGQPVPIRGADGKT
FT                   VSVDSQTIGRILNSGDASSLAAGRTRVTLDGEAVKVSPDGTLRVGDKVLTYDNTPIRVL
FT                   DRASAKRLPPGKSVVLGEDGTLSVVSVSPKAWTNGTRVDDVTGTGERMSFGPDGEMSVT
FT                   PKIVAKTPLDVLQHVLDQASDAYRQTVAGAQAPRRLAQTAAEGEAASVSADARSTRRNS
FT                   EEHARVQQQRDETDAERSTTASANRRSADTQSMRWRPVAADEPAGPGTRAKPDGAPPRV
FT                   NAKVVDLTDDAPVARAATSDPAGIAVPRGPSAEPMDVGDRTVYVVRSGATPDAPGARPP
FT                   SPRPQDFEEPVIVVAGEHDAALAPELANRWQKPVYAAAPDAFGADGQLRAGARVLRFDP
FT                   APETVAAAHETGLPDGIAPDEAPQAAPRAAADDTVIVLAGKRGPNDPAMPRPAAPPEPV
FT                   NALDGVFSAPNRVLVLVKPERAGAPERMAERDTAAADRGTRATDDAHGRAARAPAGGER
FT                   RTAANDDIGLAAAHPETTETAPPDPGASKPGWVTRMQMRFGGAALPEAAQALAMQSGTL
FT                   ATQLRMLQDAGWRVTLGKRGGGSRIDPRKRRVTIDGALQHPGSITYTLAHEARHAVEAM
FT                   AGVLNLDYGNRSRFTRKALEAEARAQINAFEARYEIELAGGGDIAAHVRLPDAIEREGD
FT                   AWRAPSHDYAGTVGRLVDAFADAPVSGRDGETYRDFYDDVWSRQKRRGGIPRRMPAPQT
FT                   HETDGTPHGVRSFDERVAWSRAHAEYASPFGDGPVPAAADLQAARSRHFTMLEDEGVLM
FT                   LHADTLPDGTLLAGGQPAGVHEYALDQAPSFLVKEGYSIVLSAKHGGEAAAAGLANLWQ
FT                   RPVYAPPPHAVGERAALLDTGVFRRYDPAPAAPHDLGQLTADAEGVHLEGNPAARIDVE
FT                   RHVGELLGAGAEKTVFALGHDAALAVYDNGPHTSEARQIEAAIDESIALDDLASYGLKT
FT                   VTMDGPFSALNRVAVLYRPLGVFHSFGFETGALPHVVSRAALEHLRQIREVVERTGIGF
FT                   DLQGLFTRGGDFLLSDPGAIGMGAGEHFTTLQRLAVIERALTQGLERGHVELAHPRLAE
FT                   TPPPDAFVQKPSVITRVRMRFGGAPLPKEAYRLIDASSLLSQQLRLGADAGWKVVRGKP
FT                   GAGSKIDTRRRRVTIDGGLQSTGSMVYVLAHEARHALEAATGTLGLDYGSTQRYVRSAL
FT                   LAEARAQVNAFAVRDEIRANLGIDIGRHVALPDAIANEYGRARAGDAASLARLADAFEH
FT                   SPTSLDGGVTYGELYRRHAQAARHTGVTMPAPRETAATLAEETAWSRARPVKASPFDGK
FT                   PVAGVDALTLDRSGPLSYDRDGRIVIVHGVTDAQGRLVDPDGRPYTPVEVTLAHRSVLG
FT                   LPGSSVILSARNGRDAAAWLANVWQRPVYAPPTIAVGLGAEARLGHTNAWLRYDPAPHQ
FT                   RPDLGALDVDGNGVHASGDPAARVPVERFTGAATGAGIEKTVFELGRRNAIGLYEGTDN
FT                   RAILGHIESIRLEQEGLAALRAHGLRTLTVGGPFAAFDRVAVMYAPFASLSSHDVMAGM
FT                   LPSRVTRDAFAQLDRARDITAQHRLYYDFEGVFDAHGDFYLSDPSTVMTDAPKLNVEGI
FT                   VREIGTLRVMLEDGIARGAIELAHPGITEHLPPDAFVQKPSVITRIRMRFGGAPLPKAA
FT                   HALVDRSSLLRQQVALAGEAGWKIVVGRPGRGSRIDTAKQRIVLDGQFHGAGTLVYTLA
FT                   HEAQHAVETITRRLALDRSSPQALADSALMAEARAQANAFAVRREILDDGGIDIARDAH
FT                   LPDAIAREADHAMPGDEAGLRRLAAAFGDVAPSVPGHATYRAYYASQADAMHALGVPRE
FT                   MPAPAPQPASNAPMPAATADAARRQHALDHLASHGKRDLIRIDGSQLASLQQMKDAFGT
FT                   NAHVLIAEHEARPDASIDARHAQPKFVASMRTDEHGTFVDKASADPAVSIPDAVYRALK
FT                   DNGSAERANVDFYVSPVSLAELREYGGAARITARSDGRTWEAEPATTPDADVVTTLQSL
FT                   ADAPRFRRPKQAAKAAGDGATLYAIDKETGKVLGYATRNAAHDWTYHESTSLGDATIAP
FT                   RDLGAAFRRRARNLSGGRRGVRFVVTDVTHDTVERYGGFAPAEMRKALGDEKPPMQKLG
FT                   TRVQRGLAKADPGVRRKIAEIEGADSPFLPPKLVPDSEQLAIDFSGANTLHLMRALELK
FT                   ALRGDHYVYVYETDHPVAESLHTRRGIIAIHDGNARWYDDAEQLRDHPDAGRPLDEMPL
FT                   GRGPFGANQHFLLSTLAPEAFDPRATATQKAALAQRLTQLLDEKSYFDALPQKFDLATR
FT                   WIRTQIAGQIDRVKAAQADLAAAQQAAQPAAGGSTGPAGRVRNALRGKRGRRNRRAANA
FT                   ANAANAPAAPKPQKPPKTPAAKPLTLRPYQPSLGSSTVAEWVMRYGAAKVADWFPTIDR
FT                   VKAVTARKNQPDAGGLALTDEPQTILADAPMLKALGIPIGLAREVSSMPSRGPVADPGG
FT                   DHNRFVKWMQAYATRHSAARMIDKRAIQAFVRAPAEIQDRVAPMARAFNLRDDPALAVR
FT                   YVEQYGGAMPVVSIPVDPHTLAAARGGKHDPAFIRRARKFGSPIGARYNEADATITREA
FT                   PDGTTRTLELDDIAHLHKWLTAASRHGFQLRLEAASGRPLVSADDRRTIAGTNDSYAEY
FT                   TRLMTSFETWSHDHAGEPAPNVMLSFHGWDAVLEPVPGAGHVELLDALLDRKAIDWLHV
FT                   GLSYGTHGADFIANQDLTRALAERIVDYYQTDRHGKFARLHGADALTRVFEPVSPEAFA
FT                   NQQQVLFAEIARIGKSKGLSDDALATLRSELYERNTTALVNQARKATIEHAMTQWASAD
FT                   HPPATRTEKLARRFGERWLAEAGGRAPARGTVVSTADPAGPLPDSRAYWQSVVEREALK
FT                   NDPSKPISVGRQIAANPKQAKMIEELQALAQINALRVHRPSFRKAELWKSIGFSSLVTG
FT                   AGALVIADTLGATHVLRQDMLSSATSSFLLGSRLGRVFQVMHQGAVRSLQAGDPKAAQA
FT                   VLTRLEVTLSRQLRSGAHDYGQNRRAQLEQISNEARTLAAQYVELNRVGLMSFDDATTH
FT                   IKALAADVLAQMQGTVGGTSLQQLHTGNPRHLFGIAGRAGAAITSTATLAVGISGVVHA
FT                   HGAFDLAYGSAAIASGAFGATYAGLVYTIGAHRVNADKRSRIVRFTDSASDFMAVAYGG
FT                   LGTGVQWSGGHYDLAIATGVSTALLLGGRLNTHFPNATPLIKKIPTAVVLIPVGAFAYK
FT                   LIESLWTTFFGSGSGSSNQSNQSNSSQSNLAPGASPSASASASASPSASAAPSASAVAS
FT                   PSASPAAPASPSASATPSTAQPSGSPQPYIVVAGDSLWVIADQHRQSLLDAAHVSRTDQ
FT                   QAMTRGEQDTRAFNEILQLNPSVSRDPNRLSVGTPLIVG"
FT   gene            complement(650016..650804)
FT                   /locus_tag="Bcen_3525"
FT   CDS_pept        complement(650016..650804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3525"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   xcv:XCVc0028 type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78419"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR6"
FT                   /protein_id="ABF78419.1"
FT                   /translation="MMRARALRTAAACVAALVALVLACGQHGVAHAAGSAAGFAQLARA
FT                   CAPNVDPDTLAALVRTESGFNPYAIGVVGGHLTRQPASLDEARATARELSSRGFSYSVG
FT                   LAQVNERNFAKYGLDEATMFEPCRNLQAGGAILTECFARSSGTGRATQAALRAALSCYY
FT                   SGNFTTGFSSGYVSRVVASAQRNAREGGVEPIPVVSDTTPARQRRMDAVATTPPDRARR
FT                   LPLPAASADAPSCHARPVVMMCRGLPANQAKRLCVRCLDQ"
FT   sig_peptide     complement(650706..650804)
FT                   /locus_tag="Bcen_3525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.962 at
FT                   residue 33"
FT   gene            complement(650801..651475)
FT                   /locus_tag="Bcen_3526"
FT   CDS_pept        complement(650801..651475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3526"
FT                   /product="Yop virulence translocation R"
FT                   /note="TIGRFAM: Yop virulence translocation R; PFAM: type
FT                   III secretion system inner membrane P protein; KEGG:
FT                   xcb:XC_3016 HrcR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78420"
FT                   /db_xref="GOA:A0A0H2XW22"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW22"
FT                   /protein_id="ABF78420.1"
FT                   /translation="MGNLPNPVALIAVIAALGIAPFAALMVTSYTKLVVVLGLLRSALG
FT                   IQQVPPNLVLNGIALILSLFIMAPVGMSIRDALQARHFDASGQLSTSDIGALADAALPP
FT                   IKDFLVSHTRQRDREFFVRTATSVWPKNRADGIKDDDLLVLVPSFTLAELTKAFQIGFV
