(data stored in ACNUC1104 zone)

EMBL: CP000384

ID   CP000384; SV 1; circular; genomic DNA; STD; PRO; 5705448 BP.
XX
AC   CP000384; AAPW01000000-AAPW01000022;
XX
PR   Project:PRJNA15762;
XX
DT   12-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Mycobacterium sp. MCS, complete genome.
XX
KW   .
XX
OS   Mycobacterium sp. MCS
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium.
XX
RN   [1]
RP   1-5705448
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Martinez M., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Miller C.D., Hughes J.E., Anderson A.J., Sims R.C., Richardson P.;
RT   "Complete sequence of chromosome of Mycobacterium sp. MCS";
RL   Unpublished.
XX
RN   [2]
RP   1-5705448
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Martinez M., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Miller C.D., Hughes J.E., Anderson A.J., Sims R.C., Richardson P.;
RT   ;
RL   Submitted (05-JUN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6235852a6fe07bbe832c3feacb6b19a1.
DR   BioSample; SAMN02598348.
DR   EnsemblGenomes-Gn; EBG00001279822.
DR   EnsemblGenomes-Gn; EBG00001279823.
DR   EnsemblGenomes-Gn; EBG00001279824.
DR   EnsemblGenomes-Gn; EBG00001279825.
DR   EnsemblGenomes-Gn; EBG00001279826.
DR   EnsemblGenomes-Gn; EBG00001279827.
DR   EnsemblGenomes-Gn; EBG00001279828.
DR   EnsemblGenomes-Gn; EBG00001279829.
DR   EnsemblGenomes-Gn; EBG00001279830.
DR   EnsemblGenomes-Gn; EBG00001279831.
DR   EnsemblGenomes-Gn; EBG00001279832.
DR   EnsemblGenomes-Gn; EBG00001279833.
DR   EnsemblGenomes-Gn; EBG00001279834.
DR   EnsemblGenomes-Gn; EBG00001279835.
DR   EnsemblGenomes-Gn; EBG00001279836.
DR   EnsemblGenomes-Gn; EBG00001279837.
DR   EnsemblGenomes-Gn; EBG00001279838.
DR   EnsemblGenomes-Gn; EBG00001279839.
DR   EnsemblGenomes-Gn; EBG00001279840.
DR   EnsemblGenomes-Gn; EBG00001279841.
DR   EnsemblGenomes-Gn; EBG00001279842.
DR   EnsemblGenomes-Gn; EBG00001279843.
DR   EnsemblGenomes-Gn; EBG00001279844.
DR   EnsemblGenomes-Gn; EBG00001279845.
DR   EnsemblGenomes-Gn; EBG00001279846.
DR   EnsemblGenomes-Gn; EBG00001279847.
DR   EnsemblGenomes-Gn; EBG00001279848.
DR   EnsemblGenomes-Gn; EBG00001279849.
DR   EnsemblGenomes-Gn; EBG00001279850.
DR   EnsemblGenomes-Gn; EBG00001279851.
DR   EnsemblGenomes-Gn; EBG00001279852.
DR   EnsemblGenomes-Gn; EBG00001279853.
DR   EnsemblGenomes-Gn; EBG00001279854.
DR   EnsemblGenomes-Gn; EBG00001279855.
DR   EnsemblGenomes-Gn; EBG00001279856.
DR   EnsemblGenomes-Gn; EBG00001279857.
DR   EnsemblGenomes-Gn; EBG00001279858.
DR   EnsemblGenomes-Gn; EBG00001279859.
DR   EnsemblGenomes-Gn; EBG00001279860.
DR   EnsemblGenomes-Gn; EBG00001279861.
DR   EnsemblGenomes-Gn; EBG00001279862.
DR   EnsemblGenomes-Gn; EBG00001279863.
DR   EnsemblGenomes-Gn; EBG00001279864.
DR   EnsemblGenomes-Gn; EBG00001279865.
DR   EnsemblGenomes-Gn; EBG00001279866.
DR   EnsemblGenomes-Gn; EBG00001279867.
DR   EnsemblGenomes-Gn; EBG00001279868.
DR   EnsemblGenomes-Gn; EBG00001279869.
DR   EnsemblGenomes-Gn; EBG00001279870.
DR   EnsemblGenomes-Gn; EBG00001279871.
DR   EnsemblGenomes-Gn; EBG00001279872.
DR   EnsemblGenomes-Gn; EBG00001279873.
DR   EnsemblGenomes-Gn; EBG00001279874.
DR   EnsemblGenomes-Gn; EBG00001279875.
DR   EnsemblGenomes-Gn; EBG00001279876.
DR   EnsemblGenomes-Gn; EBG00001279877.
DR   EnsemblGenomes-Gn; EBG00001279878.
DR   EnsemblGenomes-Gn; EBG00001279879.
DR   EnsemblGenomes-Gn; EBG00001279880.
DR   EnsemblGenomes-Gn; EBG00001279881.
DR   EnsemblGenomes-Gn; EBG00001279882.
DR   EnsemblGenomes-Gn; EBG00001279883.
DR   EnsemblGenomes-Gn; EBG00001279884.
DR   EnsemblGenomes-Gn; EBG00001279885.
DR   EnsemblGenomes-Gn; EBG00001279886.
DR   EnsemblGenomes-Gn; EBG00001279887.
DR   EnsemblGenomes-Gn; EBG00001279888.
DR   EnsemblGenomes-Gn; EBG00001279889.
DR   EnsemblGenomes-Gn; EBG00001279890.
DR   EnsemblGenomes-Gn; EBG00001279891.
DR   EnsemblGenomes-Gn; Mmcs_R0001.
DR   EnsemblGenomes-Gn; Mmcs_R0002.
DR   EnsemblGenomes-Gn; Mmcs_R0003.
DR   EnsemblGenomes-Gn; Mmcs_R0004.
DR   EnsemblGenomes-Gn; Mmcs_R0006.
DR   EnsemblGenomes-Gn; Mmcs_R0007.
DR   EnsemblGenomes-Gn; Mmcs_R0008.
DR   EnsemblGenomes-Gn; Mmcs_R0009.
DR   EnsemblGenomes-Gn; Mmcs_R0010.
DR   EnsemblGenomes-Gn; Mmcs_R0011.
DR   EnsemblGenomes-Gn; Mmcs_R0012.
DR   EnsemblGenomes-Gn; Mmcs_R0013.
DR   EnsemblGenomes-Gn; Mmcs_R0014.
DR   EnsemblGenomes-Gn; Mmcs_R0015.
DR   EnsemblGenomes-Gn; Mmcs_R0016.
DR   EnsemblGenomes-Gn; Mmcs_R0017.
DR   EnsemblGenomes-Gn; Mmcs_R0018.
DR   EnsemblGenomes-Gn; Mmcs_R0021.
DR   EnsemblGenomes-Gn; Mmcs_R0022.
DR   EnsemblGenomes-Gn; Mmcs_R0023.
DR   EnsemblGenomes-Gn; Mmcs_R0024.
DR   EnsemblGenomes-Gn; Mmcs_R0025.
DR   EnsemblGenomes-Gn; Mmcs_R0026.
DR   EnsemblGenomes-Gn; Mmcs_R0027.
DR   EnsemblGenomes-Gn; Mmcs_R0028.
DR   EnsemblGenomes-Gn; Mmcs_R0029.
DR   EnsemblGenomes-Gn; Mmcs_R0030.
DR   EnsemblGenomes-Gn; Mmcs_R0031.
DR   EnsemblGenomes-Gn; Mmcs_R0032.
DR   EnsemblGenomes-Gn; Mmcs_R0033.
DR   EnsemblGenomes-Gn; Mmcs_R0034.
DR   EnsemblGenomes-Gn; Mmcs_R0035.
DR   EnsemblGenomes-Gn; Mmcs_R0036.
DR   EnsemblGenomes-Gn; Mmcs_R0037.
DR   EnsemblGenomes-Gn; Mmcs_R0038.
DR   EnsemblGenomes-Gn; Mmcs_R0039.
DR   EnsemblGenomes-Gn; Mmcs_R0040.
DR   EnsemblGenomes-Gn; Mmcs_R0041.
DR   EnsemblGenomes-Gn; Mmcs_R0042.
DR   EnsemblGenomes-Gn; Mmcs_R0043.
DR   EnsemblGenomes-Gn; Mmcs_R0044.
DR   EnsemblGenomes-Gn; Mmcs_R0045.
DR   EnsemblGenomes-Gn; Mmcs_R0046.
DR   EnsemblGenomes-Gn; Mmcs_R0048.
DR   EnsemblGenomes-Gn; Mmcs_R0049.
DR   EnsemblGenomes-Gn; Mmcs_R0050.
DR   EnsemblGenomes-Gn; Mmcs_R0051.
DR   EnsemblGenomes-Gn; Mmcs_R0052.
DR   EnsemblGenomes-Gn; Mmcs_R0053.
DR   EnsemblGenomes-Gn; Mmcs_R0054.
DR   EnsemblGenomes-Gn; Mmcs_R0055.
DR   EnsemblGenomes-Gn; Mmcs_R0056.
DR   EnsemblGenomes-Gn; Mmcs_R0057.
DR   EnsemblGenomes-Gn; Mmcs_R0058.
DR   EnsemblGenomes-Gn; Mmcs_R0059.
DR   EnsemblGenomes-Gn; Mmcs_R0061.
DR   EnsemblGenomes-Tr; EBT00001811721.
DR   EnsemblGenomes-Tr; EBT00001811722.
DR   EnsemblGenomes-Tr; EBT00001811723.
DR   EnsemblGenomes-Tr; EBT00001811724.
DR   EnsemblGenomes-Tr; EBT00001811725.
DR   EnsemblGenomes-Tr; EBT00001811726.
DR   EnsemblGenomes-Tr; EBT00001811727.
DR   EnsemblGenomes-Tr; EBT00001811728.
DR   EnsemblGenomes-Tr; EBT00001811729.
DR   EnsemblGenomes-Tr; EBT00001811730.
DR   EnsemblGenomes-Tr; EBT00001811731.
DR   EnsemblGenomes-Tr; EBT00001811732.
DR   EnsemblGenomes-Tr; EBT00001811733.
DR   EnsemblGenomes-Tr; EBT00001811734.
DR   EnsemblGenomes-Tr; EBT00001811735.
DR   EnsemblGenomes-Tr; EBT00001811736.
DR   EnsemblGenomes-Tr; EBT00001811737.
DR   EnsemblGenomes-Tr; EBT00001811738.
DR   EnsemblGenomes-Tr; EBT00001811739.
DR   EnsemblGenomes-Tr; EBT00001811740.
DR   EnsemblGenomes-Tr; EBT00001811741.
DR   EnsemblGenomes-Tr; EBT00001811742.
DR   EnsemblGenomes-Tr; EBT00001811743.
DR   EnsemblGenomes-Tr; EBT00001811744.
DR   EnsemblGenomes-Tr; EBT00001811745.
DR   EnsemblGenomes-Tr; EBT00001811746.
DR   EnsemblGenomes-Tr; EBT00001811747.
DR   EnsemblGenomes-Tr; EBT00001811748.
DR   EnsemblGenomes-Tr; EBT00001811749.
DR   EnsemblGenomes-Tr; EBT00001811750.
DR   EnsemblGenomes-Tr; EBT00001811751.
DR   EnsemblGenomes-Tr; EBT00001811752.
DR   EnsemblGenomes-Tr; EBT00001811753.
DR   EnsemblGenomes-Tr; EBT00001811754.
DR   EnsemblGenomes-Tr; EBT00001811755.
DR   EnsemblGenomes-Tr; EBT00001811756.
DR   EnsemblGenomes-Tr; EBT00001811757.
DR   EnsemblGenomes-Tr; EBT00001811758.
DR   EnsemblGenomes-Tr; EBT00001811759.
DR   EnsemblGenomes-Tr; EBT00001811760.
DR   EnsemblGenomes-Tr; EBT00001811761.
DR   EnsemblGenomes-Tr; EBT00001811762.
DR   EnsemblGenomes-Tr; EBT00001811763.
DR   EnsemblGenomes-Tr; EBT00001811764.
DR   EnsemblGenomes-Tr; EBT00001811765.
DR   EnsemblGenomes-Tr; EBT00001811766.
DR   EnsemblGenomes-Tr; EBT00001811767.
DR   EnsemblGenomes-Tr; EBT00001811768.
DR   EnsemblGenomes-Tr; EBT00001811769.
DR   EnsemblGenomes-Tr; EBT00001811770.
DR   EnsemblGenomes-Tr; EBT00001811771.
DR   EnsemblGenomes-Tr; EBT00001811772.
DR   EnsemblGenomes-Tr; EBT00001811773.
DR   EnsemblGenomes-Tr; EBT00001811774.
DR   EnsemblGenomes-Tr; EBT00001811775.
DR   EnsemblGenomes-Tr; EBT00001811776.
DR   EnsemblGenomes-Tr; EBT00001811777.
DR   EnsemblGenomes-Tr; EBT00001811778.
DR   EnsemblGenomes-Tr; EBT00001811779.
DR   EnsemblGenomes-Tr; EBT00001811780.
DR   EnsemblGenomes-Tr; EBT00001811781.
DR   EnsemblGenomes-Tr; EBT00001811782.
DR   EnsemblGenomes-Tr; EBT00001811783.
DR   EnsemblGenomes-Tr; EBT00001811784.
DR   EnsemblGenomes-Tr; EBT00001811785.
DR   EnsemblGenomes-Tr; EBT00001811786.
DR   EnsemblGenomes-Tr; EBT00001811787.
DR   EnsemblGenomes-Tr; EBT00001811788.
DR   EnsemblGenomes-Tr; EBT00001811789.
DR   EnsemblGenomes-Tr; EBT00001811790.
DR   EnsemblGenomes-Tr; Mmcs_R0001-1.
DR   EnsemblGenomes-Tr; Mmcs_R0002-1.
DR   EnsemblGenomes-Tr; Mmcs_R0003-1.
DR   EnsemblGenomes-Tr; Mmcs_R0004-1.
DR   EnsemblGenomes-Tr; Mmcs_R0006-1.
DR   EnsemblGenomes-Tr; Mmcs_R0007-1.
DR   EnsemblGenomes-Tr; Mmcs_R0008-1.
DR   EnsemblGenomes-Tr; Mmcs_R0009-1.
DR   EnsemblGenomes-Tr; Mmcs_R0010-1.
DR   EnsemblGenomes-Tr; Mmcs_R0011-1.
DR   EnsemblGenomes-Tr; Mmcs_R0012-1.
DR   EnsemblGenomes-Tr; Mmcs_R0013-1.
DR   EnsemblGenomes-Tr; Mmcs_R0014-1.
DR   EnsemblGenomes-Tr; Mmcs_R0015-1.
DR   EnsemblGenomes-Tr; Mmcs_R0016-1.
DR   EnsemblGenomes-Tr; Mmcs_R0017-1.
DR   EnsemblGenomes-Tr; Mmcs_R0018-1.
DR   EnsemblGenomes-Tr; Mmcs_R0021-1.
DR   EnsemblGenomes-Tr; Mmcs_R0022-1.
DR   EnsemblGenomes-Tr; Mmcs_R0023-1.
DR   EnsemblGenomes-Tr; Mmcs_R0024-1.
DR   EnsemblGenomes-Tr; Mmcs_R0025-1.
DR   EnsemblGenomes-Tr; Mmcs_R0026-1.
DR   EnsemblGenomes-Tr; Mmcs_R0027-1.
DR   EnsemblGenomes-Tr; Mmcs_R0028-1.
DR   EnsemblGenomes-Tr; Mmcs_R0029-1.
DR   EnsemblGenomes-Tr; Mmcs_R0030-1.
DR   EnsemblGenomes-Tr; Mmcs_R0031-1.
DR   EnsemblGenomes-Tr; Mmcs_R0032-1.
DR   EnsemblGenomes-Tr; Mmcs_R0033-1.
DR   EnsemblGenomes-Tr; Mmcs_R0034-1.
DR   EnsemblGenomes-Tr; Mmcs_R0035-1.
DR   EnsemblGenomes-Tr; Mmcs_R0036-1.
DR   EnsemblGenomes-Tr; Mmcs_R0037-1.
DR   EnsemblGenomes-Tr; Mmcs_R0038-1.
DR   EnsemblGenomes-Tr; Mmcs_R0039-1.
DR   EnsemblGenomes-Tr; Mmcs_R0040-1.
DR   EnsemblGenomes-Tr; Mmcs_R0041-1.
DR   EnsemblGenomes-Tr; Mmcs_R0042-1.
DR   EnsemblGenomes-Tr; Mmcs_R0043-1.
DR   EnsemblGenomes-Tr; Mmcs_R0044-1.
DR   EnsemblGenomes-Tr; Mmcs_R0045-1.
DR   EnsemblGenomes-Tr; Mmcs_R0046-1.
DR   EnsemblGenomes-Tr; Mmcs_R0048-1.
DR   EnsemblGenomes-Tr; Mmcs_R0049-1.
DR   EnsemblGenomes-Tr; Mmcs_R0050-1.
DR   EnsemblGenomes-Tr; Mmcs_R0051-1.
DR   EnsemblGenomes-Tr; Mmcs_R0052-1.
DR   EnsemblGenomes-Tr; Mmcs_R0053-1.
DR   EnsemblGenomes-Tr; Mmcs_R0054-1.
DR   EnsemblGenomes-Tr; Mmcs_R0055-1.
DR   EnsemblGenomes-Tr; Mmcs_R0056-1.
DR   EnsemblGenomes-Tr; Mmcs_R0057-1.
DR   EnsemblGenomes-Tr; Mmcs_R0058-1.
DR   EnsemblGenomes-Tr; Mmcs_R0059-1.
DR   EnsemblGenomes-Tr; Mmcs_R0061-1.
DR   EuropePMC; PMC1974809; 17504473.
DR   EuropePMC; PMC3271072; 22319448.
DR   EuropePMC; PMC5550956; 28793878.
DR   GOA; P0CG93.
DR   InterPro; IPR008515; Ubiquitin-like_Pup.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000384.
DR   SILVA-SSU; CP000384.
DR   UniProtKB/Swiss-Prot; P0CG93; PUP_MYCSS.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000380
CC   Source DNA and bacteria available from Charles Miller
CC   (cdmiller@biology.usu.edu)
CC   Contacts: Charles Miller (cdmiller@biology.usu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5705448
FT                   /organism="Mycobacterium sp. MCS"
FT                   /strain="MCS"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:164756"
FT   gene            20..1507
FT                   /locus_tag="Mmcs_0001"
FT   CDS_pept        20..1507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mtc:MT0001 chromosomal replication initiator
FT                   protein dnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator,
FT                   DnaA-like Chromosomal replication initiator, DnaA; SMART:
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06123"
FT                   /db_xref="GOA:Q1BG61"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BG61"
FT                   /protein_id="ABG06123.1"
FT                   /translation="MTADPDPPFVAVWNTVVAELNGDPAATGPRNGDGALPTLTPQQRA
FT                   WLKLVKPLVITEGFALLSVPTPFVQNEIERHLREPIITALSRHLGQRVELGVRIATPSP
FT                   EDDDPPPSPVIADIDEVDEDTEARVSAEETWPRYFSRPPETPAAEDPNAVSLNRRYTFD
FT                   TFVIGASNRFAHAATLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRV
FT                   KYVSTEEFTNDFINSLRDDRKASFKRSYRDIDVLLVDDIQFIEGKEGIQEEFFHTFNTL
FT                   HNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLD
FT                   VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLISDASTMQI
FT                   STAAIMAATAEYFETTIEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDH
FT                   TTVMYAEKKIRGEMAERREVFDHVKELTTRIRQRAKR"
FT   gene            2069..3265
FT                   /locus_tag="Mmcs_0002"
FT   CDS_pept        2069..3265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mpa:MAP0002 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06124"
FT                   /protein_id="ABG06124.1"
FT                   /translation="MDVVPTTAGHTDLKFRLVREDFADAVAWVARNLPTRPTVPVLAGV
FT                   LLTGDDDGLTISGFDYEVSAEVRVVAEIASPGSVLVSGRLLSDITKALPAKPVDVSVEG
FT                   TRVSLTCGSARFSLPTMAVEDYPALPTLPDETGVIGADLFAEAIGQVAVAAGRDDTLPM
FT                   LTGIRVEITGESVVLAATDRFRLAVRELTWSTSSPDVEAAVLVPAKTLAEAAKAGTDGT
FT                   DVHLALGAGSAVGKEGLLGIRSEGKRSTTRLLDAEFPKFRQLLPSEHTAVATIGVAELT
FT                   EAIKRVALVADRGAQVRMEFADDVLRLSAGADDVGRAEEDLAVAFSGEPLTIAFNPTYL
FT                   TDGLGSLHSERVTFGFTTPSRPAVLRPAGDEDTGGGAGPFPALQTDYVYLLMPVRLPG"
FT   gene            3295..4188
FT                   /locus_tag="Mmcs_0003"
FT   CDS_pept        3295..4188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase related
FT                   protein; PFAM: 6-phosphogluconate dehydrogenase-like
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   lxx:Lxx00030 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06125"
FT                   /protein_id="ABG06125.1"
FT                   /translation="MQLGLVGLGKMGFNMRERLREGGHEVVGFDPRPEVTDVPSLAALA
FT                   DALAPPRVVWVMVPSGPVTHDTIVSLAEVLGEGDLVIDGGNSRFTEDAPHAELLKAKGI
FT                   GFIDAGVSGGVWGLAEGYGLMVGGDDADIERVMPIFDTLRPPGDRADGFVHAGPVGAGH
FT                   FAKMVHNGVEYALMTAYGEGYELLAAEELIRDPQAVYQAWTNGTVVRSWLQQLLAKALR
FT                   EDPGLAEISGYTEDSGEGRWTVEEAIRLRVPVPSIAASLFARFESRQEDSPTMKAVSAL
FT                   RNQFGGHAVQRISKSG"
FT   gene            4241..5383
FT                   /locus_tag="Mmcs_0004"
FT   CDS_pept        4241..5383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC protein-like; KEGG: mpa:MAP0003 putative DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06126"
FT                   /db_xref="GOA:Q1BG58"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BG58"
FT                   /protein_id="ABG06126.1"
FT                   /translation="MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWY
FT                   SATLGSHRVASDAPLIRVGAPRAVVSTIVVNEGRELAVDLEITTGRANKARLNRSPVRS
FT                   PREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTRRPSIAGVRADYDRVIRQRTA
FT                   LLKSAAGARYRGDRSVLETLDVWDGHLAAHGALLMAARADLVHHLAPEVEKAYQLLAPG
FT                   SRPAAIRYRTSIDAEDDVSAEYYEAALLDAMTRRRDAELERGVCLVGPHRDDLELRLGD
FT                   QMAKGYASHGESWSMALSLRLAAYELLRTDGSDPVLLLDDVFAELDAARRRALAEVAAS
FT                   AEQVLVTAAVAEDIPADWDARRIMIRMQDDDDGRVSMVES"
FT   gene            5380..5952
FT                   /locus_tag="Mmcs_0005"
FT   CDS_pept        5380..5952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   mpa:MAP0004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06127"
FT                   /protein_id="ABG06127.1"
FT                   /translation="MSDDDRDGDGDPIGPPAHLSELKGMDLVRRTLEEARGAARSQGKD
FT                   VGRGRTSPARRVAGTGRRRSWSGPGPDSRDPQTLGAATRDLARTRGWSPKVAEGAVFGQ
FT                   WSTVVGEQIAEHATPSSLREGVLTVAAESTAWATQLRMVQSQLLAKIAAAVGDGVVTSL
FT                   KITGPTAPSWRKGRYHIAGRGPRDTYG"
FT   gene            6173..8200
FT                   /locus_tag="Mmcs_0006"
FT   CDS_pept        6173..8200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mpa:MAP0005 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B-like
FT                   ATP-binding region, ATPase-like TOPRIM DNA topoisomerase,
FT                   type IIA, subunit B, region 2; SMART: DNA topoisomerase,
FT                   type IIA, subunit B or-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06128"
FT                   /protein_id="ABG06128.1"
FT                   /translation="MAAQKKNAPAEYGADSIKVLEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VWEVVDNAVDEAMAGFATKVEVRILENGGVQVTDDGRGIPVAMHSTGIPTVDVVMTVLH
FT                   AGGKFEEGAYQVSGGLHGVGVSVVNALSTRLEADIRTDGYEWFQTYDRSVPGTLKQGEK
FT                   TKKTGTTIRFWADPDIFETTSYDFETIARRLQEMAFLNKGLTIELTDERVTAEEVVDDV
FT                   VSDHAEAPKSAEEKSAEAAKPQKVKHRVFHYPGGLVDFVKHINRTKTPIQPSVIDFDGK
FT                   GEGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRTALTSVVNKYAKDKKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVSQPQFEGQTKTKLGNTEVKSFVQKICNEQLSHWFEAN
FT                   PAEAKTVVNKAVSSAQARLAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEF
FT                   DISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLIENGHVFLAQPPLYKLKWQRS
FT                   TPEFAYSDRERDGLLEAGRAAGKRINADDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   ITLDDAAAADELFSILMGEDVEARRSFITRNAKDVRFLDV"
FT   gene            8234..12007
FT                   /locus_tag="Mmcs_0007"
FT   CDS_pept        8234..12007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mle:ML0006 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit Protein splicing (intein) site; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A DNA gyrase C-terminal
FT                   repeat, beta-propeller; SMART: Hedgehog/intein hint
FT                   domain-like Hedgehog/intein hint-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06129"
FT                   /protein_id="ABG06129.1"
FT                   /translation="MTDTTLPPGDEAGDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMFDSGFRPDRGHAKSARSVAETMGNYHPHGDSSIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYCVTGDALVRLPLGQSVRIDGVVPGAKPNSDNPI
FT                   DLKVVDRHGDPVAADRLFHSGEHQTYKVTTTEGYTVTGTENHPLLCLVDVGGVPTLLWK
FT                   LVEEIRPGDTVVLQRSQPMEFGPADWQETLEALLAGAFISEGFISEKRAGFNNLDRDFF
FT                   NMVVAAYDAVVGGRRYVSSRTIASGSLLHELDIHNLESLRRSRLGVAVGQRSADKFVPE
FT                   WIWQSPAAVKRVFLQALFEGDGSCSRLPRNTIQVSYSTRSERLAADVQQMLLEFGIVSR
FT                   RYRHAVGEYKVALTNRAQAELFARQIGFGGAKQVKLLEILSALPEEAAGLDRDFVPGLA
FT                   RFIRQHSGGRWADKEWLRKHNVDRISRWQRNGAEILGRIADPEVRAVATDLTDGRFYYA
FT                   TVASVADAGVQPVYSLRVDTEDHAFITNGFVSHNTEARLTPLAMEMLREIDEETVDFIP
FT                   NYDGRVQEPTVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVYWCLENFEADEE
FT                   TTLAAVMERVKGPDFPTHGLIVGSQGIEDTYKTGRGSVKMRGVVEIEEDSRGRTGIVIT
FT                   ELPYQVNHDNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVVELKRDAVAKVVLNNL
FT                   YKHTQLQTSFGANMLSIVDGVPRTLRLDQMIRYYVEHQLDVIVRRTRYRLRKANERAHI
FT                   LRGLVKALDALDEVIALIRASQTVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQ
FT                   RIVDDLAKIEAEIADLEDILAKPERQRAIVRDELKEIADKYGDDRRTRIVPADGEVSDE
FT                   DLIAREDVVVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVNHFFVCSTHDWI
FT                   LFFTTQGRVYRAKAYELPEASRTARGQHVANLLAFQPNERIAQVIQIKSYEDAPYLVLA
FT                   TRNGLVKKSRLTDFDSNRSGGIVAVNLRDGDELVGAVLCSSEDDLLLVSAKGQSIRFSA
FT                   TDEALRPMGRATSGVQGMRFNADDELLSLNVVRPDTYLLVATSGGYAKRTSIEEYTAQG
FT                   RGGKGILTIQYDRRRGNLVGALIVDDDTELYAITSGGGVIRTAARQVRKAGRQTKGVRL
FT                   MNLGEGDTLIAIARNAEAGDSTDEVNTDPDAV"
FT   gene            12025..12897
FT                   /locus_tag="Mmcs_0008"
FT   CDS_pept        12025..12897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06130"
FT                   /protein_id="ABG06130.1"
FT                   /translation="MSAPNEPGLPRGGDGPGGGNGSPAPGAGRDNGSPANAAGRVGTEG
FT                   GDVPPWQRGRPNRPPQSRAQDAPTRQEPSRGGSPTHAPGAEARNTSRFPVSGSAPTEET
FT                   KAPAAPVRTPERTEAPRPEAYASELPDLSGPVPRPPQRKPATDRPATEAPARPAARTQV
FT                   GQRPARGPVRASMQIRRVDPWSALKVSLVLSVALFFVWMIAVAFLYLVLGGMGVWSKLN
FT                   SNVGDLLTSASGSSGGELVSSSTIFGGAALVGLVNIVILTAMATAGAFIYNLTTDLVGG
FT                   VEVTLADRD"
FT   gene            12992..13065
FT                   /locus_tag="Mmcs_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            12992..13065