FT                   IYIVFIVVDLLVANILLALGMQMISPTTISVPFKLLLFVALDGWSLLVHGLVLSYRVAG
FT                   AG"
FT   sig_peptide     complement(651404..651475)
FT                   /locus_tag="Bcen_3526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.373 at
FT                   residue 24"
FT   gene            complement(651479..652633)
FT                   /locus_tag="Bcen_3527"
FT   CDS_pept        complement(651479..652633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3527"
FT                   /product="type III secretion system apparatus protein
FT                   YscQ/HrcQ"
FT                   /note="TIGRFAM: Type III secretion system apparatus protein
FT                   YscQ/HrcQ; PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: bpe:BP2241 putative type III secretion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78421"
FT                   /db_xref="GOA:A0A0H2XTW7"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTW7"
FT                   /protein_id="ABF78421.1"
FT                   /translation="MPALFLTNADAGDAANRALPAASPPPAAAPAAVALDASPYLPRLS
FT                   AAAARGLSHAYGATGAVPVTLGEHAYEVRWRVDAEPATDAHAYRFVVGPAAGTLWIDPL
FT                   AEAEWLADAADPAVPAVIRAALLADLCAPLTAVLQAATRQRVELLPPPDGVPAWHASPA
FT                   ALRFELRRADATWRCHGALLFDAPDALAVFFAAAPAALADARAAYANLPVPLVFEIGRT
FT                   ELTTAELADVVGGDIIAIERWQAHEQNLLCVARLPAAPAWEITGRPSGNRLTVERIREM
FT                   PLEPTRTDSAPPTTHDAPPADVPRSLDGLAVDLRFELPPTSMPLGELSALQPGAVIELQ
FT                   QGINQSVIHLVANGMLIGTGHLIAVGQKLGVRVVTLTQPAPRER"
FT   gene            complement(653016..653414)
FT                   /locus_tag="Bcen_3528"
FT   CDS_pept        complement(653016..653414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3528"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: transcriptional regulatory protein-like; KEGG:
FT                   bur:Bcep18194_B0860 response regulator receiver domain
FT                   protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78422"
FT                   /db_xref="GOA:A0A0H2XVA6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVA6"
FT                   /protein_id="ABF78422.1"
FT                   /translation="MDCKYLYIDNIKINFVRRTIEIDNKVVDVTPREFDVVEFLLDNMN
FT                   KIVPRQAIQEAVWGRELGVSSRTLDTHISRIRSKLQLEHDKNLRIIPIYAVGYRLVLFG
FT                   AAMTHVERHDAAPVLRAAPQAAMAADYA"
FT   gene            complement(653864..656074)
FT                   /locus_tag="Bcen_3529"
FT   CDS_pept        complement(653864..656074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3529"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding; KEGG: bur:Bcep18194_B0862 aldehyde
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78423"
FT                   /db_xref="GOA:A0A0H2XW07"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW07"
FT                   /protein_id="ABF78423.1"
FT                   /translation="MTIELDHTDAVRPSRRTFLKTAGAAAAVSLTIGFDWAGLGRRALA
FT                   ATAPAGDFAPNAFLRITPDGAVTVIAKHVEMGQGAYTGIATIVAEELDADWSSVRVESA
FT                   PADAKRYANLAFGTMQGTGGSSAMSNSWQQLREAGGKARAMLVSAAAARWKVPAGELTT
FT                   ANGVVSHAKSGKTAAYGTLVADASKLPVPDKVTLKQPADFKLIGHRIPRVDGSSKSNGT
FT                   AHFTLDTTFPGMRVALLQRPPRFGATVKSFDATAAKAVPGVVSVVQVPGGVAVVATGFW
FT                   AAKQGRDALKIDWDETKAEKRGSDELMREYRQLAEKPGTSARKDGDADAAIAGAARKVS
FT                   ATYEFPYLAHAPMEPLDAVVKLTANSCEIWAGDQFQTVDQGNAAKTAGLKPEQVKIHTL
FT                   YAGGSFGRRANAWSDYVVEAVSIAKALGADGKPVKLQWTREDDIQGGFYRPMYFHKLDA
FT                   GLTADGKLVGWRHRIVGQSILAGTPFEAFMVKNGVDATSVEGAANLPYAVPNVSVELTT
FT                   TQVGLPVLWWRVVGSSHTAYAVEAFIDEAAHAAGKDPYAFRRDLLAKEPRMRAVLELAA
FT                   QKAGWDPAKPLPKGRGRGIAVAEAFKSYVAQVAEVSVDADGKVKVERVVCAVDCGIAIN
FT                   PDIVAAQMEGGIGFGLGAAMHSAITLKDGQVEQRNFDGYHVLRMAEMPKVEVHIVPSAE
FT                   APTGVGEPGVAPVGPAVANAIFAATGKRHYVLPFDSADSAKA"
FT   gene            complement(656077..656538)
FT                   /locus_tag="Bcen_3530"
FT   CDS_pept        complement(656077..656538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3530"
FT                   /product="(2Fe-2S)-binding protein"
FT                   /note="PFAM: ferredoxin; KEGG: bur:Bcep18194_B0863
FT                   (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78424"
FT                   /db_xref="GOA:A0A0H2XUR9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUR9"
FT                   /protein_id="ABF78424.1"
FT                   /translation="MPTSFVLNGKNVTLDADPSMPVLWAIREHAGLTGTKFGCGMAQCG
FT                   ACTVHLEGQAVRSCVLPLAGIAGKHVTTIEGLQSKPAQAVQAAWVKLQVPQCGYCQSGQ
FT                   IMSATALLEQNPKPTDADIDAAMNGNLCRCATYARIRAAIHDAAATLGA"
FT   gene            656720..657643
FT                   /locus_tag="Bcen_3531"
FT   CDS_pept        656720..657643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3531"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0864 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78425"
FT                   /db_xref="GOA:A0A0H2XW27"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW27"
FT                   /protein_id="ABF78425.1"
FT                   /translation="MDMTDIVASREAGRRELASLIGRFAPADGSHSTAVPGLMLHRHTR
FT                   PVDLGCAVSRAALVIAAQGAKRVIVAGQAYEYDTHNCLITSIDLPILSRVTRASADEPY
FT                   LCLSLTLDPQRIVELAAEMRLPEPDAGPEGEGIALAELTPPLLDAALRLLRLLDTPADI
FT                   AVVAPLIEKEVLYRLMTSGQGTRLRHMAIAGSQTHRIARAIEWIRDHFAEPMRVESLAQ
FT                   AVNMSVSSLHHHFKHVTTLSPLQYQKQLRLHEARRLLLRQGGDVGSVAAVVGYESASQF
FT                   SREYSRLFGAPPMRDVVHLRKKELLG"
FT   gene            complement(657868..658251)
FT                   /locus_tag="Bcen_3532"
FT   CDS_pept        complement(657868..658251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTX0"
FT                   /protein_id="ABF78426.1"
FT                   /translation="MPNGHCVATPACSGTSSFMACRLPEVRLSPSGTPRHTQYKRWPLV
FT                   NQRIGEKAMKITTDRSTLASFKHQRGCQRNRSACRGASSTSAEADRRLPKRYPCGGMER
FT                   VRDAVEQIDVWFLEMLDEEESHE"
FT   gene            complement(658890..659162)
FT                   /locus_tag="Bcen_3533"
FT   CDS_pept        complement(658890..659162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78427"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVB2"
FT                   /protein_id="ABF78427.1"
FT                   /translation="MRKKRADQATAYSVHRRFPDWLVTNWSPPHRCCIVSTARRCVQSR
FT                   KPHAMRYATGRCARHAAARPDHYARNGIFCFRNVSRQRWAHGGYH"
FT   gene            659228..659479
FT                   /locus_tag="Bcen_3534"
FT   CDS_pept        659228..659479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW13"
FT                   /protein_id="ABF78428.1"
FT                   /translation="MPISRPPRAPRAGAVAVPCGNRATAVLDLIQHSRMGQAVRAGQHD
FT                   ADSSSTVQSRFDRAGPVPAPAGLDRTRVGRIIRKAFLR"
FT   gene            659937..660260
FT                   /locus_tag="Bcen_3535"
FT   CDS_pept        659937..660260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUS3"
FT                   /protein_id="ABF78429.1"
FT                   /translation="MKKLLIAAAVLAVSGAAFAGSGTVSSSNSSSGGQTMAGVAGFGHF
FT                   TATDSGSALGAAGATAGGGSSGSISYTNHTQTSTVGGFGFGGAQAGGSSGANAGSTGWT
FT                   YHH"
FT   sig_peptide     659937..659996
FT                   /locus_tag="Bcen_3535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 20"
FT   gene            660372..660962
FT                   /locus_tag="Bcen_3536"
FT   CDS_pept        660372..660962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW33"
FT                   /protein_id="ABF78430.1"
FT                   /translation="MKAKVILATALTVISSAALAAGSSTTNQTQSVAAGVSGSVLVGSG
FT                   SYTSNSTSTAGANAGSAVTPAGSAGTASAYHNSTSTASGSGTNGGAFAAGGGIGAAGSF
FT                   AGNGSTNENANALSGGVTATIVLGANHYTATGANDHGNANAGAVGWTGSGGSGAITGSN
FT                   HYNSSTVWSTGPAGSPSASGGSQGDSSATGSSH"
FT   sig_peptide     660372..660434
FT                   /locus_tag="Bcen_3536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            661042..661323
FT                   /locus_tag="Bcen_3537"
FT   CDS_pept        661042..661323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTX5"
FT                   /protein_id="ABF78431.1"
FT                   /translation="MKQNLIAAALMFASLTAYGADRAADGGQSTMQTSNKPDQTTKPSE
FT                   QQTLSSGSAIGGPDTQQWQGMSAGSWSQLGSGWKQFGEAAKTEGIQGN"
FT   sig_peptide     661042..661101
FT                   /locus_tag="Bcen_3537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.947 at
FT                   residue 20"
FT   gene            661368..663026
FT                   /locus_tag="Bcen_3538"
FT   CDS_pept        661368..663026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVB8"
FT                   /protein_id="ABF78432.1"
FT                   /translation="MNSNRIKVACAAMFAMTTIGAQAQTADSTSSAQSSTSSTAISQGG
FT                   GSSMNTNTTSSRGGNATSSSGVRGSGNSSVNVNVTMPSSTAGGNVTPQSTNTLAAGAPG
FT                   SSPYNTQATENVNYSGTQTIKTNPSIQAPGLTTTLSDTCMGSVSVGVSFPGFGATGGTT
FT                   LVDQACVRRLDAREFRAMGLTDVALALLCQSDANRRAVEATGHLCPGTTAPLARSNVAP
FT                   SVEATVADDVKYRDPIVRDRMGLPPLGSAAPAPAATRPIETASMRAAPVSVPVPVPVPA
FT                   LAPVAAAPAVATPAVAAAAPAVAVPTVAAAVPVAAAPAAAAPAVAAAPAASVVPAAAMA
FT                   AVPAAAVIAAPAVADKAAPAPAAPVADTKAAEPVQPVVDKAAEPAPTVADKAPEAAPAV
FT                   ADKTPEPAPAVADKAPEPAQPVADKAPEPMPAATDTAQAVGEPVAEPMPAAAVVAAPAA
FT                   DAKAAEPAPQATAEAPAPAAPQPAVAAAPADMPAADAKVPDAVESAGTAAAQAAGMPAL
FT                   TDPAQALPPATVDKQAAPAAPVAPAPTVISTSTSS"
FT   sig_peptide     661368..661439
FT                   /locus_tag="Bcen_3538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.864 at
FT                   residue 24"
FT   gene            663182..663766
FT                   /locus_tag="Bcen_3539"
FT   CDS_pept        663182..663766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW18"
FT                   /protein_id="ABF78433.1"
FT                   /translation="MRIFLIALWLASVQAAAQSVFQNPAVFVILSEQTLANAASVQQAL
FT                   STLGRPDNTACAPMMMIGDPQMIYMMPEAGHAPSWQSPVYGRGAPFDAQNGPKSTGKTV
FT                   GAMQHTEDMQTQPWSDGSAITQQIAGESSVTAAERVNEWRHAGLDRIETARASDVTVNG
FT                   KTYRAYRDDLNGSTKPVVEPQIYTQRVVFCR"
FT   sig_peptide     663182..663235
FT                   /locus_tag="Bcen_3539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.781 at
FT                   residue 18"
FT   gene            663902..665299
FT                   /locus_tag="Bcen_3540"
FT   CDS_pept        663902..665299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3540"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction region; SMART:
FT                   ATPase; KEGG: bur:Bcep18194_B0877 sigma54 specific
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78434"
FT                   /db_xref="GOA:A0A0H2XUS7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUS7"
FT                   /protein_id="ABF78434.1"
FT                   /translation="MSGPRDVERLVSALPFIAVRHNPVAPSRPLVYLSQQHDAALVDVL
FT                   ASRGWDVWRAKTVADALNLVKANRPHAGIVDFGSFASPDVASFEALPRDPRVGWVALAD
FT                   GERLRNITIARLIRHCCFDYVRNAGAYTTIGYLVGHAYGMLKLADGDPAAEAPPPGGTM
FT                   IGACGAMRRLFATIRKVANTEATVFIAGESGTGKELTAAAIHRQSSRADAPFVAVNCAA
FT                   IPTTLLQAELFGHERGAFTGAHQRKIGRIEAAHGGTLFLDEIGDMPFESQASLLRFLQE
FT                   GKIERLGGHASIPVDVRIVSATHVDLEAAMQAGRFRADLYYRLCVLRIDEPPLRMRGRD
FT                   IMLLADDVLRRYRDDGSYRIRGFTPCAIEAIHNYPWPGNVRELINRIRFAVVMTNGPLI
FT                   SAADLELRPYTSLRPPTLAQARRQAERHAIEETLLRHRHQHADVAAELGISRATLYRLM
FT                   IAHGLHS"
FT   gene            665430..665936
FT                   /locus_tag="Bcen_3541"
FT   CDS_pept        665430..665936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78435"
FT                   /db_xref="GOA:A0A0H2XW37"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW37"
FT                   /protein_id="ABF78435.1"
FT                   /translation="MAECSHCGRTFLLGGQSIDGRRYCGPACAHAHPVVVEAERVPDAK
FT                   VRQYVDDWRYGPCPICLREGRPVDVHASHRVVSLLFVTRWATRRHVCCRRCGRRKQALA
FT                   LLASATLGWWGLPWGIVLTPIQLARNLLGLAARDPEVATQQFEQLVRRKLAARRLARAE
FT                   RGAGA"
FT   gene            complement(665962..666453)
FT                   /locus_tag="Bcen_3542"
FT   CDS_pept        complement(665962..666453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTX9"
FT                   /protein_id="ABF78436.1"
FT                   /translation="MTDSDLQSDDTSIHEDGLWRDNGWTARIIKNEDDDGWAVEMVKDG
FT                   ESEPALVGPWTMGRDKKNPKPMDANAFRTLVKTATEVLMRHEQQRRALLHKEVTVQDEA
FT                   GQDVSVTLDIVPDEFEPYAQLKAFDPYGELLADAKVSAGFKLNKASAERWVASGFDRPA
FT                   "
FT   gene            666830..667507
FT                   /locus_tag="Bcen_3543"
FT   CDS_pept        666830..667507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3543"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG:
FT                   bur:Bcep18194_B0880 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78437"
FT                   /db_xref="GOA:A0A0H2XVC3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC3"
FT                   /protein_id="ABF78437.1"