FT                   /locus_tag="Mmcs_R0001"
FT                   /product="tRNA-Ile"
FT   gene            13227..13299
FT                   /locus_tag="Mmcs_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            13227..13299
FT                   /locus_tag="Mmcs_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(13324..13737)
FT                   /locus_tag="Mmcs_0009"
FT   CDS_pept        complement(13324..13737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0009"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: mbo:Mb0008c possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06131"
FT                   /protein_id="ABG06131.1"
FT                   /translation="MTLTPLTPRQRLARGLKYTAVGPVDVTRGVLGVGVDSAQATAAEL
FT                   RRRYQSGQLRRELAAARETLVAELVAAQEAVSGLPEALTGARARNRRRKRLLMVGVGAG
FT                   VLAVGAVTFSIVRRSMKPEPSPLPPSVEVTPKP"
FT   gene            13835..14362
FT                   /locus_tag="Mmcs_0010"
FT   CDS_pept        13835..14362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0010"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mbo:Mb0009 probable iron-regulated
FT                   peptidyl-prolyl CIS-trans isomerase A PpiA (PPIase A)
FT                   (rotamase A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06132"
FT                   /protein_id="ABG06132.1"
FT                   /translation="MTSPIQTATATLHTNRGDIKIALFGNHAPKTVSNFVGLAQGTKDY
FT                   KGENASGSTSGPFYDGAVFHRVIDGFMIQGGDPTGTGRGGPGYQFADEFHPELQFDKPY
FT                   LLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVVDPESQKVVDAIATTATDRNDRP
FT                   TDPVVIESVTIS"
FT   gene            complement(14376..14795)
FT                   /locus_tag="Mmcs_0011"
FT   CDS_pept        complement(14376..14795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0012c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06133"
FT                   /protein_id="ABG06133.1"
FT                   /translation="MQQTEWSPPAAGIAGCGFAGLLMAIAAVTVVTDPPGRLLAGIAAV
FT                   GLITFAIMSWRARPKLAITPEGVAVRGWWHTRVLRQADIKIVRITEFRRLARKMRLLEI
FT                   DTADDRLHVFTRWDLGTDPVDVLDALTAAGYTGTQ"
FT   sig_peptide     complement(14715..14795)
FT                   /locus_tag="Mmcs_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.507 at
FT                   residue 27"
FT   gene            complement(14951..15235)
FT                   /locus_tag="Mmcs_0012"
FT   CDS_pept        complement(14951..15235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0012"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   mpa:MAP0013c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06134"
FT                   /db_xref="GOA:Q1BG50"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BG50"
FT                   /protein_id="ABG06134.1"
FT                   /translation="MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGL
FT                   IWLLVFQLAATNPVDAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR"
FT   sig_peptide     complement(15071..15235)
FT                   /locus_tag="Mmcs_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.610 at
FT                   residue 55"
FT   gene            15301..16137
FT                   /locus_tag="Mmcs_0013"
FT   CDS_pept        15301..16137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0013"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   mpa:MAP0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06135"
FT                   /protein_id="ABG06135.1"
FT                   /translation="MVQMPPEPNAGPDRETPPTTSAAPAAPARAGAGRRSGWRFGVPLV
FT                   CLAAGLLLAATHGVSGGDEIRRSDAPRLVDLVREAQQSVDRLGAERDTLSAQVDGHHGG
FT                   SPGTDAALSAITNRSAALAAEAGLNPVKGPGLVVTLNDAQRDAEGRFPRDASPDDLVVH
FT                   QQDIQAVLNALWSAGAEGVQMQDQRIIATSAPRCVGNTLLLNGRTYSPPYVITAIGDAG
FT                   AMQAALSASPLVTLYKQYVVRFGLGYTEEPRAEVELVGHTEPVRMKHAQPIGPVGY"
FT   gene            16161..16835
FT                   /locus_tag="Mmcs_0014"
FT   CDS_pept        16161..16835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0014"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: mpa:MAP0015
FT                   para-aminobenzoate synthetase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06136"
FT                   /protein_id="ABG06136.1"
FT                   /translation="MQFLVVDNYDSFVFNLVQYLGQLGVDVTVWRNDDSRLSTDADIAK
FT                   AAEDFDGVLLSPGPGTPERAGASIPLVHACAAAGTPLLGVCLGHQAIGVAFGGTVDRAP
FT                   ELLHGKTSIVHHTNRGVLKGLPDPFTATRYHSLTILPETMPDELEVTARTPGGVIMGVR
FT                   HVDLPIHGVQFHPESILTEGGHRMLANWLGYCGSAPDEALVRRLEDEVASTVAAATTRS
FT                   SA"
FT   gene            complement(16813..18687)
FT                   /locus_tag="Mmcs_0015"
FT   CDS_pept        complement(16813..18687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0015"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase PASTA; SMART: Tyrosine protein
FT                   kinase Serine/threonine protein kinase; KEGG: mbo:Mb0014c
FT                   transmembrane serine/threonine-protein kinase B PknB
FT                   (protein kinase B) (StpK B)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06137"
FT                   /protein_id="ABG06137.1"
FT                   /translation="MTTPQHLSDRYELGEILGFGGMSEVHLARDNRLHRDVAIKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HSEGPMPPKRALEVIADACQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAL
FT                   ADSSSVTQTAAVIGTAQYLSPEQARGEKVDARSDVYSLGCVLYEILTGEPPFVGDSPVA
FT                   VAYQHVREDPVPPSQRHEGVSRDLDAVVLKALAKNPDNRYQTAAELRSDLVRVHSGEPP
FT                   EAPKVFTDAERTSMLSAAPHPGRTEPMTHMPRPEPRLVERNRGGSIGRWIAAVAVLAVL
FT                   TVVVAVAINTYGGETRAVQVPDVRGEVSAEAIAQLQNAGFTVRTQNEPNSEVAPDHVIS
FT                   TSPEANTEADAGEEITLNVSTGPEQREVPDVKSLTYAEAVRKLTDAGFGRFRQQASPST
FT                   PELKDRVMATNPPANQTSAITNEVTIIIGSGPQTRAVPEVVGQTVESAQQILTASGFRN
FT                   SVPAEVDSTEPAGQVLGTSPTAGENVPVDTLIQLQVSRGNQFVMPDLTGQFWTDAEPRL
FT                   RALGWTGVLDKGGDVQNSGQRTNAVVRQTPPPGTGVNFDSRITLNFAS"
FT   gene            complement(18684..20015)
FT                   /locus_tag="Mmcs_0016"
FT   CDS_pept        complement(18684..20015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0016"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein kinase
FT                   Serine/threonine protein kinase; KEGG: mle:ML0017 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06138"
FT                   /protein_id="ABG06138.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAIKVLK
FT                   AEYSTDPEFVERFRAEARTVAMLNHPGIASVYDYGETDMDGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDATAASDVYALGVVGYESVSGKRPFTGDGA
FT                   LTVAMKHIKETPPPLPADLPPNVRELIEITLVKNPGMRYRSGGPFADAVAAVRSGRRPP
FT                   RPNQAPSIGRATPAAVPSAAQARAAADLTGRAPVTAARARPTGAIHRPPPPRRTFSSGQ
FT                   RALLWAAGVLGALAIVIAILIVLNAQDRKDRQLPPPTVTNTITETTPYQSPAAMPEWMP
FT                   DWTSSAVIGHGGDTSGAVRPDAVAASAHLRALPAPAQTWLRTQT"
FT   gene            complement(20047..21522)
FT                   /locus_tag="Mmcs_0017"
FT   CDS_pept        complement(20047..21522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0017"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: mbo:Mb0016c probable penicillin-binding protein PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06139"
FT                   /protein_id="ABG06139.1"
FT                   /translation="MNTSLRRIAVTIMVLIVLLLGNATVTQVFTADGLRTDPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVSTPGRFRFLRVYPNAQAYAPVTGFYSLTYSSTGLERAE
FT                   DTILNGSDERLFGRRLADFFTGRDPRGGNVVTTINPRVQQAAWEAMEQGCNGPCKGSVV
FT                   ALEPSTGKILAMVSAPSYDPNLLATHDVEEQTAAWQQLRDNPDNPLVNRAISETYPPGS
FT                   TFKVITTAAALQNGATPDTQLTAAPRIPLPNSSVTLENFGGSACGGGPTAPLREAFARS
FT                   CNTAFVELGTDTGTEALKNTASAFGLDTPPAPIPLQVAESTVGPIGDAAALGMSSIGQR
FT                   DVALTPLQNAMVAATVANEGVTMRPYLVDSLRGPDLANITTTEPVEERRAVTPEVAATL
FT                   TDLMVGAEQQTQQKGAIAGVQIASKTGTAEHGTDPRNTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGGNRLSATGGQVAAPIGRATIAAALREGS"
FT   sig_peptide     complement(21430..21522)
FT                   /locus_tag="Mmcs_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.770 at
FT                   residue 31"
FT   gene            complement(21519..22931)
FT                   /locus_tag="Mmcs_0018"
FT   CDS_pept        complement(21519..22931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0018"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: mbo:Mb0017c probable
FT                   cell division protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06140"
FT                   /protein_id="ABG06140.1"
FT                   /translation="MTTQPQSPVTVTPPLPNRRNAELLLLAFAAVITTVALLMVEANQE
FT                   QGISWDLAQYAAGYLALFAGAHLAVRRYAPYADPLLLPVVALLNGLGLVMIHRLDLAQG
FT                   ELTGRGLGGTANQQMLWTLVGVIGFACVITFLSDHRMLARYGYVCGLTGLVLLAIPAVL
FT                   PASMSEQNGAKIWIELPGFSIQPAEFSKILLLIFFAAVLVDKRELFTSAGKHFLWMDLP
FT                   RPRDLAPLLAAWIASIAVMIFEKDLGTSLLLYASFLILLYVATDRISWVAIGLSLFAAG
FT                   SVVAYHLFGHVRVRVQTWLDPFADPEGAGYQMVQSMFSFATGGIFGTGLGNGQPGTVPA
FT                   ASTDFIIAAVGEELGLVGFSAVLMLYTILVIRGLRTAIAVRDSFGKLLAAGLASTLAIQ
FT                   LFIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYLLLAILLRISHAARRPISTKPVTQTP
FT                   IAAASTEVIDKV"
FT   gene            complement(22928..24403)
FT                   /locus_tag="Mmcs_0019"
FT   CDS_pept        complement(22928..24403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0019"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: protein phosphatase 2C-like; KEGG: mbo:Mb0018c
FT                   possible serine/threonine phosphatase ppp"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06141"
FT                   /protein_id="ABG06141.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLSKLDNAVREGNSAIAAHVEADPELEGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLMRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLIMREARAGDRYLLCSDGLSDPVSHDTIAEAMQIPDVAESADRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTAPILAGAVSGDDDQPPPNTAAGRASAFNPKRNAPKRVV
FT                   AQPEEPVKKPRSKRRMIIAATLVVLVVLAGLAIAREIVRNNYYVTAHEGTVSIMRGVDG
FT                   SLLGYSLQEPYLLGCLNARNELSLISAGQSGENRGCQLLDVQDMRESERAQVVAGLPGG
FT                   SLDQAIAQIEELARSSVLPICPPPATTSRRPPPPPPPSPTESAATSAVPRPGTSPAPET
FT                   PTTVTPPPPPPSPTVTALPPPPPQPGTTCRAAS"
FT   gene            complement(24400..24864)
FT                   /locus_tag="Mmcs_0020"
FT   CDS_pept        complement(24400..24864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0020"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: mbo:Mb0019c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06142"
FT                   /protein_id="ABG06142.1"
FT                   /translation="MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGL
FT                   ALRGSLLPNRQRSVARQLVVTEGALTGTRITLGSQPVLIGRADDSTLVLTDDYASTRHA
FT                   RLSPRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPMGTPVRIGKTVIELRP"
FT   gene            complement(25008..26417)
FT                   /locus_tag="Mmcs_0021"
FT   CDS_pept        complement(25008..26417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0021"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: mtc:MT0023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06143"
FT                   /protein_id="ABG06143.1"
FT                   /translation="MGLVDRFERKLESTVGDAFARVFGGSIVPQEVEALLRREAEAGIR