FT                   /translation="MRKFNVRIVFAYDWPLTLAGIEQIAGGSCAIELVAVYRSAAELVA
FT                   SLGGVDCDIVLVDYAIRGDEQMDGLALFDWLRRMRPNVGIVALVANENPLIFRSILGIG
FT                   HVSVVSKLDEVGHIVTAIHSSYSGGAYLSPSVRRAVDALGTRGDPPVKLSAREIEVIRL
FT                   YLSGVPIKTIAQRLSKGKQTVSAQKISAMKKLGANNDVELIQRAAGLGLGSGEAALRAG
FT                   SAA"
FT   gene            complement(667560..669185)
FT                   /locus_tag="Bcen_3544"
FT   CDS_pept        complement(667560..669185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3544"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region; KEGG:
FT                   bur:Bcep18194_B0881 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78438"
FT                   /db_xref="GOA:A0A0H2XW23"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW23"
FT                   /protein_id="ABF78438.1"
FT                   /translation="MARRQTTYPVTPLRRASTTDRPHTMRNLSLNQKLASMIVILWLGL
FT                   LVIAGLGAWQTRASMIADRRDQLASLVAQAASVTDHYYKLSQQNVMPEADAKQKAIEAI
FT                   AAMRHGADGYISINDSKPVIVMHPIKAELNGKDVSNFTDPNGKHLFVEIVKAGNAEGGK
FT                   GFVEYLWPKPGADKPQEKTSAVQRFAPWDWYLVTGMYMNDVRSAVLASIGRWLAMTAVL
FT                   GAIATAVMVLVLKSVRASLGGELEAALDAAQRIAQGDLTARVTVKHDDRGSLLHALHTM
FT                   QGGLIDMVSRVRMGTENINVGASEIASGNTDLSQRTEEQAAALVQTASSMDEMTANVKQ
FT                   NADSAAQAASLAGQAAQVATRGSEVVDDVVRTMNEITDRSHKIGDIIGVIDGIAFQTNI
FT                   LALNAAVEAARAGEQGRGFAVVAAEVRSLAQRSATAAKEIKSLIVSSNETVQHGATLVT
FT                   HAGETMAEIVQSVRRVNEILDEISHASREQSAGIEQVNRAVGEMDQVTQQNAALVEQAA
FT                   AAAHSLRDQAEALRDAVTRFALPV"
FT   gene            669362..670309
FT                   /locus_tag="Bcen_3545"
FT   CDS_pept        669362..670309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3545"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bur:Bcep18194_B0882 2-dehydropantoate
FT                   2-reductase TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78439"
FT                   /db_xref="GOA:A0A0H2XUT3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUT3"
FT                   /protein_id="ABF78439.1"
FT                   /translation="MRILVVGAGAVGGYFGGRLVAAGRDVTFLVRDGRAAALARDGLLI
FT                   RSPRGDLTLANVQTVRAGDAGAGVAPFDLVLLSCKAYSLDDAIASFAPFVGPQTLILPM
FT                   LNGMRHLDVLRERFGAAPVLGGLCVIAATLDREQRIVHLNDTHGVSFGELAGGESPRVR
FT                   AVADVLGGAGFDATLSDDIAARMWDKWVFLATLAASTSLFRGSIGDILAAPDGRRLLET
FT                   MLAECSAIAEHNGHRPDPAASERMQRMVLTPSPLTASMLRDVENHARVEADHVIGDLLA
FT                   RRDPQATDTLSLLRIAYNHLKTYEVRTAREHAAA"
FT   sig_peptide     669362..669427
FT                   /locus_tag="Bcen_3545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.667) with cleavage site probability 0.580 at
FT                   residue 22"
FT   gene            670560..671519
FT                   /locus_tag="Bcen_3546"
FT   CDS_pept        670560..671519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3546"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0883 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78440"
FT                   /db_xref="GOA:A0A0H2XW42"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW42"
FT                   /protein_id="ABF78440.1"
FT                   /translation="MMHPDLEVVDVRRDESFKVWSHGYPYRTIRWHFHPEFELHLIVAT
FT                   HGKYFVGDHIGSFGPGHLVLLGPNLPHNWVSDMAEGETVERRNLVIQFDPSFVRRCMDA
FT                   FPECRDAQTLLDDARRGVGFDAATSAAIAPLFDELLTARGMRRIALFMTILERLCGAAE
FT                   RTLLASPAYDQADVTPTRLSHALSYIGKNLASELRESDLAQLTGQSVSAFSRTFHRHTG
FT                   MPFVQYVNRLRIESACQMLLADDASITDICFQAGFNNVSNFNRQFRAVKGMAPSEFRAL
FT                   QRLNARSRELALHAAPTGNPLPPRVLTPGAPELTPQPG"
FT   gene            671640..672587
FT                   /locus_tag="Bcen_3547"
FT   CDS_pept        671640..672587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3547"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bur:Bcep18194_B0884 ABC
FT                   sugar transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78441"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTY3"
FT                   /protein_id="ABF78441.1"
FT                   /translation="MTHASPATSPRRAARLAAVAALAGAALLSAAAAAHAAPLRIGMTF
FT                   QELNNPYFVTMQKALNDAAASIGAQVVVTDAHHDVSKQVSDVEDMLQKKIDILLVNPTD
FT                   STGIQSAITQAKKAGAVVVAVDANANGPVDSFVGSKNYDAGVMSCEYLAKAIGGSGEVA
FT                   ILDGIPVVPILERVRGCKAGLAKFPNVKLVDTQNGKQERATALSVTENMISAHPNLKGL
FT                   FSVNDGGSMGALAAIEGSGKDIKLTSVDGAPEAIAAIQKPNSKFIETTAQFPADQVRIA
FT                   LGIAIARKWGATVPKAIPVDVKVVDRGNAKGFSW"
FT   sig_peptide     671640..671750
FT                   /locus_tag="Bcen_3547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.910 at
FT                   residue 37"
FT   gene            672650..674170
FT                   /locus_tag="Bcen_3548"
FT   CDS_pept        672650..674170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3548"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bur:Bcep18194_B0885 ABC sugar transporter, ATPase subunit;
FT                   TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78442"
FT                   /db_xref="GOA:Q1BPL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BPL3"
FT                   /protein_id="ABF78442.1"
FT                   /translation="MDTILRLSHITKSFPGVKALSDIDLEIARGEIHALLGENGAGKST
FT                   LMKILCGIHQPDAGTIEIDGAARHFADYHDAVAAGVGIVFQEFSLIPHLDAVDNLFLGR
FT                   ELRNRWGARDRKRMRAAAAAIFARLGVAIDLDAPIRTLSVAQQQFVEIGKALSLDARIL
FT                   ILDEPTATLTPAEAEHLFAIMRELKRQGVAMIFISHHLDEIFVVCDRITVLRDGQYVAT
FT                   TEVARTDVEQLVRMMVGRRIESSFPPKPVLPADAPAVLEVDALQIERDGPVNRFALREG
FT                   EILGFAGLVGSGRTETALAVIGATRAHRKELRVRGAAAKLADPADALRAGIGILPESRK
FT                   TEGLVTSFSIRDNISLNNLGKYRSMRWLIDRRGEARTTHDVMRRVGVKAPSIHTEVATL
FT                   SGGNQQKVVIARWLNHHTSVLIFDEPTRGIDVGAKAEIYGLMRELTARGYAIIMISSEL
FT                   PEIVGMCDRVAVFRQGRIEATLEGDEIDPDTVMTYATAGTRGATHEPA"
FT   gene            674157..675170
FT                   /locus_tag="Bcen_3549"
FT   CDS_pept        674157..675170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3549"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B0886 ABC sugar transporter, inner-membrane
FT                   subunit; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78443"
FT                   /db_xref="GOA:A0A0H2XVC9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVC9"
FT                   /protein_id="ABF78443.1"
FT                   /translation="MNLPDSSSTPSTTLAATAGNGDAPPPRAMWAQLRRSTLFYPLVGL
FT                   IVVCIAMMIASPSFLSAANLENVLRQVSINAIIAVGMTCVILTGGIDLSVGSVMALSGT
FT                   LAAGLMVAGVNAVAALAIGIAVGLGFGFLNGVFVAFAGMPPIIVTLATMGIARGLALIY
FT                   TGGYPIDGLPDWVAFFGSGKVLGIQAPVLIMLVVYAIAWLLLDRMPFGRYVYAIGGNEQ
FT                   ATRLTGVRVARVKLIVYTLAGLTSALAAIVLTGRLMSGQPNAGVGFELDAIAAVVMGGT
FT                   SISGGRGAILGTLVGALLLGVLNNGLNMIGVNPYVQNVIKGGIILLAIYISRERSR"
FT   gene            675217..676305
FT                   /locus_tag="Bcen_3550"
FT   CDS_pept        675217..676305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3550"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding; KEGG:
FT                   bur:Bcep18194_B0887 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78444"
FT                   /db_xref="GOA:A0A0H2XW29"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW29"
FT                   /protein_id="ABF78444.1"
FT                   /translation="MTTPEAQPRMTAVVCHGPEDYRVEQVAKPNPGANELVIRIAACGI
FT                   CASDCKCYTGAKMFWGGPSPWVKAPVIPGHEFFGHVEALGDGAAEHFGVALGDRVIAEQ
FT                   IVPCGKCRYCKSGQYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPLGVSLEDA
FT                   AIIEPLSCAIHTVNRGDVQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLIDERLE
FT                   LARQYGADVTINPQRDDAREIVRALTDGYGCDVYIETTGAPVGVNQGLDLIRKLGRFVE
FT                   FSVFGEDATVDWSIIGDRKELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHGFALED
FT                   WDDAIRVAKSPESIKVLLKPAR"
FT   gene            676335..677882
FT                   /locus_tag="Bcen_3551"
FT   CDS_pept        676335..677882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3551"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="PFAM: carbohydrate kinase, FGGY; KEGG:
FT                   bur:Bcep18194_B0888 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78445"
FT                   /db_xref="GOA:A0A0H2XUU0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU0"
FT                   /protein_id="ABF78445.1"
FT                   /translation="MEYVIGVDIGTQSTKALLVDRHGTIVARRSSGYQPDTPRPLWAEQ
FT                   WPQVWFDAVRDCIAGCVSDARAQGVPADAIRAVCVSSLYGGSGIPVDIDMRPLHPCLIW
FT                   MDRRATAEVDWVNEHVNVERLRVITGNGVDSYYGFTKMLWLRDQRPDVWANVRYFLPPN
FT                   AYVIYLLTGEVAVDHSSAGNIGGVYDVARREWSDDALDMLGIPATMMPERLVDSTDVVG
FT                   GLLSQWTAQFGLPAGTPVVAGGVDAAVATFAAGATRTGQHVAMIGTSMCWGYVNRHVDA
FT                   RHGLVSMPHVFDGQRDLYVFGGAITAGASVAWFRDQFCHAEIDAARLLPHGDPHVLLEE
FT                   AAERVPAGADGVLFLPYLMGERSPVWDAKASGAFVGLSLAHTRAHLYRAVLEGVAFALR
FT                   HNIEAGRRGAVALDDRLIVVGGAAHSALWMQIIADVTGFPVWTIEQDVEAAMGAALLAG
FT                   VGAGLVSRDDAQGGWVTLVERARPDADRVQTYDARFALYTALYPALKPIMHRLGTSS"
FT   gene            677912..678637
FT                   /locus_tag="Bcen_3552"
FT   CDS_pept        677912..678637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3552"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B0889 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78446"
FT                   /db_xref="GOA:A0A0H2XW45"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW45"
FT                   /protein_id="ABF78446.1"
FT                   /translation="MLVTGASSGIGRACAVALAQAGARVVAAGRDMAALDTLAGEIACD
FT                   TLRLDVGGDQHAIDAALAAYDAFDGLVNCAGIASLEPALEVCAAQFDHVMAVNARGAAL
FT                   VARAVARKMIERDGRGAAHARGSIVNVSSQAALVGLPAHLSYCASKAAMDAITRVLCIE
FT                   LGPHGIRVNSVNPTVTLTPMAQFAWSEPEKRAPMLAAIPLGRFAEPHEVVEPILFLLSD
FT                   AASMISGVSLPIDGGYTAR"
FT   sig_peptide     677912..677971
FT                   /locus_tag="Bcen_3552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.886) with cleavage site probability 0.720 at
FT                   residue 20"
FT   gene            complement(678689..678985)
FT                   /locus_tag="Bcen_3553"
FT   CDS_pept        complement(678689..678985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78447"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTZ0"
FT                   /protein_id="ABF78447.1"
FT                   /translation="MQYPARTPPISEFLRRSTPRNKNPAANACPIAYNGDEARPPRHRR
FT                   HALHEFSMSDHTTPTPEPPADPNRDPEDDPFSPPPGHHDNPQQPDGPPSKDPV"
FT   gene            complement(679003..679587)
FT                   /locus_tag="Bcen_3554"
FT   CDS_pept        complement(679003..679587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3554"
FT                   /product="uncharacterized MobA-related protein"
FT                   /note="KEGG: bur:Bcep18194_B0890 uncharacterized
FT                   MobA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78448"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVD5"
FT                   /protein_id="ABF78448.1"
FT                   /translation="MSYASLATGVLLAGGLGQRFDPSGLHSKLLARLPDGTPVAVAAAR
FT                   RLAAATADVIAVVRPGAEKLAMLLNEAGCQVVYAPDALRGMGASLAAGVRTTPDANGWL
FT                   VALGDMPWIAASTYETVARALETDDASIVAPAHRGVRGHPVGFAAHHFDALAALDGDTG
FT                   ARALFASAPVTLLDVDDPGILRDVDTPADLR"
FT   gene            complement(679690..680382)
FT                   /locus_tag="Bcen_3555"
FT   CDS_pept        complement(679690..680382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3555"
FT                   /product="peptidase M15D, vanX D-ala-D-ala dipeptidase"
FT                   /note="PFAM: peptidase M15D, vanX D-ala-D-ala dipeptidase;
FT                   KEGG: bur:Bcep18194_B0891 peptidase M15D, VanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78449"
FT                   /db_xref="GOA:A0A0H2XW34"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW34"
FT                   /protein_id="ABF78449.1"
FT                   /translation="MPATVIPLSDPAVRSIALQESHEGFVDLAGFHDRIAVDLDRRDIE
FT                   SRSPHFLKVRRSVAERLIAAAHALPAGLRLYVKEGYRPLALQRRSFTEHLAHLRRTLNP
FT                   LPDEDTLVALTSHYVALPEVAAHPTGAAIDLTLISAEGIEIDMGTIMNATDQESSGACY
FT                   THNTFISRAAARNRQILIGALTRAGFTNYPSEWWHWSFGDRYWAVMQNESHAIYGPVEE
FT                   SMLDEASR"
FT   gene            complement(680630..680959)
FT                   /locus_tag="Bcen_3556"
FT   CDS_pept        complement(680630..680959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUU7"
FT                   /protein_id="ABF78450.1"
FT                   /translation="MRSLSRSRAGARAASKDGSKTISSNDPTHIAMPLTPVSKSEFKAR
FT                   ALEHLRLIEASGEDLIVTDHGKPTLEIRPYRSREAQPLDILRGSVMRYDNPLDPIAKED
FT                   WETSL"
FT   gene            complement(680952..681635)
FT                   /locus_tag="Bcen_3557"
FT   CDS_pept        complement(680952..681635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3557"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase, alpha subunit; KEGG: bur:Bcep18194_B0892