FT                   ELGRGRILAPNEYVITLSVPDHKKVSADPDLTATTFAKHLEGYIREQGWQTYGDVVVKF
FT                   EQAPNLHTGQFRARGAVNPDSTTGEPAPAHRDHAFPAEPGVPPMSDNPTYRGGGQGQGR
FT                   PGDEYYDDGYGRPQEEPRGQEPRAPYPPEQGGYPPRGGYPEQGGYPDRGGYPDQGGYPD
FT                   QGGYGGGYEQRGPGGYGPPGGGYDQGYRQGPGGYAPPPPPGGQPGYGAPGADYDYGRPP
FT                   GGPGRHEDGGYGRPGYPDQGGYPDQGGYGGGYGAPAGGRQDYGQDYGRGYAEPAGGYGD
FT                   PGYGEPAGRDYDYGQGAGGYGGGYGQADYPAAGVGTTVTLQLDDGSGRTYQLREGANVI
FT                   GRGQDAQFRLPDTGVSRRHLEIRWDGQVALLSDLNSTNGTTVNNAPVQEWQLADGDVIR
FT                   LGHSEIIVRVH"
FT   gene            26655..26737
FT                   /locus_tag="Mmcs_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            26655..26737
FT                   /locus_tag="Mmcs_R0003"
FT                   /product="tRNA-Leu"
FT   gene            27053..28540
FT                   /locus_tag="Mmcs_0022"
FT   CDS_pept        27053..28540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0022"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: dar:Daro_1303 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06144"
FT                   /protein_id="ABG06144.1"
FT                   /translation="MRRQKIVRGRGASNRQNGTWLKTTDLAKVRNTLWAAADELRANSK
FT                   LTPVQYRNPVLGLVFLAYAENRFEAVRGEVESKASARNPATPADYKAKSVLYVPEESRL
FT                   SYLNDLPEGDDIGKAVDDAIKAIEAANPELKDILPRGYQKLERSTLIELLRLFAPLPTQ
FT                   LEGDAFGFIYEDFLSNFAAQEGKGGGEYFTPYSIVRLIVEILEPFHGRVFDPACGSGGM
FT                   FVQCAKFVERHNESANRKLSIFGAEKTDDTVPLAKMNLALHGLSGDIRQANSYYEDPHK
FT                   AVGAFDYVMANPPFNVDKVKKGQLAGDKRFPFGIPKPDNANYLWIQQFYAALGPKGRAG
FT                   FVMANSAGDAGHSEKEIRKQIIESGVVDVMVAISSNFFYTVTLPVTLWFMDKAKAGTQR
FT                   EDAVLFLDARHTYRQIDRAHRDFTAEQIEFLANVVRLYRGEAVETVAGSDVLLKEHFPD
FT                   GKYIDVPGLCKVATRSEIEDQGWSLNPRPLRRLHGRG"
FT   gene            28661..29896
FT                   /locus_tag="Mmcs_0023"
FT   CDS_pept        28661..29896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0023"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /note="KEGG: ade:Adeh_2328 type I restriction-modification
FT                   system specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06145"
FT                   /protein_id="ABG06145.1"
FT                   /translation="MTVWRESVLGDLCTRVTVGHVGKMATEYVPDGVPFLRSQNVRPFV
FT                   IDKRGLLYIGDDFNAKLRKSALTAGDVVIVRTGYPGTAAVVPEDLDGSNCADLVVITPS
FT                   DALNPHVLAALFNSVYGQHAVSSQLVGSAQQHFNVGSAKTMRVRLPDRAEQDHIAAVLC
FT                   SINDLIENNRRRVEVLEGMARTIYREWFVKFRYPGNEGVPLVDSALGPAPKGWEVANLF
FT                   DAADVGFGYSFKSPRFSNSGPFQVIRIRDIPVGISRTYTDEAADPRYAVYDDDVLIGMD
FT                   GDFHMTVWTGEDAWLNQRVTRLRPRLGLSALHLLLAIEEQIKDWNRAIVGTTVAHLGKK
FT                   HLQLVNVLVPNDAVRIDASVVFAPIMEERRALIQSSRRLAALRDLLLPKLVSGQIDVSA
FT                   LDLDAVVGEQVA"
FT   gene            29896..33222
FT                   /locus_tag="Mmcs_0024"
FT   CDS_pept        29896..33222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0024"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: sme:SMc02292 putative type I restriction
FT                   enzyme R protein; TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: type III restriction
FT                   enzyme, res subunit protein of unknown function DUF450;
FT                   SMART: DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06146"
FT                   /protein_id="ABG06146.1"
FT                   /translation="MMARGPEYDYVEKPSMELLAELGWNPVDAFHEILGAEGTLGRDSQ
FT                   HDVILTHRLRLAMRNLNAEDVPDLSINEAIEALTKDRSVMDRVRANREVYDLLRDGYQA
FT                   EWEDDNGDKRIELIRYIDLRDKLNNDLLAVQQMWVKGPLHSRRLDVALFVNGVPLAVLE
FT                   FKEPNAPVKSAYDDNVTDYRDTIPQLFIPNCLVLLSNGSEAKVGSTYAPWDFFSDWKVI
FT                   DAFGARSEIALQTALRGTCDPANLLDLFESFVAYMERPGGLVKIVARSHQYLGVNAAIE
FT                   NLNRARAVHDKRLGVFWHTQGSGKSLSMLWFTQKVLRHVRGKWTFVMVTDRTELDTQLH
FT                   GEFADAGAIPPEARVHADSIAHLRELLEADHRYVFTLIQKFQPAKGERQMPVLSERSDI
FT                   IVITDEAHRSQYDTLALNMRTALPNASMMGFTGTPLIAGEEQATRQQFGDYVSIYNFGD
FT                   AIEDGATVPLYYENRIPELQLTNAEFADELDALLEKAELDEDAEGALARKFGTQYTLLT
FT                   RPERLQTLAQDLVSHFVGRGFSGKAMYVGLDKAAAVTMHDLVQDAWAEHLADLRRQHDA
FT                   LPELERPWLASRIELMETTDMAVVVSQSQNELKMLDDLGLDIRPHRERMNREDLAEKFK
FT                   DPNDPLRLVFVCAMWMTGFDAPSVSTIYLDRPMKNHTLMQTIARANRVFPDKDNGLIVD
FT                   YVGVFRNLEKALAIYGAAKEGESPIEIIDALADELDTAVADLIAFCAGVGVDLIAVRNA
FT                   QGFDHVAKRDAAIEALLVDEQTRNDFTTKARQVRRLYKALLPNPKAAAQQRNVAAIRVL
FT                   AERIHEVTKPPTPDIGVVADAVDALLDRSVGAEEYVIRAAAEGSEPDPLIDLSQIDFDG
FT                   LAARLAGRKRAETDRMAQLLRQQAIGAAMRNPTRYELVERIEQLIADYNAGSVNIDEYL
FT                   RRLVELSRTLTSEEERAVREGMTEEELAIFDLLTQPDPVLTAEERERVQASAKTLLQHL
FT                   HEKLVQDWRRKVDVMNDVNSTIRRVLDDGLPETPYTVDVFREKVQLVYDHVLSAYGDDG
FT                   ESVYTRRVDVGFPPQTAGQVPLGPIDVDRIADDVVARIHADPAFAEHVARQLIDRPNAA
FT                   E"
FT   gene            complement(33798..35609)
FT                   /locus_tag="Mmcs_0025"
FT   CDS_pept        complement(33798..35609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cef:CE1462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06147"
FT                   /protein_id="ABG06147.1"
FT                   /translation="MASPQRLPTATVVCSGRKQPQSRFTGYALTVIDTQAVFNMALFNL
FT                   RQVERRLMVTAAEMITADALACGHALSFEDQPILGQVFTTLKKRQKHLTLILGAGVSMN
FT                   ASLPSWSTLVRDMSKSVKDAKLSQMLREVTGDSLERKAETTIQIACALNKNIDAAQIIR
FT                   DALYNAEEIPKPGLLASSIGRLIAEYFPAVSVLTTNFDLIMEEAVSAYLPGIAITPYSM
FT                   DTYSDWEASEGTDTELGVLHLHGVVRQGGLSPSGPIVLTDSDFLEHGAQVRSAVGKAIN
FT                   SGVALFVGLSLTDPNIVGPLYEAAGHASSERYGLFVPRLYGDDFTPTEYAKYALSGAEF
FT                   LRRKLHLRPIFMKSYSQLTQLISEFGLAVAEPKLYRRNGPKATSLHYGFRFKEALSAAY
FT                   TAVGANTRTGDLASDSALKLSRKLHSSFHAKNGPMWLLDAFRKRHAADVSLEENFGIFL
FT                   WLRSLDSPPEKKYALKLLGTSVYTHLEAWSAKREEHITAHSNYAAIHAIYEGGVKVENL
FT                   DPSRNGGTWRSALAVPVVVTQSRSLLLRGGDPLDSLTIGAITLDSNKPVEPIDSASSDR
FT                   SVIGALESDEFQQLIDALDRLAGDVLT"
FT   gene            35895..36563
FT                   /locus_tag="Mmcs_0026"
FT   CDS_pept        35895..36563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0026"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   mca:MCA2276 DNA polymerase bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06148"
FT                   /protein_id="ABG06148.1"
FT                   /translation="MTIRRDPEGSLQHRKNLLDDEIRSCSRCAGMNEEGVTQAAPGWGN
FT                   LYSPVVIVGQSLCEQCMKPQEPFFEGSGSLLNEGLRLAGRAKGETFISNVVHCHPPKNR
FT                   GSREHEIVNCSSYLHRELELVRPRLVIALGVDAKRVLSFFYPSARVSPWPFRASSGRQP
FT                   RSPYLLFAKHPAWIKRQHDSALEQEYVHSLADAMRWVFHDAAPGLEPTCAGMADVNATD
FT                   "
FT   gene            37037..37321
FT                   /locus_tag="Mmcs_0027"
FT   CDS_pept        37037..37321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06149"
FT                   /protein_id="ABG06149.1"
FT                   /translation="MSDTEPQWRHICEVCGVEEILTPGDAFNLGWDYPPRMGQFGVVGP
FT                   RCCPNCPNVGTVWWALAIDGYTDDMLTEAQRATVRRIAGEPLSIAVLSE"
FT   gene            37655..37897
FT                   /locus_tag="Mmcs_0028"
FT   CDS_pept        37655..37897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06150"
FT                   /protein_id="ABG06150.1"
FT                   /translation="MRDDWSAARRLVSAFHCGAVDNFVAVVDEIDTAGRWKAVALALVG
FT                   EVAAIANHVRGSAAQDFLDQRSATALDRDRQTGEP"
FT   gene            37942..38268
FT                   /locus_tag="Mmcs_0029"
FT   CDS_pept        37942..38268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06151"
FT                   /protein_id="ABG06151.1"
FT                   /translation="MAVDLRELTLFVSDVDAAARFYEAIGLALYCIEEPEHPRRYDGEL
FT                   GLQLRPATARRPVSQLQLGFEVEDISAVVARLAAVGASWTCDLPNFVRTSDPEGNKITW
FT                   TQRR"
FT   gene            38340..38999
FT                   /locus_tag="Mmcs_0030"
FT   CDS_pept        38340..38999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cef:CE1182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06152"
FT                   /protein_id="ABG06152.1"
FT                   /translation="MAEFEYIQWRHRWPEVVVQRRTDEAVELLTRYYAVTAAGRPAYSG
FT                   SQFEAMAALNSDPYSIGPADFTAASMLSVNIHAQAAIRLLSRDANEITALLHRIPVDVD
FT                   IITIDPNDLVPGGPASLLWQLLRRGNDGMGRTRTSKLIAAKRPRLIPIWDSFVEQATGL
FT                   DTSDYWRQFQAVLAADDRAVWTWLTQIRSAVPNVPAAVSNLRILDVLLWMTVDQQR"
FT   gene            39866..40915
FT                   /locus_tag="Mmcs_0031"
FT   CDS_pept        39866..40915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06153"
FT                   /protein_id="ABG06153.1"
FT                   /translation="MGRHGAMASAADDPEPAKPVARANHDRADSQRHVLAPFHHDVNED
FT                   RYRALAGLTIRGVDPRYLVPALESAKRLWCRLGDFAPSTDRISAAHLARYLAFEAERVG
FT                   TFDYRTALRRANVDRHLMDIATRKTNRSMRTIRWILYDAGRLVHPREYPEARTLPAPRT
FT                   KRIDAAAPQDIRDWYTLAPTLPQWLRRRLALLLDLCYGAGARPPDFKVLRGTSITSETI
FT                   DGLHIAIVRLQNTAGGTRLVPITDPDISRRLLALAQSKGSDYLLPAAKGEVERNATNRI
FT                   GEQLRARGHGNINAAALRNRWILDLADRVPAALLLQLADVVDVQVLADQRTQLPTYGIH
FT                   RAIALMAEG"
FT   gene            40919..42697
FT                   /locus_tag="Mmcs_0032"
FT   CDS_pept        40919..42697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06154"
FT                   /protein_id="ABG06154.1"
FT                   /translation="MITDFEKSYRLSDSLFREAKVIIERSHAAEMINDFHDQHRGAGGQ
FT                   DCAGIAYTISAVLVAALGLLMLGRTPTYKAIQQAIGDLTPRQLAEVGMAGQDTSRIFAD
FT                   RAEQRRERTRFVAWLNRRLAPLDPSPDQPARRITNAEHRRIIAHRSTEQRAASGEATER
FT                   LRTVMNRIVFGSIVDPQPPEAVGDIVADETIFDLAGPSAGLGIKPDKQRGAAYFGSYYS
FT                   RDKHSTTVYQDASGGGKRGFGIGLTAVIRVGPPDQLHAVAPVVIGMDVHPPTSGSVDGL
FT                   DVAITHAKRNGLDTRRAGRARLPCLTTDMGYNPKDGFARLMLDHQYAAVVRYPQHWTLT
FT                   DTAANPPGATADVPPGPIQFAGSFYCPAAADLLAQHHMPKTRDLLADNGWEAHDRRLAS
FT                   VLPFLMGLNSRPRLSRPRGRPPLGVEPRLDVKAELVCPAVQLRVQCPLKPASMTRAAFG
FT                   APTAAPTWQASDRQCCAQSIVTVTLTPRQLKKAQWGPVGASWEHILYFEAARARTEQTF
FT                   SILKSAHVTKLVDLKWGPRREPMVKLLMALAVASTNHRIQKTYRSRQAREESIDVRRRQ
FT                   LRDHLGHEPAKTPPLT"
FT   gene            complement(43100..44119)
FT                   /locus_tag="Mmcs_0033"
FT   CDS_pept        complement(43100..44119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0033"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sco:SCO4951
FT                   aldoketoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06155"
FT                   /protein_id="ABG06155.1"
FT                   /translation="MRYRTLGRTGIQVSAIGLGAMMFATRMGNSKQESVDVIHRALDAG
FT                   INLIDTADAYEDSEDIVGHALKGRRDDVVLATKFGRPVDDNPNHRGASRRWIVAAVENS
FT                   LRRLQTDYIDIYQLHRSDPDTDLEETLSALTDLVRSGKIRAFGTSTLPASNLVQAQWIA
FT                   ERHGYERPHTEQPPYSILNRGIEREVLPIAQQYGLGVLVWGPLGQGMLTGRVRRGHDND
FT                   VIRAQLLSSFHDQRRLDAVERLIPVAAQAGLSMPHLAMAFTIAHPGVTGALLGARTMSH
FT                   LDDLLTGADTVLGDDVLDEIDDIVPPGTDAGPLDQDHTPPAIQKAALRRRPLAERAAA"
FT   gene            44204..44809
FT                   /locus_tag="Mmcs_0034"
FT   CDS_pept        44204..44809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0034"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rpb:RPB_4514