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78451"
FT                   /db_xref="GOA:Q1BPK4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BPK4"
FT                   /protein_id="ABF78451.1"
FT                   /translation="MMLHIPGVLTKAQVAQCREMLDTADWVDGNATSGAQSALAKRNRQ
FT                   LPEGSPVARTVGDAIQDALARHPLFFSAALPLKVFPPLFNRYEGGETFGTHVDNAIRLL
FT                   RGTDFRVRSDLSATLFLEEPDAYDGGELCVEDTYGVHRAKLPAGDLVLYPASSLHHVTP
FT                   VTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQALSAEKGAKDPVVISLTGIYHNLLR
FT                   KWADA"
FT   gene            complement(681632..682387)
FT                   /locus_tag="Bcen_3558"
FT   CDS_pept        complement(681632..682387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3558"
FT                   /product="Sel1-like repeat protein"
FT                   /note="PFAM: Sel1-like repeat; KEGG: bur:Bcep18194_B0893
FT                   TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78452"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW49"
FT                   /protein_id="ABF78452.1"
FT                   /translation="MEAVSLKALASVSPREFADILAGPPERAAAWVAAAADHGIVDAQA
FT                   VYGQYLLDGHGVARDPAAAFNWFRHAARAGHPMAMNMLGRCYEFGWGTAACAPVAVYWY
FT                   RLAAQAGLDWGMYNYATALALGHGVDENRADALDWFRRAAALGHAKSINLIGGFYEDGW
FT                   VVAVDTDAAFDHYRRAAIAGDFRGQFNYARLLAERGRIDEALAWLARVPATATPAFIAK
FT                   MRAYLVSSPLDAFRSVAMQLAPHAMEFAS"
FT   gene            complement(682391..684634)
FT                   /locus_tag="Bcen_3559"
FT   CDS_pept        complement(682391..684634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3559"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; KEGG: bur:Bcep18194_B0894
FT                   TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78453"
FT                   /db_xref="GOA:A0A0H2XTZ6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XTZ6"
FT                   /protein_id="ABF78453.1"
FT                   /translation="MKSRPDELKLGKFTTLCSVLAASPAFADGTPPAAPASTEGHLAPI
FT                   EIQGKTEHSYKADFSASAKFTAPLVDTPKSVTVIPQELIQSSGAATLTEALRTVPGITF
FT                   GAGEGGNPLGDRPFIRGYDTQGSMFVDGMRDTGATTREIFNTERVEITKGSDGAYGGRG
FT                   GAGGSINLITKAPHLGTTAAASAGLGTDRYRRFTADGNWQFAEHAAFRLNLMSHNNDVA
FT                   GRDAVNNERWGVAPSIAFGLGTPTRVTASYYHLQTDDMPDGGIPYFYTTSNKPANVGTI
FT                   YPAPVDRHNFYGLIDRDFRKTTSDISTIKIEHDITPNLTVRNTTRYTESTQDYIWTQPD
FT                   DSQGNVVNGKVWRRNNNRNSSINSLANLTELFGEFRTGPFKHSFTTGIELSREWGKRDS
FT                   YTVATDKGTICQKGIGAASGYNCTSLWSPNPNDPWAGSITRNNDYAHARTTTKSIYGFD
FT                   TIEITPRWQVNAGVRVDDYSTRFTDTKANGGKTYTRDDTLFNWQAGLVFKPAQNGSIYA
FT                   SYATSSTPAGMMLGEGSETQSLTPGRGGVGPNADQLSPEKNRSIELGTKWNVLNDKLSL
FT                   TAALFQIDTTNARVTLPNNQYAMVSNKRVQGLELGLAGQITKQWQVFGGYTYMKSQLRD
FT                   NGKDAANNGNRFPNTPKHSLTMWSNYDVTPKFTVGGGAFYMSEVFGDPANLRAVPSYWR
FT                   FDAMAQYRINKKLDLQLNVNNLFNRTYFDQAYPAHYASIAPGRSAFVTLNARY"
FT   sig_peptide     complement(684551..684634)
FT                   /locus_tag="Bcen_3559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(685131..686426)
FT                   /locus_tag="Bcen_3560"
FT   CDS_pept        complement(685131..686426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3560"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: bur:Bcep18194_B0897 aspartate
FT                   carbamoyltransferase TIGRFAM: aspartate
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78454"
FT                   /db_xref="GOA:A0A0H2XVF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVF8"
FT                   /protein_id="ABF78454.1"
FT                   /translation="MTVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQE
FT                   SRGMPEIVERFVSEIVERSAPDGENYTQSVDKQGLAKQFLFEGKPQLISVDQFSRDSVE
FT                   ALFRVADVMQPIARRHKISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGF
FT                   TFSSMAKGESIYDTSRVMAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQ
FT                   ALLDLYTIQREFSRLGKIVDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTL
FT                   EMPTYIVEQIATNGHVVEQTNDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQ
FT                   ALVDAVCKPDTLIMHPLPRDSRPGANDLSVDLNRDPRLAIFRQTDNGIPVRMAIFAVLL
FT                   GVENLVQHSMRDATWRPPAYLGPEDAVFHGID"
FT   gene            686661..686795
FT                   /locus_tag="Bcen_3561"
FT   CDS_pept        686661..686795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3561"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: bur:Bcep18194_B0898
FT                   Entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78455"
FT                   /db_xref="GOA:A0A0H2XW63"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW63"
FT                   /protein_id="ABF78455.1"
FT                   /translation="MTRTIAAMLLVVTAALAGCNTVAGVGQDISKGGQAISDSAEKAK"
FT   sig_peptide     686661..686732
FT                   /locus_tag="Bcen_3561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.576 at
FT                   residue 24"
FT   gene            complement(686890..687438)
FT                   /locus_tag="Bcen_3562"
FT   CDS_pept        complement(686890..687438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78456"
FT                   /db_xref="GOA:A0A0H2XUX4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX4"
FT                   /protein_id="ABF78456.1"
FT                   /translation="MNRKEAKTRIAVLLSAGTRKADTLAELSGQGLKDRVLAHLIASRP
FT                   DPERCRKNKVHVRILIALGIAQLVISLMLAYYFFVSGAGNVLVTVFLALTVPLSLLFIW
FT                   GFATHRVGAYHAFIVLSLLQIPKAVADLGRDPAAALPSLAITVVLVGYVWFVRTRLFPD
FT                   YGWFTPRKVEGRYAFVERA"
FT   gene            complement(687641..688636)
FT                   /locus_tag="Bcen_3563"
FT   CDS_pept        complement(687641..688636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3563"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B0900 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78457"
FT                   /db_xref="GOA:A0A0H2XW73"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW73"
FT                   /protein_id="ABF78457.1"
FT                   /translation="MPLALQFRSRRAPPPYATMRRMKTRLIGYLYLAAAMAGVGSTVIA
FT                   SRLAAGGLPPFAATALRFLIATPLLFALMRAQHMCWPRISARDAVLLVIQAAAGGVGYT
FT                   VLLISGTKLSSPLDAGVMLGTLPAMSTLIAAVVLRERQTPRDWLAAALATAGVLFVTFA
FT                   PGHAMPSLQTLAGDALVLAAVACEAVFILLNRRLAAPVPPLALSTAMSGLGFVLALVPA
FT                   AFEWQAVASGWTVGAVSAIVYYALIPTVLGYLCWYAGSARTSGTEAALFTAVAPVSAVL
FT                   FAVALFGETLTGTRVAGISLVVAGMLVGATRRREPPGASRATLAARTAID"
FT   sig_peptide     complement(688487..688636)
FT                   /locus_tag="Bcen_3563"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.419 at
FT                   residue 50"
FT   gene            complement(688755..689549)
FT                   /locus_tag="Bcen_3564"
FT   CDS_pept        complement(688755..689549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3564"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_B0901 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78458"
FT                   /db_xref="GOA:A0A0H2XU28"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU28"
FT                   /protein_id="ABF78458.1"
FT                   /translation="MHRVTHYRRTGEGIEAISLESDRAFPRHAHDEFGVGVIVSGAHRS
FT                   WSGRGQVDALAGDAIMVNPGEMHDGSPLEAGTGRRWRMLYLAPGLVAGVAAEEGLGGVE
FT                   LAHPAVRDARLTAAVGRLHARIVAGETPPLARDEALVMLVAGLLARHANRTLPAAGVAP
FT                   AVRVARERLDAAPAAPVSLAELADLSGVSRFQLLRGFARELGITPHAYLVQSRTRLARA
FT                   LLASGLPIADAAAEAGFADQSHLTRAFARQFGITPGRFTQAG"
FT   gene            689720..690553
FT                   /locus_tag="Bcen_3565"
FT   CDS_pept        689720..690553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78459"
FT                   /db_xref="InterPro:IPR024724"
FT                   /db_xref="InterPro:IPR035348"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVG2"
FT                   /protein_id="ABF78459.1"
FT                   /translation="MERQDPVFIQVGALADGFAPEANILAPVDALVGRTLALGDASGAW
FT                   RVYTFEPDALQWRDAASDTGGRAPCRVTRLRDGLYFVDYIDVTARATSVSLVIDLDTGV
FT                   WTSVVGTLPTEADTRIDAFTRVARGLPLTAVDVQFRHGTLGGHAQPGPLHAPTHELIGK
FT                   RTMYRYSPTECYEHIYLNENFYAWQCLQGVEGGLADVDRCHYFKMADELYLFVWREKVV
FT                   PTLGVVLIDLAQRKTDGKIFGYQGGDFGTLSNFQIGAYAQVLNETVYPPGGEAQR"
FT   gene            690550..691359
FT                   /locus_tag="Bcen_3566"
FT   CDS_pept        690550..691359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3566"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_B0903 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78460"
FT                   /db_xref="GOA:A0A0H2XW65"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW65"
FT                   /protein_id="ABF78460.1"
FT                   /translation="MTAVPGSGRLRADFGGRVVLVTGAAQGIGAAIARRFAESDAFVAV
FT                   ADLNGDAAAAQADALASAGGDARAYRVDAASRGDLDALVAAVERDGGRLDVVIHNAAYF
FT                   PLTPFMQIDEPTLDRTLSVNLSALFWLAQAALPAFQRAGAGRLLVTSSVTGPRVVYPGL
FT                   AHYAASKAGVNGFIRAAALELARRNVTVNGVEPGMIRTPAAGNLGDASVAAQIAHDIPL
FT                   ARMGEPEDIANAMLFLASADAAYITGQTIVVDGGATLPESGAVLGER"
FT   gene            complement(691452..692129)
FT                   /locus_tag="Bcen_3567"
FT   CDS_pept        complement(691452..692129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78461"
FT                   /db_xref="GOA:A0A0H2XUX7"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUX7"
FT                   /protein_id="ABF78461.1"
FT                   /translation="MQVLVIGTGKLANELLGSHKLDPATYRVMPWSDTTRTDARSIVVH
FT                   AGSGRELAAAIAFCQATASPLVELSTGSDLETGTYGFPVVLCPNTNILMLKFMSMLETS
FT                   GHLFRDCEISVTESHQAGKTSVPGTAVGIAASLGVQPADIRSVRDPAVQRSEFAIADDQ
FT                   LGRHAVHRIRIDDGACSLQFESRVSGETPYADGVSRIVEAVRQHDLEHRRYSIVEFIRN
FT                   GWL"
FT   gene            692530..693243
FT                   /locus_tag="Bcen_3568"
FT   CDS_pept        692530..693243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3568"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B0911 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78462"
FT                   /db_xref="GOA:A0A0H2XW79"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW79"
FT                   /protein_id="ABF78462.1"
FT                   /translation="MEHDLKGKAVAITGGFGHLGVATAAWLGERGARVALIGRGAAPAA
FT                   QTLPGVPADALRIGGIDLVDPQAAVQALDTVNREFGRVDALLNIAGAFVWQTIADGDAA
FT                   TWDRMYELNVKTALNASKAALPYLVASQAGRIVNIGAGAAFKAGAGMGAYAAAKAGVTR
FT                   LTEALAAELLDRGVTVNALLPSIIDTPPNRKDMPDADFSRWVRPEQLAATIGFLLSADA
FT                   QAITGASIPVSGRVA"
FT   gene            693297..694046
FT                   /locus_tag="Bcen_3569"
FT   CDS_pept        693297..694046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3569"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_B0912 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78463"
FT                   /db_xref="GOA:A0A0H2XU33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU33"
FT                   /protein_id="ABF78463.1"
FT                   /translation="MHGRNPRPEPETMTQPTILIVEDEQAIADTIVYALGTDGMQTVHC
FT                   TLAQAALDRLRDTHVDLVVLDVGLPDLSGFEVCRRLRTFTDIPVIFLTARHDEIDRIVG
FT                   LEIGADDYVVKPFSPRELAARVRVILRRFHRTAAPEPAPAPASADAPAPVASGFTLDTD
FT                   GARVSWLGHALDLTRYEFGLMVLLVRHPGRIYSREQLMDLVWHEALDSADRTVDTHIKT
FT                   LRAKLRAIDPERDPIRTHRGMGYSLQP"
FT   gene            694062..695513
FT                   /locus_tag="Bcen_3570"
FT   CDS_pept        694062..695513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3570"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like; KEGG:
FT                   bur:Bcep18194_B0913 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78464"
FT                   /db_xref="GOA:A0A0H2XVG7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVG7"
FT                   /protein_id="ABF78464.1"
FT                   /translation="MHIGLRIFFGFFLIVGLAALITLRVFVQEVKPGVREAMEDTLVDT
FT                   AQVLATLAADDMANGRIADGTFARQLGKLHERPVSANVWGIQKNAIGYRLYITDAHGIV
FT                   RYDSSGSALGQDYSRWNDVYRTLRGEYGARSTRSDPNDDGSTVMHVAAPIRRGNEIIGV
FT                   LTIAKPNQTVAPFIARSQRKIMLYGALLMGGAILIGAACTWWLVLGLRRLQRYARAIAA
FT                   GERAPMPLQGANELAELGRAVESMHQRLEDRQYVETYIHTLTHEMKSPLAAISGAAELL
FT                   QEDMPVANRRRFTENIRRQAGRLEQMIRKLLALAEVEQKQRLSVHEPVALRPVLEQLVD
FT                   DIEPRARQRGVSLRIDANDAADPAVVDGDPFLLRQALGNLLDNALDFAPQGSTIRIALE
FT                   RQPAGRAHVAVVRVDDDGPGVPDYALSRVFERFYSLPRPDGQDRSTGLGLCFVREVAML
FT                   HRGQIALANRAEGGACATLTLPSAG"
FT   sig_peptide     694062..694145
FT                   /locus_tag="Bcen_3570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.931 at
FT                   residue 28"
FT   gene            695617..697005
FT                   /locus_tag="Bcen_3571"
FT   CDS_pept        695617..697005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3571"