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06156"
FT                   /protein_id="ABG06156.1"
FT                   /translation="MAGRPERAGVTNASINTGRRQRLDAQRNVLSILEAAKTTFADSGV
FT                   DVPARTITDLAGVGVGTLYRHFPRRSDLILAVIEREIDDCIEAAHELTARMEPRDALVA
FT                   WVSRFAEFVRTKHGLANALHSGDPAYTGLADTLLDRLEPVLDSLLERVPLNVRNRDTVS
FT                   ARDVLTTIALMCQPVPGETSSFNERMTKIFLEGLLASG"
FT   gene            44953..45942
FT                   /locus_tag="Mmcs_0035"
FT   CDS_pept        44953..45942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:507957.179 mucin-associated surface
FT                   protein (MASP) PROSITE: ALA_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06157"
FT                   /protein_id="ABG06157.1"
FT                   /translation="MSENLCVKTPFSDLRYLVDCLGPLTRRDSGPCSLVRRRRHEAISL
FT                   SVPVARMGQRSEWGLGMGSKRSSDGSGAIGGAIFFVIVLIAMVPKPVWIAIGIGVAVIV
FT                   LGWVAYRIFEAVEKSRAEAAERERAEQAARAAAAKREREERARTEKQRRIDTLGKANAA
FT                   LVESALRAVKQIAGSEAARAGWLGDVDFTADIRGITENFQKAHALRGVAGKLSALDKPS
FT                   AEDRVILAEAKTTAANLERTAIERVELVGKCAVEAQLIDKSLRTEREDARVAEQRAELH
FT                   AKLSAMLYGIEAAPNTTPEDSAVDAVMARVQAYREIKYQIEQARDGQS"
FT   gene            complement(45967..46995)
FT                   /locus_tag="Mmcs_0036"
FT   CDS_pept        complement(45967..46995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0036"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:bll7862
FT                   homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06158"
FT                   /protein_id="ABG06158.1"
FT                   /translation="MDEFPQDYEIFDLGDVTLQHGATLRDAKLAYKTYGELNADKTNAI
FT                   VYPTWYSGRHWDNEWLIGEGMALDPTKYFIIVPNMLGNGLSSSPSNTPPPYDAARFPHV
FT                   TFYDQVEQQHKLVTSFGIETLPLVTGWSMGAGQTYQWAVSYPDMVQRALPFCGSSKTSE
FT                   HNIVFLEGVKSALTADAAFKEGWYTEKPTKGLRAAARVYAGWGFSQAFYWQQEYKKMGY
FT                   SSLEDFLVGFWEGFFLDRRDPNNLLAMLWTWQNGNVGATPGRGFDGDQVAALKTIKAKM
FT                   IVAPAEKDLYFPPEDEEFAVSHIPNAELRVIPGIYGHFAGGDANPADNQFIDAALKDLL
FT                   AR"
FT   gene            complement(47100..48971)
FT                   /locus_tag="Mmcs_0037"
FT   CDS_pept        complement(47100..48971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP4336 putative virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06159"
FT                   /protein_id="ABG06159.1"
FT                   /translation="MAAHAVPSAATHGGGWFTKLPVLPNAAGASAIALAATPANNAGAA
FT                   ALLILFRMTKALPPSLIFKPPRLVTRSTMPRLAGCGLAQARRGYARPEDGCVELTRCWT
FT                   VTTIEHQDPGASAEWPTQPLPAPGRALNPATTQVPGCIVGGRYRLLVCHGTSGVLEFWQ
FT                   AVDLAAGRAVAVTLVDPRSSLPIEWVNEILSLTVRLRGVDAPGIATILDVLHTGQCGVV
FT                   VANWVAGGSLREVADTDPAPEAAAAALESLAMAAEASHRAGMHLSIDHPARVRISSDAR
FT                   AVLAFPATLPDGTPHTDLRGIGGCLYALLAKCWPEDVSEPAQLAELRPGTPYLVSATAS
FT                   GLARPEPGITSAATVLTMLRQAARDGRDDGADIRVLPPLDPPPPGVYAAFRNFGPDEQA
FT                   QEARKSVLRATIGTAAAVVAAGVVMLGSSVNEVLQAPDETPAMDAGQLGLQDGPTSVAP
FT                   KVPEETVKAAAADAPVKPVRAEVFSTDGRPDNPGEAGRVIDGDPATAWSTDRYYDADPF
FT                   PEFKEGLGLMLELPAPTTLGSVEVDLGSTGTVVQVRSAPGQSPAALGDTTEISAPTPMQ
FT                   PGRNTIAVRSREPVKHVLVWVSTLGSTDGRNQAAVSEITLHPPAPPA"
FT   gene            complement(49302..49877)
FT                   /locus_tag="Mmcs_0038"
FT   CDS_pept        complement(49302..49877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0038"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP4304
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06160"
FT                   /protein_id="ABG06160.1"
FT                   /translation="MPDGVTAAPRRRSEKSRVAIIAATRELLWQRGFDGLSIEAVAARA
FT                   GVGKQTIYRWWPSRPALVADVLLEDAHEILLPVRDSGNLVADVVSWIGKLAATLTSPRG
FT                   NAMLRILTVASMEHEDTAARLRAGFGDPLHVSVRDRLLAAGVDAPTAESAAEAIVGGVV
FT                   YAIQREGCAYSRSRAQRTARLVVESLTN"
FT   gene            49951..50958
FT                   /locus_tag="Mmcs_0039"
FT   CDS_pept        49951..50958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0039"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase Male sterility-like;
FT                   KEGG: mtc:MT0147 dihydroflavonol-4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06161"
FT                   /protein_id="ABG06161.1"
FT                   /translation="MGKKLVIGASGFLGSHVTRRLVERGDDVRVLIRHTSSTRGIDGLP
FT                   VECHYGDIFDDDAVRAAVAGCDVVYYCVVDARAWLRDPTPLWRTNVEGLQRVLDVVADA
FT                   DLYRFVFTSSIATIGIADSGPATEELSHNWLDRAGEYVRTRVAAEDLVLRYHRERALPA
FT                   VAMCVSNTYGPDDWLPTPHGGLVAAAVRGKLPFYIDGAQAEVVGVRDAADALILAGERG
FT                   RPGERYIVSERFMTAREIYQTACAAVGVTPPQRGVPIRALAAAAVPSAWLARLRRRDTR
FT                   FTPLTIRLMHIMSPMDHSKAERELGWRPAPTTDALAEAAEFFVGNRRRPAEDRR"
FT   gene            50958..53174
FT                   /locus_tag="Mmcs_0040"
FT   CDS_pept        50958..53174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0040"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   mpa:MAP4303c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06162"
FT                   /protein_id="ABG06162.1"
FT                   /translation="MPIALTPEQRALSDAVREFAARHAPVEKTRQAFDDLAAGNVPTWW
FT                   DDLVSAGFHAVHLPERVGGQGGDLVDTACVVEAAAQAMLPGPLLSTVATGSVALLADTV
FT                   TSESLLRDLAGGTTAAVILPNDAALQAVSTPDGWEVSGVSPVVLGVGAARLLLAAAHTE
FT                   DGGLIWFVADADAAVTECERGTDLTTDVARVRFDGHQVASGARLTGIDTERARCAVAAL
FT                   TASASAGTIRWCVDAVTEHLRTREQFGKPIGTFQALQHRAADLLISSELATAAAWDAVR
FT                   SADEPAEQHVIAAATAVLMAAAPAPDLVLDTLTMFGAIGFTWEHDLHLYWRRATALAAS
FT                   LGPATRWSRRLGELTRTTARDVTVRLGDADPEFRARVSDVLDRASTLPNDGPRPQGDYD
FT                   QFATGPQRTAIAEAGLIAPHYPAPWGLDATPLQQLIIDEEFAARPALTRPSLGIAEWIV
FT                   PSLISAAGQEVRDRLIPPTLRGETAWCQLFSEPSAGSDLASLTTRATRVDGGWKINGHK
FT                   IWTSSAQHAHFGALLARTDPDARKHRGIGYFVVDMSSEGVEVQPIRQVTGDAHFNEVFL
FT                   TDVFVPDEMLLGEPTGGWNLAIATMAQERVAIGNYVHNDRAVALRALARTPGPDQDAAL
FT                   RALGDIDAYAGSIKALGVRETLRLLDGQHAGPASSIAKVATAAMLRRTFEATLQLTGET
FT                   ALLEDTDPPVVQPYLHLPAELVGGGTREIQLNIIAQMVLGLPRG"
FT   gene            53188..54396
FT                   /locus_tag="Mmcs_0041"
FT   CDS_pept        53188..54396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP4302c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06163"
FT                   /protein_id="ABG06163.1"
FT                   /translation="MGLRGEAAIVGYVELPPERLNKAGPAPFLLEQWAELSAAALEDAG
FT                   LPAESVNGIVTSHIGESEIFVPSTVAEYLGVDANFAEILDLGGASAAGMVWRAAAAIEL
FT                   GLCDVVLCALPARYLTPTSDKKPAPLVDAMFFGSSSNRFGSPQAEFEIPYGNLGQNGPY
FT                   GQVAQRYAAVYGYDERAMAKIVVDQRVNANHTEGAVWKDKPLTIEDVLASPVIADPLHM
FT                   LGIVMPCVGGAAVVVASADIARRAKRRPVWIKGFGEHVPFKTPTYARDLLQTPITKAAD
FT                   TAFAMTGLGRADMDMVSIYDCYTITVLLSLEDAGFCEKGKGMAFVSDHDLTFRGDFPLN
FT                   TAGGQLGFGQAGLAGGMHHVCDATRQIMGRAGAAQVADCNRAFVSGNGGILSEQTTLIL
FT                   EGD"
FT   gene            54401..54817
FT                   /locus_tag="Mmcs_0042"
FT   CDS_pept        54401..54817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0042"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mpa:MAP4301c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06164"
FT                   /protein_id="ABG06164.1"
FT                   /translation="MTTFERPMPVKTPTSAPFWDALAEHKIRIQYSPSSDQYVFYPRVR
FT                   APRTLADDLEWREISGLGTLYSYTVARRPVGPHFADAVPLLTAIVEWGEGPRFSTELVN
FT                   VAPEDIRVGMRVRPVFFDYPDHDVTMLRYEPDVA"
FT   gene            54814..55221
FT                   /locus_tag="Mmcs_0043"
FT   CDS_pept        54814..55221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb2934c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06165"
FT                   /protein_id="ABG06165.1"
FT                   /translation="MTDRDDIADVLIRYATGIDRRDWPLFRTVFTDDCTLDYGDIGTFD
FT                   GVDAVTEFMDQAHAMAGHTLHRLTNFAIDVGGDSARARAYVDALIFAPDNASGVNAVGF
FT                   YDDELVRTPAGWRIARRRFTTVRVSPVGGQS"
FT   gene            55218..56030
FT                   /locus_tag="Mmcs_0044"
FT   CDS_pept        55218..56030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0044"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nfa:nfa33460 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06166"
FT                   /protein_id="ABG06166.1"
FT                   /translation="MTFAQKYGPWAVVAGASDGLGAAFAERIAENGVNVVLLARRQSVL
FT                   DDVAAGIRDRTGVETRTLAIDLTDPAATGAVADATDDLEVGFLVYCAGADPAFEPFLAQ
FT                   PIEAAEAMVQRNCVAPMRLCHHFAPAMAARGRGGLVIFGSGAGLAGGPNMVAYAATKAF
FT                   DMVFAEALWAELHDTGVDVLGLILGKTDTPALRTLEHRRGQIASTEQTPPGAVPVAGVV
FT                   SEAFDNLANGPTWIVGEDLRAATQMMGSISRSDAVRFIVEASRDAMGP"
FT   gene            complement(56054..56758)
FT                   /locus_tag="Mmcs_0045"
FT   CDS_pept        complement(56054..56758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0045"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: mpa:MAP1565
FT                   molybdate transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06167"
FT                   /protein_id="ABG06167.1"
FT                   /translation="MLGGCGAQRDPSTLTVFAAASLRTSFAEIAEQFERDHPGMDIEFS
FT                   FAGSSDLVTQLTQGAYADVFASADHRNMDRAAEAGLLDGAPVDFAANTLTIAVTPGNPK
FT                   GIRSLRDLSDPEVRVVLCAPQVPCGHAASAVEEAAGVDLRPVSEESSVTDVLNKVTSGQ
FT                   ADAGLVYVTDARDAGERVTAVPFPESARAVNTYPIAVLKESQNATGARQFLAAVTGTTG
FT                   QTVLRRNGFAAP"
FT   gene            complement(56791..57195)
FT                   /locus_tag="Mmcs_0046"
FT   CDS_pept        complement(56791..57195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0046"
FT                   /product="molybdenum-pterin binding domain protein"
FT                   /note="TIGRFAM: molybdenum-pterin binding domain
FT                   Excisionase/Xis, DNA-binding; PFAM: regulatory protein,
FT                   MerR TOBE; KEGG: mpa:MAP1121c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06168"
FT                   /protein_id="ABG06168.1"
FT                   /translation="MPKIRVRQAAELLGVSDDTVRRWLDDGSLAASADASGRKVVDGAE
FT                   LAAFARGNPATAPKDPLGTPSSARNRFAGLVTDVVSDTVMSQVEMQCGPFTVVSLMSTS
FT                   AVRELGLEPGSVAVAVVKATTVIVEAPAQP"
FT   gene            57552..59387
FT                   /locus_tag="Mmcs_0047"
FT   CDS_pept        57552..59387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgb:cg3016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06169"
FT                   /protein_id="ABG06169.1"
FT                   /translation="MLPGSVAEHADDMARVLAELPARPGGSEEEITPAGRHRGDDPVGE
FT                   PLYERATQGDHFAPYEGDGPGAAAHSVTLHRRRDTGALELRWPSIDAAGQTVVYRVVSG
FT                   EDAAPRSPDTGDPLTVTTTTSATDDRPPVAAVRHFQVWANLGATRAEALAAQPVLHAAG
FT                   VLIGRITDLALQEDSGRVVGRYTVPPGISAVYVYRMPAGEAHRDGPQYRILAGQDNLAG
FT                   FVDIDVERGYRYVYRVRCAAPVGGVLRLSEAAESGVDVSAVLAPVTDLTITGSTADATV
FT                   LDLAWTTPPGGRVVVYRTPTGPSAGAEADELPEDALDQVGLPPELRLAQPVTEERDEDG
FT                   RVRTAMPGVAWPDQWSRAYFTPVTLIGGRAMLGKTFSTVRTGVIRDIELAEYCNKQVLT
FT                   FDWPDGAASVVVYLAPPGHDPRNGLGGHTYEITLEEYEKYGGLQLSGPLPVHGCSLHLA
FT                   PIAFTGGRRVMGAIASIDYQGLLRLQYAVRVGRDADGRPFTATIAVRSEYDLPGSPAFV
FT                   LVNNPTRIPLSVHDGELVDVAPLNEQGQLAAPPAKELRWSQLTTTGGSELWAANVRNRQ
FT                   GWIRLFVSTPSPASLRLIALLDPPVEHLRLTPAVT"
FT   gene            59384..61873
FT                   /locus_tag="Mmcs_0048"
FT   CDS_pept        59384..61873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgb:cg3015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06170"
FT                   /protein_id="ABG06170.1"
FT                   /translation="MTGRYGQLTYTSFDTAAYMGGWQVKETSADLSPDEVHALTSGVRT
FT                   VFRPAQPLPAYPTPEQLDRGPRRLAYGRLDRRRAGYWHTVPSGSDSTGRPGNVFAHALL
FT                   DRAAGDRADRPIQWWRSDGWLCPYGPLAVGAAALPGTPPAPGTAVTKDSVVRFALDPDA
FT                   WRLATLFGLLDAVAAALDGGPPVVLGVESADSAAQWIGLVSFLMSAGTAARLHFSTFDR
FT                   ADQLTLARQSGQHLTAVPVDDLEHVPDDVVAISEHATLSLGELDHEPHRTADGRAITVT
FT                   PWSAMAQVVLLDAEGARSVLDDIDHYAAQVADAGLHPAWPLAMSVAHRDEFADALTEAY
FT                   AVIAAHSPRAASDSVTARTVAEVMRNALGTSTADAWKAVQDTVDGPAADLADVTYLCRA
FT                   VADEDWLSRPGRIPARERDSERRPPPRELRESLGPALAAAQAGGAHRVARLADLLLRSG
FT                   IDDDRVSAALRTEVAPKLMDSEAAPALLEALRESLGAPTRLALAATLLQDGDATAVNGD
FT                   VFDWLAEGVRAPAPHDLREARPGDPVWTAAALRGARTVQRGAVDQADRWASLWWLRVSG
FT                   SERFEEVAGSSVWHPDELLAAVGDSALPGAAAVRTLAGAPPSAALERLAQTVLRANNDD
FT                   VAVACAAVRIFDPRGWIEQGYAASHQSAYAPLWERALESTGTDAVHRDFAVRLVTFAAI
FT                   ALAAGQPYPPSSALLTAEPRVAADAFGQLAALLDGYVLNAMSVLAVAALRFAHNGDDPA
FT                   AVTDGIEELIWQGARHVMATRRPESIDIGVVAATMARLTGEPNDGAVRRHRKTVLKLLA
FT                   RRPEAPTAPIARTRWSR"
FT   gene            61875..63032
FT                   /locus_tag="Mmcs_0049"
FT   CDS_pept        61875..63032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgb:cg3013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06171"
FT                   /protein_id="ABG06171.1"
FT                   /translation="MTKCPRCFSVLDPNQYLWTLPPHAGGTRYRDDLASSYLGAPADSG
FT                   ALYTWARPPGYTGPPPPLSEASQALQGPAVEICPACHFILPDDWRNGHAVCIAMAGARA
FT                   TGKSLYIGVLVKQLELLCEHLGVSMQPATRATAVAYTMNYETPLYVQRGLVPPTPTVQT
FT                   QASHQREPLIYGIGVWHGVRRYLVLRDVAGEDLESGDLYTPPFRFFANADAVFFMFDPL
FT                   RIKGIRDQLHDLLPAQAFSGGDPRAVLNNVLHAVGAAQPKLAVIVSKFDALRVLRDVEG
FT                   SEWSLIMSNAGAAYLRDPSDTPQYDESDGQLLHEEVRSLLTRLHGGAIVAAVENPSTGM
FT                   RLPHRYFAVSALGAPPSGNRLHSRGIAPFRTVDPVRWVTAPYGVL"
FT   gene            63135..64166
FT                   /locus_tag="Mmcs_0050"
FT   CDS_pept        63135..64166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0050"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: mbo:Mb3893
FT                   hypothetical alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06172"
FT                   /protein_id="ABG06172.1"
FT                   /translation="MVQGAGETVPALRIRCGDVLCTVTPGDAPVLIGRDLPAQIRADDP
FT                   RVSPVHARIAVDGDHWVIGDAGGTTGVFVDGERVESVGVRDTVTVRLGHAEGLVVTLAV
FT                   DHATDPEEIEAGVARAGAAVEDRREELGFTRRRLSAEGVIDPQTLADFEAGRVWPPDDA
FT                   RARLEVHLGWEPGTIAAVRAGSPAPEDESTEILSDTVQMAVMVDAASIALGNVKARIDR
FT                   APAPHDAAYDEYVETVLFDLRGLEKMVRNAGKTTRRPDGAVVLRDIRRTYNGVMTRAAQ
FT                   APGAPLSRRLYVARRSAELTVEEAADAAGVSVEAVTDAEDGQFVADADAAALEALVRRL
FT                   AAG"
FT   gene            64227..64736
FT                   /locus_tag="Mmcs_0051"
FT   CDS_pept        64227..64736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0051"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mpa:MAP3028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06173"
FT                   /protein_id="ABG06173.1"
FT                   /translation="MGKNERAKIVMSDPEIAEFIDHSRTATLATLLPSGRPHLVAMWYA
FT                   VLDGEIWFETKAKSQKAVNLRRDPTVTVMIEDGLTYNTLRGVSIDGRAEIVDSDPDLLL
FT                   RVGISVWERYTGPYSDDMKPFVDQMMHNRIAVRVVPERTRSWDHRKLGMPDMPLSGSTA
FT                   QYLGEQ"
FT   gene            64733..65212
FT                   /locus_tag="Mmcs_0052"
FT   CDS_pept        64733..65212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0052"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: mtc:MT3267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06174"
FT                   /protein_id="ABG06174.1"
FT                   /translation="MTAPDRPKQLDSPLLPKIFKYVGKAHVWVYRRTGGRIGGKWRVGA
FT                   GFRKPVPTMLLEHRGRKTGKVFVTPLLYLRDGADVVIVASQGGRKEHPQWYRNLIAGPD
FT                   VFAEIGSERRPVKAVVADAEQRARLWPALVELYADFDTYQSWTEREIPVVILQPR"
FT   gene            complement(65193..66023)
FT                   /locus_tag="Mmcs_0053"
FT   CDS_pept        complement(65193..66023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06175"
FT                   /protein_id="ABG06175.1"
FT                   /translation="MSTTRPSAPAFFVPEGDTFIPTGIARGPWGETVSGTYVGGLLGHV
FT                   VERDTDADPEVAPARLTVDLLRPVAMAPVHTRSTVVRRGRRLWLADAELVQAGTVVARA
FT                   SALLLRRGPEPPDDAWTSPVNMPPLPPDPTEIGTRTTVLWVFGGADPSTPTADLSGWQQ
FT                   SGPKSVWVREITPLIDGVTLTPFVRAAIAGDYASSLTNFGSTGLPFINADYTVSLSRLP
FT                   DGPHLGLAALTHHACDGVSTGVATLFDHRGPIGNATVTALANPGFTPGLSAAAG"
FT   gene            complement(66075..66380)
FT                   /locus_tag="Mmcs_0054"
FT   CDS_pept        complement(66075..66380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0030c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06176"
FT                   /protein_id="ABG06176.1"
FT                   /translation="MTTDKTGASTTVKAEADRFTIGVEGQTVGFAEFTDRDGQRVFTHT
FT                   EVDGEFEGRGLATILVGEALDQTRSAGKRIVPECKLVASYIDKHDEYADIVDPVGH"
FT   gene            complement(66393..66887)
FT                   /locus_tag="Mmcs_0055"
FT   CDS_pept        complement(66393..66887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0055"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   ret:RHE_CH00838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06177"
FT                   /protein_id="ABG06177.1"
FT                   /translation="MTNWINTVSRDHVERAVRGRFTQANHGKPQALRRMARGDWIIFYS
FT                   PRVTYPDGAQLQAFTAIGQVVDDEPYQASTEDEVWRRNVDFLDCAETPIRPLIDALDFI
FT                   ENKQRWGYKFRFGVFRIDDHDFETIRSAMTRSPELIGASTVSDAAGGVPGQTAAPPNDT
FT                   D"
FT   gene            66942..67292
FT                   /locus_tag="Mmcs_0056"
FT   CDS_pept        66942..67292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa36930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06178"
FT                   /protein_id="ABG06178.1"
FT                   /translation="MDRRRIGDGRSAARTRSVRLRSQSMSEPSGGLTADAVRSATFSKP
FT                   PLGKRGYDPKSVRDFLALTARRLEGRGHLCAADVRSIRFPKPPLGRRGYHDGEVDEYMV
FT                   TVAAAIAALDGQ"
FT   gene            complement(67426..67719)
FT                   /locus_tag="Mmcs_0057"
FT   CDS_pept        complement(67426..67719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0057"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: mbo:Mb3892c
FT                   putative transcriptional regulatory protein WhiB-like
FT                   WhiB6"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06179"
FT                   /protein_id="ABG06179.1"
FT                   /translation="MSNVTFLEVPVGACTRDPERWTTTADEEAKAICRGCPRRWMCARD
FT                   AVELPRAEGLWAGIVIPEAGRGRTFALKQLRSLAERNGYPVRAIRRVFPESA"
FT   gene            68078..68809
FT                   /locus_tag="Mmcs_0058"
FT   CDS_pept        68078..68809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0058"
FT                   /product="conserved hypothetical alanine rich protein"
FT                   /note="KEGG: mbo:Mb3893 hypothetical alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06180"
FT                   /protein_id="ABG06180.1"
FT                   /translation="MTNAESIDEATGVLDPGVARAGAAAAARRRELDISQRSLAADGII
FT                   NAGALIAFEKGRSWPRERTRAKLEEVLRWPTGTIAKLRRGEPTAAVPAVPAAADGAEAP
FT                   LIAQAVEAAVHTLGATADVLPALDDREFTPRVTTILSDLRQLEAVAARAARIGKVTPAL
FT                   IKALSAVRGRIDELTMLAATAPNATLGQRLYAVRRRANLTISETAQAAGVPDDDIAGAE
FT                   AERPISAESAAAIEALIGVLE"
FT   gene            68930..69892
FT                   /locus_tag="Mmcs_0059"
FT   CDS_pept        68930..69892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06181"
FT                   /protein_id="ABG06181.1"
FT                   /translation="MTWPPPPPSSDPWATGPAPDSDADRDDGAPAADPVAEPLWEPLAD
FT                   PVADSGPDELSEPVEQPVEQPVEPPTARPVDQPIVHPEAATPVPQGEFVPPPAPVSEPP
FT                   PPDGGWSAAGYGGPPPVVPRAQVAPPQQKKPVWLIAAAVLGVVVIGVVVWLLVPSGDGG
FT                   STAASPTTPSPTRTADPRAEADLRGLLPRGYAADACEMRTPPAGALAEAACGANLDPGG
FT                   PPSATYTITADDTALDAAFNDVVEASSIVTCPGNIQSPGPWRRNATPQKVSGVLFCGLQ
FT                   ADRPVVAWTNTDEALVAVVKSGPRGPGLDQLYTWWSSHS"
FT   gene            complement(69962..70957)
FT                   /locus_tag="Mmcs_0060"
FT   CDS_pept        complement(69962..70957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0060"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: mbo:Mb1961c immunogenic protein MPT63 (antigen
FT                   MPT63/MPB63) (16 KD immunoprotective extracellular
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06182"
FT                   /protein_id="ABG06182.1"
FT                   /translation="MKITTVFAATAAAAAVAAAGAVIAAPIAGAESGAPAGPAVHEIGQ
FT                   QADLVNGSVVQGWTVTDLKASTDTIPYAVRGTLWEATATDEAIQGAATPIVSNFNARAR
FT                   NGETYRALWQVATAQGVNPSTLGQGQETTGKLYFDVTGAQPDSVVYNDGGQDLLLWVQP
FT                   PPSSTSSSTPRSSSSPSGSATSATPQATPQGSEASPPAAEAVEPGTPGAAPASTELVPA
FT                   PAGSSGTPLPAGSSGTPLPATSSGTPLPAGSSGTPLPATSSGTPLPAGSQGTPALAPGA
FT                   PAPAPAVPAQPAPQPASSGPAPVPVSTGDQAPVPHGQGVPTPTPTPVPVP"
FT   sig_peptide     complement(70883..70957)
FT                   /locus_tag="Mmcs_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.899 at
FT                   residue 25"
FT   gene            complement(71075..72034)
FT                   /locus_tag="Mmcs_0061"
FT   CDS_pept        complement(71075..72034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0171c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06183"
FT                   /protein_id="ABG06183.1"
FT                   /translation="MAQPGSYADWIRVDELVPPRRTPPAHGWRRWVYRLSFGRINPGQS
FT                   PEELRQLELENKVRGVLRGHYKVGVMGKGGVGKTTVSASIGSVFAELRQDDRVVAIDAD
FT                   TAFGKLGSRVDPNAQGSYWELASDQHLESFADVRSRVGNNAAGLFVLAGEGSPARRRVL
FT                   DPAIYREAASRLDRYFSISIVDCSSTMDSPVTQEVLRDLDALIVVSSPWVDGAAAAGQT
FT                   LDWLAARGMTGLLQRTVVVLNDSDGHADKRTRSILAQQFAGHGQRVIEIPFDGHLRPGG
FT                   VISGTREMSPAARRKFLELAAALADHFPSTDDRSRERG"
FT   gene            72906..73754
FT                   /locus_tag="Mmcs_0062"
FT   CDS_pept        72906..73754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb3896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06184"
FT                   /protein_id="ABG06184.1"
FT                   /translation="MMAGAPAASSGTHYDDVVAVEVTIDGMLVIADRMSASDFPPSLGI
FT                   RLNIPQPDLRKIVWDQVARDLTEQGVLNFYGDPHPEVAAMVDTLSRSDRVLEGRWWRRD
FT                   LGGKMVRFVVCRKGDRHVVAARDDEMLVLQRIAPQIGLANMVTTVLGTAPPADVEPLTG
FT                   VAAKLAQCRTANELQAYGIALTSARAYADIISEPASWVELTATERHPGGTQTTTDVAAG
FT                   VLDSPHGRIVSIPRRVSGELYGSFLPGTQENLQRALDGLVDFLPSKTWFDHSDADASHG
FT                   E"
FT   gene            73767..74273
FT                   /locus_tag="Mmcs_0063"
FT   CDS_pept        73767..74273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb3897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06185"
FT                   /protein_id="ABG06185.1"
FT                   /translation="MAGDFSTRDPDDDADDLSALDFYRPVPVEDDGEVDGGDLAALDAF