FT                   /product="Inner membrane CreD"
FT                   /note="PFAM: Inner membrane CreD; KEGG: bur:Bcep18194_B0914
FT                   inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78465"
FT                   /db_xref="GOA:A0A0H2XW69"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW69"
FT                   /protein_id="ABF78465.1"
FT                   /translation="MNRVLLFKSMITAFLALAILIPLQMVQSIVRERADYRQSALQSIW
FT                   ASYAGPQTVTGPVLVVRYTEVTRVSDDARAGGKAKTSLKSETKRLLVFPKTLKVDGTLS
FT                   VSVRYRGIHKALVYGLDSRITGTLPLPDLKKLPEADGHVSFKIDGAYVALGIGDLRGLK
FT                   AQPDLRIGGKRIDVEQGTRLDSLRQGVHANVDLTALADANAGATVVPFSIGLPLAGAES
FT                   VAFAPVGDQNDFSLKSTWPHPSFGGEFLPAERTIDARGFVSNWHVTSFNTKAREQVASG
FT                   NGGGEIEMASVSVIEPVNVYLQAERATKYGALFVMLTFASFFMYELVKRLRIHPIQYTL
FT                   VGLSLALFFLLLLSLSEHIAFGYAYLAASGACIGLLGFYLSFVLHSVKRGATFTVLLAM
FT                   LYAALYGLLLSEDNALMLGSLLLFAILAGIMTLTRRVDWYSLGAAWQPLADKPGAVKPG
FT                   APAK"
FT   sig_peptide     695617..695697
FT                   /locus_tag="Bcen_3571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.932) with cleavage site probability 0.503 at
FT                   residue 27"
FT   gene            complement(697189..697611)
FT                   /locus_tag="Bcen_3572"
FT   CDS_pept        complement(697189..697611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3572"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG:
FT                   bur:Bcep18194_B0915 endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78466"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY1"
FT                   /protein_id="ABF78466.1"
FT                   /translation="MAEAVNPPEVWAPFGAFSMAVIQGDGRIVHLKGQVALDRDGQPVG
FT                   AGDMRAQVRQTLDNIRDVLAALGGQLRDVISLVHYATDIDAFMQAGDIRKTYFAEPYPV
FT                   TTTVQVERLYHPDLLIEIAAIAEIPLARFRRPESAA"
FT   gene            697682..697969
FT                   /locus_tag="Bcen_3573"
FT   CDS_pept        697682..697969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78467"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="InterPro:IPR039251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW82"
FT                   /protein_id="ABF78467.1"
FT                   /translation="MRSSATRPACRTRRRPGSPYTDHSTLPDHAVPNQASGDPSVDDPR
FT                   PTPPVQPELEDCCNSGCSPCVFDLYDEALARYRVELAEWEARHAQREPHR"
FT   gene            complement(698063..699607)
FT                   /locus_tag="Bcen_3574"
FT   CDS_pept        complement(698063..699607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3574"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B0918 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78468"
FT                   /db_xref="GOA:A0A0H2XU38"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XU38"
FT                   /protein_id="ABF78468.1"
FT                   /translation="MDDAQNKGSTACLRRSPIGPSFFGSAFTMTNNTLAPCAPACAAAA
FT                   ATPRSHHSWALVVLLVGAILPPLDYFIVNLALPAIRDGIGAHQAELQLVVSAYACANAV
FT                   VQITGGRLGDLYGRKRMFMIGMAGFVLASTLCGLADNGTVLVGGRVLQGLFAAILAPQV
FT                   LATIRSVFSPQEQVRVMGFYGFAFGLAAVIGQLGGGALISLHPFGLGWRAIFLVNLPIG
FT                   ILALIGSWRFIPENRAPRGQRIDVPGTVLMSLFLLMLVYPLTHGREAGWPLWMIACGVG
FT                   ALPMLGALLAVEARRLARGHDPLLDVRLLRNPVVALGLLLAFLFYTLSAFFLSYGIYLQ
FT                   GCLNWSPLASGFAILPLGLGFLASPLLTTRLVARFGGYRVLTLGFAMLAAGVAIAAALA
FT                   RDGAPGPGFYAGIAAIGIGQGLVLPSVVRIVLAEVDAARAGVASGMVSAMLQIGAAVGA
FT                   ATIGGVFFARLGVHPAALDYVQGFRASMFTLTIVLLGCVALSMALGPLHRRLHADA"
FT   gene            699671..700543
FT                   /locus_tag="Bcen_3575"
FT   CDS_pept        699671..700543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3575"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   bur:Bcep18194_B0919 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78469"
FT                   /db_xref="GOA:A0A0H2XVH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XVH1"
FT                   /protein_id="ABF78469.1"
FT                   /translation="MRGFDLDQLRTFAAVADAGSLTAAAPRLHLSQSTVSEQVRKLESR
FT                   AGVPLFVRSKRGVEPTPAGARLLQHARRIVALNEAAFDELRGQAIKGELRVAITDYYRT
FT                   NEVAGMLARLRECYPQLSLHVSAMKSAEIEAAHARGQIDLGVVMNMSSGPFRPVSADTR
FT                   WVLRREPLSWVASPALAEQLPEPLPLVLLPDDCMMHQVAVRSLDEQHTPYVLVHSASGV
FT                   AGLQSMLAAGLGVGCLCASAIGDGLMRLGTKYRLPPLPDAVFSLTPPLPGERETVTQAR
FT                   EVLSRQLLM"
FT   gene            700588..700908
FT                   /locus_tag="Bcen_3576"
FT   CDS_pept        700588..700908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW74"
FT                   /protein_id="ABF78470.1"
FT                   /translation="MNDELKNQMAAKLQYALERVVDERSLIHFLRVLGHDWHTERQLEA
FT                   DVPLSPYAHAALGWENRSIGEYLEAMIDWAEASEEGLRFYDVPDNPWRRIADILFAGKI
FT                   YE"
FT   gene            complement(700940..701840)
FT                   /pseudo
FT                   /locus_tag="Bcen_3577"
FT   gene            701940..702917
FT                   /locus_tag="Bcen_3578"
FT   CDS_pept        701940..702917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3578"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_B0922 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78471"
FT                   /db_xref="GOA:A0A0H2XUY6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XUY6"
FT                   /protein_id="ABF78471.1"
FT                   /translation="MLANAGGTQRQALVLGASGGIGGEVARQLRDAGWQVRALKRGLDA
FT                   EVVERDGIAWVRGDALDRDAVVRAARGCSVIVHAVNPPGYRNWATQVLPMIDNTIAAAR
FT                   AAQATVVLPGTVYNFGADAFPVLREDAPQHPATRKGAIRVELERRLQDASAHGVPAIVV
FT                   RAGDFFGPQLGNSWFSQGLVKAGRPVAAISVPSRGVGHQWSYVPDVARVMVELIERRET
FT                   LEPFARFHLGGHWDEDGMQMALAVQRVAQRHGMRPALRDFPWWLVYVAAPFVTTLRELL
FT                   EMRYLWREPIRMDNARVTAVLGREPVTPLDTAVEATLAGLGCLG"
FT   gene            complement(703269..703970)
FT                   /locus_tag="Bcen_3579"
FT   CDS_pept        complement(703269..703970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcen_3579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcen_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF78472"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2XW86"
FT                   /protein_id="ABF78472.1"
FT                   /translation="MPTLSFNVISLQGAPAAVDADIERVVIAGWAGRDPAAIQTHIDEL
FT                   AALGVAPPSTTPCFYRVSSALLTQAPSIGVLGARSGGEIECVLVDSPAGTLVTIGSDHT
FT                   DREVEAYSVAVSKQVCAKPLGRDAWRHADVA