FT                   AGYGLSDEPEPEPEPLFTVTNPPGTVTVTSYLDGRVQHIDLSPRAVHMSETELAEEIVV
FT                   IAGLAAQDAKSAQYEFMLDGMREQGHDDPATRDFLQRDLELPTPEEARAHRAEVFTTRY
FT                   AGSHE"
FT   gene            74266..75987
FT                   /locus_tag="Mmcs_0064"
FT   CDS_pept        74266..75987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0064"
FT                   /product="AAA ATPase, central region"
FT                   /note="PFAM: AAA ATPase, central region; SMART: ATPase;
FT                   KEGG: mle:ML0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06186"
FT                   /protein_id="ABG06186.1"
FT                   /translation="MSDHLASLFGSAVGMLPNAPARSYELFTDITNYDETACDAWVGRI
FT                   RCGDMDRVTLFRAWYSRGNFGQLAGAAEISMNTLAARIPIGGLFGEITYPITSPLAITM
FT                   GFAVNEAKEGNFTDAMEALENVPPGGADHLIAWVKTVVYGAAERWTDVIDKVRGANSWP
FT                   DKFLAAAAGVAHGVAAANLGLFTEAERRLTEMNSSPAGQACAQTIAWYLAMTYRSQGNE
FT                   EGARALLEWLQATHPEPKVTAALRDPSYRLVTTTAEKIAARTDPWDPASAVADTSGRER
FT                   LLEEAQAELDRQIGLSRVKEQIEAYRAATQMAKIRAARGMKVAQTSKHMIFAGPPGTGK
FT                   TTIARVVANILAGLGVISEPKLVETSRKDFVAEYEGQSAVKTARTIDRAVGGVLFIDEA
FT                   YTLVQERDGRADPFGTEALDTLLARMENDRDRLVVIIAGYSADIDRLLETNDGLRSRFA
FT                   TRIEFDSYSPDEIVEIAKVIAAANDSTVNEDAAKLVLEAATLLGQRTLGGKPALDIAGN
FT                   GRYARQLVEAGEQSRDMRLARSLDFDSLGVEQLSEINGEDMASAIAAVHSRLNISG"
FT   sig_peptide     74266..74337
FT                   /locus_tag="Mmcs_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.799) with cleavage site probability 0.799 at
FT                   residue 24"
FT   gene            75991..77466
FT                   /locus_tag="Mmcs_0065"
FT   CDS_pept        75991..77466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0065"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mbo:Mb3899 possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06187"
FT                   /protein_id="ABG06187.1"
FT                   /translation="MASFRLTTKVQVSGWRFLLRRVEHAIVRRDTRMFDDPLQFYSRAV
FT                   GAGIIIAVLICLGAALMAYFKPLGKRGGDQLLVDRSTNQLYVVMPGGGELRPVYNLTSA
FT                   RLVLGNPGTPVAVKSEELNRMSKGQPIGIPGAPYATPVSGAAESMWTLCDTVTKPESVV
FT                   PRVETSVLVRPLVVDSTVGPLRPDQGMLVSFKGANWLVTEGGRHSIDLADRAVTSAVGI
FT                   PVTARATPISEGLFNALPNAGPWQLPQVARAGEPNTVGLPANLVIGSVFETVTESDDQQ
FT                   HYVVLADGVARVNDPTAAALRATNSYGLIEPPMVEASVVARIPEQVYVSPLPDKALDIL
FT                   LRQDDPTLCWSWQRVAGDQAPRTTVIAGRRLPIAASALNTGIRQITGDSTVYIDGGQFI
FT                   RLQSPDPRYGESLYYIDPQGVRYGVSDEETAKNLGLVGPLTAPWQVVSLLVDGPVLSKQ
FT                   AALLEHDTLPANPNPRKVGEDGPVAGARPGGSR"
FT   gene            77480..79717
FT                   /locus_tag="Mmcs_0066"
FT   CDS_pept        77480..79717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0066"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: mbo:Mb3900
FT                   possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06188"
FT                   /protein_id="ABG06188.1"
FT                   /translation="MTTKKFTPIIKRGPRLTPGEITVTPPDDLGVEIPPSGIQRALPWV
FT                   MGGCMLGMISIMIFTGVRQLSPYMLMMPLMMVMATVGFMAGGGSGAKRVPEINADRKEY
FT                   LRYLSGLRTRVTSSAAAQVTFFNYHAPHPEDLLSIIGTNRQWSRQANSEFFAATRIGLG
FT                   SEPAVDRLLKPSIGDVNGLAGPQAAPQPHLEPVSHMWVTKFLRTHGLIHDCPKLLQLRS
FT                   FPTIAIGGDPDGSAALLAAMICHLAVFHPPDLLQLRVLTDNPEDPNWSWLKWLPHVQHQ
FT                   SDVDAAGPTRMVFTRPDGLSDLTARGPHTADSAPSGPYVVVVDLTGGRAGFPADGRAGV
FT                   TVLTLGNHNGSAYRIRVAADGTADDRMPNSSFRLVTNSSDRLTPGQAGRIARKLAGWSI
FT                   TGAIIDKNVRVQKKVATEWHQLVGAQTVEEVTPARWRMFADTDRDRLKIPFGHELRTGD
FT                   IMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLAATHHPDQVNLLLTDFKGGS
FT                   TFLGMEKLPHTAAVVTNMEEEAELVSRMGEVLTGELDRRQSILRQAGMQVGAAGALSGV
FT                   AEYEKHRERGADLPPLPTLFVVVDEFAELLQNHPDFIALFDRICRVGRSLRVHLLLATQ
FT                   SLNTGGVRIDKLEPNLTYRIALRTTSSAESKAVIGTPEAQYITNKESGVGFLRVGMEDP
FT                   VKFQSVYTGNPYVPATTVQEDGEVKPRQSTRNRVRIHKFTATPIFDTAVTS"
FT   gene            79714..81516
FT                   /locus_tag="Mmcs_0067"
FT   CDS_pept        79714..81516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0067"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: ATPase;
FT                   KEGG: mbo:Mb3901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06189"
FT                   /protein_id="ABG06189.1"
FT                   /translation="MTASRQAAEQKVLREVVLDQLTTGEIRAYRMWLPPLTDPTPVDEL
FT                   VERDHQRRPLRFGLGIMDEPRRHRQDIWGVDVSAAGGNIAIGGAPQTGKSTFLQTLILS
FT                   AAATHSPRDVQFYCVDLGGGGLMYLEDLPHVGGVATRAEPDRVNRVVAEVKAVQRQRER
FT                   TFKELRVGSIAGYRQMREDPNNPAAADPFGDVFLVIDGWPAFVAEFPDLEPVVQDLAGQ
FT                   GLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAIS
FT                   MEKHHLMMGVPRLDGQHSAGNLVPAITSAVAQIAARHTVRAPQVRVLPERVHLDELDPN
FT                   PPGPDADYRTRWRIPLGVRESDLSVAYNEMQMTPHLLIFGAPKSGKTTIAHAVAQAICR
FT                   RNSPQQVRFMLADYRSALLDAVPQSHLLDAGAVNRNHASLEAAIKALATNLQKRLPPPD
FT                   LTTAQLRSRSWWSGPDVVLLVDDWHMIVAASGMVPPMAPLAPLLPAAADIGLHIIVTCQ
FT                   MSQAHRATMDKFVGAAYGAGTPTLFLSGEKTEFPSSEIKLRKRPPGQALLVSPDGKEVV
FT                   QAAYVDPPADPLEEEVLAPPPQGG"
FT   gene            81664..81957
FT                   /locus_tag="Mmcs_0068"
FT   CDS_pept        81664..81957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0068"
FT                   /product="PE-like protein"
FT                   /note="PFAM: PE-like; KEGG: mbo:Mb3902 PE family-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06190"
FT                   /protein_id="ABG06190.1"
FT                   /translation="MQPLEHNPGAAGIGGQVVANGARGLAGGTAATAAVTALVPAGADE
FT                   VSAMAAATFAAEGAETLALNTFAQEELSRAGAAFTEISGIYAAVDAANASTF"
FT   gene            82008..83339
FT                   /locus_tag="Mmcs_0069"
FT   CDS_pept        82008..83339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0069"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mbo:Mb3903 PPE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06191"
FT                   /protein_id="ABG06191.1"
FT                   /translation="MALTGIPLPPTWTALPPEVNTGRLMAGAGPAPMLQAAAGWEALAV
FT                   LLETQADELAASLANLSSMWTGTASERAVAATMPMVLWLRTTSAQAMKRALQAANQANS
FT                   YTLAMATTPPLPEIEQNHITHAVLEATNFLGVNTVPIGVNEFDYFVRMWNQAAGAMDVY
FT                   QAETQMNLLFEPIPPMTPIVIPGVGESTGAAAVAQAGARAPMGVARNGLIAKASATAKM
FT                   ESVGLNAGRAMAQGNMAAQRAQGAVQKGEQAAHQQPQDQVMQQGVQMGVQMAGQVGSMV
FT                   AQVPQQFGQMVQTPMQMLTQPLQQVSSIFGQMGGGLGGEKAQIGVIGAAPFSNHPLAGG
FT                   SGVSSGAGLVRAASLPGAGGTAARTPLMANLVGDKMAAAPVPVGAGAAAGATVGGLAPV
FT                   GGAGGGMGPMGMAGQGAKGGGSKPGLTAPAPLVHDLDEDDGDDW"
FT   gene            83433..83732
FT                   /locus_tag="Mmcs_0070"
FT   CDS_pept        83433..83732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0070"
FT                   /product="10 kDa culture filtrate antigen LHP (CFP10)"
FT                   /note="KEGG: mbo:Mb3904 10 kDa culture filtrate antigen LHP
FT                   (CFP10)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06192"
FT                   /protein_id="ABG06192.1"
FT                   /translation="MAMNTDIAVLAKEAGNFERISGELQGVMRSVDATANSLLPQWRGQ
FT                   AGEAAQAALLRYQEAAQAQIQTLTEISSNIHTSGTQYGSTDEDQAGTLASSMNL"
FT   gene            83763..84050
FT                   /locus_tag="Mmcs_0071"
FT   CDS_pept        83763..84050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0071"
FT                   /product="6 kDa early secretory antigenic target EsaT6
FT                   (EsaT-6)"
FT                   /note="KEGG: mbo:Mb3905 6 kDa early secretory antigenic
FT                   target EsaT6 (EsaT-6)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06193"
FT                   /protein_id="ABG06193.1"
FT                   /translation="MSEQVWNFAGIEGGAGEINGAVSTTQGLLDEGKASLGALAAVWGG
FT                   SGSEAYQAVQARWDNTSAELNAALQNLAQTISEAGSTMAQTEAGVTGMFA"
FT   gene            84156..85583
FT                   /locus_tag="Mmcs_0072"
FT   CDS_pept        84156..85583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0072"
FT                   /product="conserved hypothetical proline and alanine rich
FT                   protein"
FT                   /note="KEGG: mbo:Mb3906 conserved hypothetical proline and
FT                   alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06194"
FT                   /protein_id="ABG06194.1"
FT                   /translation="MSADYDRLFHSPDAAQTPDEATVHVDRDALMQGTAPAPAPAGGSN
FT                   NADGSAPPPLPITPPRTQAAPAPPPRHAEITTQMPPTTQAPTSQGPVPQRPPNGMMRTP
FT                   QTNLPGGARFEAPRQASAPAPRPAPAPPPSAHFAEAPPAEVAWPQSQPPAQPAPTSAAA
FT                   MGNHRAIDALSHVGVKSAVKMPSQRGWRHVLYLLTRINLGLSPDEMYEMDLHARIRRNA
FT                   RDSYQIGVLGLKGGVGKTAVTVALGSTLAKVRGDRILAIDADPDAGNLADRAGRQSAAT
FT                   IADLLSDKELDRYNDIRAYTSMNGANLEVLSSEEYSQARREFNDDDWKGATDVVSRYYN
FT                   LVLADCGAGLFQPASRAVLSTVSGLVIVASASIDGARQAAVTMDWMRQNGYQDLLGRSC
FT                   VVINHVVPGKPNIDVDDLVQQFERHVAPGRVIVLPWDKHIAAGTEIQLDLLDKVFQRRI
FT                   TELAAALSDDFDRLERR"
FT   gene            85580..87109
FT                   /locus_tag="Mmcs_0073"
FT   CDS_pept        85580..87109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0073"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mbo:Mb3907 probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06195"
FT                   /protein_id="ABG06195.1"
FT                   /translation="MTTTAAASTTSSVTPGRPSTTRVTILTGRRMTDLVLPAAAPVETY
FT                   IDETVAVLAEILEDTPKDVLAGFDFTAQGVWAFARPGAPPLKADESLDDAGVVDGSLLT
FT                   LVSVSRTERYRPLVEDVIDAIAVLDESPEFDRAALNRFVGVSIPLVSVAITLMSLVSWD
FT                   RTGQSLWWALALAVLGLGLLGGSLLAQNRYANLNMAESLLIASIPALAGGAALAVPLPN
FT                   GVGSLGAPQLAGAGAVVLLLTLATRGGPRKRAEVAAFLAIATAALTAAAVGYGYGWQYW
FT                   VPAGAVAFGLIVLTNAAKLTVAVARIALPPIPAPGETVTNDELLDPVTSREGVDEESPT
FT                   WQAIIASVPESAARLQERSVLAKKLLIGFLTAGALILAVGAVAVVVQGHFFVHSLIVAG
FT                   LVAAICGFRSRLYAERWCAWALLAVTVIVPTGVMVRLCQWYPDDAWLVLAIYTALGAVA
FT                   LVVIGATDGVRRVSPVTKRILELVDGAAIAAVIPLLLWIASVYDVLRNLRF"
FT   gene            87119..87430
FT                   /locus_tag="Mmcs_0074"
FT   CDS_pept        87119..87430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06196"
FT                   /protein_id="ABG06196.1"
FT                   /translation="MSGEVLQVNPPALAGAGTAFGQAASGVAGLHADAPLGEAARAVAA
FT                   LQTAAACRQAQADIGALTAAAAAAADEYGENLRSAAARYESVDQAGRDAIEQVALAGG"
FT   gene            complement(87436..87756)
FT                   /locus_tag="Mmcs_0075"
FT   CDS_pept        complement(87436..87756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb3910c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06197"
FT                   /protein_id="ABG06197.1"
FT                   /translation="MHPQVAAVLAQAQQLQSIMDEQLHKMKHQTFTASDETETVEVTLD
FT                   GHQQLTSVHIEDGLLRQGAHVVEQRLNEALQNATEAASAAIEADRERIDARVAELTESW
FT                   RP"
FT   gene            complement(87765..89366)
FT                   /locus_tag="Mmcs_0076"
FT   CDS_pept        complement(87765..89366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtc:MT3996 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06198"
FT                   /protein_id="ABG06198.1"
FT                   /translation="MAGDEVRVEPADLRARATTLDEEITDESQRPTPPCGLPFVTASAA
FT                   GIAAGSDTLRSHLISGNREAERLAAVLSEAADVYQQIDNRAAQALEYPDGPRSVEPVPV
FT                   NPTLPPSVPPIEFPATVPAVPGGQTDAGFMDVKAAAQIIHSGDSGPMRTYGEQAKKFAG
FT                   TLRDRAASFNLDGINWDGTAAEKAGDAVRQHKEWLEKLAESYEFLGTEAIDMADAHDKW
FT                   SGQHPTVAEVEAVEARVAQAGQAGDKDALARAMMDYLALQRKSEDVRTSYSADVAGKSL
FT                   PKVLDPPPGAAPVPPISSNGDPRKGKIQPAGEGAPGEPGSGGGAQPGGRPGAQPGGQAA
FT                   AAPMGGGSPAGQGGAQPAGASSGGGGSPSGGGGSPAGGGGAPAAPAAGGGLPGGLPGGG
FT                   PDGLPPLDDPALKPAAASGGGAGGGSGGGAGGGGGGVPPSPLQPAVGAETVAPGAAGTG
FT                   RAGAAAAGPAGAMGAMGGMGGMPMGGHGAGRGQGGGEKKRTPGLAPDEDLYVEDRPFTE
FT                   SVIGYTPKPRDRKDSK"
FT   gene            complement(89417..90814)
FT                   /locus_tag="Mmcs_0077"
FT   CDS_pept        complement(89417..90814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0077"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mbo:Mb3912c possible conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06199"
FT                   /protein_id="ABG06199.1"
FT                   /translation="MRSFVAQFGLRLTTGHLMWAAVLIPACIAIFVPLDLLWVGVTVSV
FT                   LIALIAVVTVRGRRLTGWVAALFSWRRRHLSTPPAPSEPAVGSTVMPGDHVAVRWQGDH
FT                   LMSAIELVPRPFTPTVVVNGQSFTDDVLDTALVENLIAAHCPELEADVVAAGYRVGKTA
FT                   PASLVALYEQVVGPYPAPANRRTWIVLRADPELTRKPAQRRDSGVAGLARYLVASTTRL
FT                   ADQLAGNGIDARPSRSFDDFDRATEVSFERETWSAIKGRSTFTAAYSAPGGPDVWWSAR
FT                   ADHTITRMRIRPGIAPTTTVLLTTLANPATPRGFSCLFGGQRAALQGISPVSDKHYELP
FT                   IGSAGILIGETADRYPVYMPFDDVDVSINLGDARLFTQFVVRSAAAGAVVTLGPQFREF
FT                   AGFVNGRIGQEAKLSWPNATTYLSPHPGVGRVILRHNFIDTPRHRQLPIRLINPREESR
FT                   YQMALEQ"
FT   gene            complement(90811..92157)
FT                   /locus_tag="Mmcs_0078"
FT   CDS_pept        complement(90811..92157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0078"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mtu:Rv3883c putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06200"
FT                   /protein_id="ABG06200.1"
FT                   /translation="MQRVGLILLALLLALLSAPPVGAIEPPSIDPAALPPDQTGPDSPT
FT                   EQRRVCSAPTVLPNSNFADKPWPNDYLQLAEAQKFATGAGVTVAVIDTGVNGSPRVPAE
FT                   PGGDFVDQAGNGMSDCDSHGTLTASIIAGRGSPTDGFIGVAPDARILSLRQTSEAFQPV
FT                   GARQDPNDPNTTQTAGSLRSLARAVVHAANLGAQVINISEAACYKITRPIDETGLGAAV
FT                   NYAVNVKNAVVVVAAGNTGQDCSQNPPPDPAVPTDPRGWQQVQTVVSPAWYSPLVLTVG
FT                   SINDNGQPSNFSMSGPWVGAAAPGANITALGYDGQPVNALQGQDGPIPIGGTSFSAAYV
FT                   SGLAALLKQRFPELTPAQIMNRITATARHPGGGVDNYVGAGVIDPVAALTWEVPEGPTA
FT                   IPYRVKQLPPPVYVPPPDRGPITWVVVIGAGLTLVLGIAALTRRALRRR"
FT   sig_peptide     complement(92086..92157)
FT                   /locus_tag="Mmcs_0078"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.769 at
FT                   residue 24"
FT   gene            complement(92348..92605)
FT                   /locus_tag="Mmcs_0079"
FT   CDS_pept        complement(92348..92605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0079"
FT                   /product="Phosphotransferase system, HPr"
FT                   /note="TIGRFAM: Phosphotransferase system, HPr; PFAM:
FT                   phosphocarrier HPr protein; KEGG: nfa:nfa28530 putative
FT                   phosphocarrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06201"
FT                   /protein_id="ABG06201.1"
FT                   /translation="MPARTVTVGSAIGLHARPAAIIAEAVVNAGVPVTLAVAGGEPVDA
FT                   GSALMIMTLGAGNGAEVTVESDDAAALDTVAGLVEQDLDA"
FT   gene            complement(92634..94649)
FT                   /locus_tag="Mmcs_0080"
FT   CDS_pept        complement(92634..94649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0080"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIB component (F1P-forming), Frc family / PTS system
FT                   D-fructose-specific IIC component (F1P-forming), Frc
FT                   family"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   component PTS system, fructose subfamily, IIA component
FT                   Phosphotransferase system, fructose IIC component; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2 phosphotransferase system, EIIC
FT                   phosphotransferase system PTS, fructose-specific IIB
FT                   subunit; KEGG: nfa:nfa28540 putative PTS fructose-specific
FT                   enzyme IIABC; TC 4.A.2.1.4; TC 4.A.2.1.4; TC 4.A.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06202"
FT                   /protein_id="ABG06202.1"
FT                   /translation="MSSPTASPIITTDLVLLDVDAGGDKEAVIGRLVNRLADAGRSTDA
FT                   DGLTRAALAREEQSATGLPGGIAIPHCRSPYVDTATIGFARLTPGVDFGAPDGPADLVF
FT                   LIAAPDSGGAEHMKLLSSLARALVRKEFVASLRAAETSEDVVSLVEDVVNPQAAAPPPP
FT                   AAEPEPARQRSLVAVTACPTGIAHTYMAADSLAAAAKNAGVTLHVETQGSSGSTPLSDA
FT                   TIAEADAVIFATDVGVKDRQRFAGKPVVASGVKRAINEPDKMVADALAAADNPDAARVE
FT                   GSAGAPSAAAPAGDVGWGTRTRQILLTGVSYMIPFVAAGGLLIALGFLFAGYDIANTPD
FT                   GQTDSLGKIIATTNSLTNLPSGGLIQYLGAVLFTIGNLAFFFLVPALAGYIAFAIADRP
FT                   GIAPGFVAGYIATTVGAGFIGGIVGGLIAGFAALWISRIGVPHWARGLMPVVIIPLFAS
FT                   LVVGLLMFLLLGRPLAWLTTSLTDWLNGLSGSSVIVLGVILGLMMCFDLGGPVNKAAYA
FT                   FATTGLNVADPASLRIMAAVMAAGMVPPLAMALASTVRPGLFTEPERENGRAAWLLGAS
FT                   FISEGAIPFAAADPLRVIPSMMFGGAITGALVMAFDVTSKAPHGGIFVFFAIGNLAWFL
FT                   VALAVGTAAGAGAVVAAKQFAKPETPADASPALANA"
FT   gene            complement(94670..95647)
FT                   /locus_tag="Mmcs_0081"
FT   CDS_pept        complement(94670..95647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0081"
FT                   /product="PfkB"
FT                   /note="PFAM: PfkB; KEGG: nfa:nfa28550 putative
FT                   fructose-1-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06203"
FT                   /protein_id="ABG06203.1"
FT                   /translation="MIVTVTPNPSIDRTVALPAPLTRGAVQRVTSVTSEPGGKGVNVAR
FT                   ALTLARLDAVALLPAADGDPMVTALRAIGVPFRCVPIAEPVRTNLAITESDGTTTKLNE
FT                   RGAALDAAARDALTRGIIDAAEQASWVVLSGSLPPGLPDDWYAEVVARLVPLRCRVAVD
FT                   TSERPLAALAAAFDHAAPDVIKPNAEELAGLVGASAEELESAAAQGDPEPVAAAARQLV
FT                   DRGVGAVLATLGAAGAVLVDRTGAWMATPPPIVPRSTVGAGDASLAGYVRAAVAGAEPP
FT                   RRLRMAVAYGSAAAALPGSALPSPAQLDLDGVAVSTIAPTPASS"
FT   gene            complement(95644..96411)
FT                   /locus_tag="Mmcs_0082"
FT   CDS_pept        complement(95644..96411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0082"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR Helix-turn-helix,
FT                   type 11; KEGG: nfa:nfa28560 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06204"
FT                   /protein_id="ABG06204.1"
FT                   /translation="MYAEERQQAIASLVMQKGRASVAELAEAYDVTTETVRRDLAALDR
FT                   AGLLRRVHGGAVPARTLHLVEAGVGEREATRAEYKDAIAAAALEYLPGSGASVLLDAGT
FT                   TTARIAGQLPSDRELVVVTNSVPIAARLAGMPSVNLQLLGGRVRGLTQAAVGEQALRVL
FT                   DSLRVDVAFIGTNGISVRHGLSTPDSEEAAVKRAMVRAAGYVVVAADSSKVGREEFVSF
FT                   APISSVDTLITDGEISDNYRGQFAERGVEVVVA"
FT   gene            96454..98208
FT                   /locus_tag="Mmcs_0083"
FT   CDS_pept        96454..98208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0083"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: Phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme
FT                   PEP-utilising enzyme, mobile region PEP-utilising
FT                   enzyme-like; KEGG: nfa:nfa28570 putative
FT                   phosphoenolpyruvate-protein phosphotransferase enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06205"
FT                   /protein_id="ABG06205.1"
FT                   /translation="MFGFTPVRVDLSTLFSNLVHMTASSAPTSHATAGTVLRGVPVVPG
FT                   VQYAPVVRPGRLPVVEDTAAEIADADRPAEAARFSAAATAVATRLRDRAAHSTGAASEV
FT                   LAATATLAQDRAWLGAAEKRIAGGTPAVRAVREAVAQFVDLFTKMGGLMAERVTDLQDI
FT                   RDRVLAELSGLPEPGVPLPMVPSVLCAEDLAPADTAGLDPTLIVALATTLGGPTSHTAI
FT                   IARQLGIPCVVAVDGLDAVPAGAFVLVDGTAGTVTVGPDEVAAAEAVAAARHEAERAAH
FT                   WAGPGATADGHAVAILANVQDGAAARAARETPAEGVGLFRTELCFLNRDTEPTVDEQAE
FT                   IYGEVLDAFAGHKVVVRTLDAGSDKPLKFAGHRDEANPALGVRGIRIAHGNPGILERQL
FT                   AGIAAAAARTGTRPWVMAPMIATAGEAKDFAAAARRHGLTPGVMIEVPAAALLADRILE
FT                   HVDFLSIGTNDLAQYTMAADRMSADLALLTDPWQPAVLALVAMTVRAGAAAGKPVGVCG
FT                   EAAADPTLACVLAGLGVTSLSAASAAVPGVGARLAQVTLQQCRDAAEAVLATATAAEAR
FT                   AAALAALG"
FT   gene            98245..99231
FT                   /locus_tag="Mmcs_0084"
FT   CDS_pept        98245..99231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0084"
FT                   /product="Pirin-like protein"
FT                   /note="PFAM: Pirin-like; KEGG: mpa:MAP3561 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06206"
FT                   /protein_id="ABG06206.1"
FT                   /translation="MPAITADTLTLPRVTAPAPSDTERPVRSITTGPRGYEGEGFPVVR
FT                   AFAGVSAADLDPFIHMDQMGEVEYEPGEPRGTDWHPHRGFETVTYMIDGRFAHQDSHGG
FT                   GGLITDGATQWMTAGSGILHIETPPAELVESGGLFHGIQLWVNLPRKDKFATPRYQAIE
FT                   GGQVKMLASEDGGALIRIIAGDVDSQDGPARGPGATHTPITMAHATVEPGARLNIPWNR
FT                   DFNALVYVLSGRGAVGPVGHPIRQGQLAVFGPGDRLSVAAEPTQDSHRPALEVLILGGR
FT                   PIREPVFHYGPFVMNSKSELIRAVEDYQAGKFGTIPPNALMPHTSGR"
FT   gene            complement(99234..101390)
FT                   /locus_tag="Mmcs_0085"
FT   CDS_pept        complement(99234..101390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0085"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: fra:Francci3_4074 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06207"
FT                   /protein_id="ABG06207.1"
FT                   /translation="MLTPAVLWRRAADRIQRRDPERDALRRAGRAAIVLPVAAAASFTL
FT                   AGGTQAPMFTIFGSVALLILADFPGNRAARALAYAGLGFNGAILITLGTLTAPHPWLGV
FT                   ALMFVLGVVVTFSGVLSEVIAAGQRATLMTFVLPACTAPGPIDERLTGWLIALALCVPA
FT                   ALFLFPPRHHDDLRRHAATVCRSLADCLDGDASTRDVHRAMNALWENFVNADFRPVALT
FT                   AGSRALVRVVDDLGWLSDRVTDDTAALLGDMKPPIVRVLRDAAAVVRIHDRQVRAARNA
FT                   DLDAALDELRSIAHGRYREDIEQILAVPDDATAVAVSRTLLGRRTFSATVGVTGRIIRN
FT                   AALADARPVWARVLGRRLPRTGAADWVMPETTAVAAITKGFVATRAVVLRNSLRTGLGL
FT                   ALAVTVTQVFPVEHGFWVVLGAMSVLRSSALTTGTRVLRAVAGTAIGFLLGVALIEVVG
FT                   VEPAVMWLLLPVVAFGSAYVPEIASFIAGQAAFTMMVLIIFNVIAPTGWSVGLIRVEDV
FT                   VLGALVGATVSLLMWPRGASATVTAAVRDACEAGAALLRAAVLRVTRGSSEQAADRVTA
FT                   LSHAALEASRTLDDAVRQYLSENGGKTDVRAPVVRAANRAVRLRAAAELIADVVPPPLG
FT                   VYPQTRRVLEAHAELVCRRLVGPAPEAVHTPPISDDVALALRPEAEENDLAISAALPLV
FT                   TVAAHLGELELLYPRAEQPLTTGR"
FT   gene            complement(101422..102039)
FT                   /locus_tag="Mmcs_0086"
FT   CDS_pept        complement(101422..102039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0086"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: nfa:nfa29450
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06208"
FT                   /protein_id="ABG06208.1"
FT                   /translation="MWRRRPQNQSQQLLFRLMGAVVTREGYFETGLAVLADQGYGGLKL
FT                   AEVCHRLGVTTGSFYHYFANWSAYTRELVEYWRQQATVRIVEAVRAEKDPHRRIETLIE
FT                   EALALPHGAEAAIRVWSSIDPDVHAVQAAVDRQRYDIMRESSLEVVGDERQAEVFAACC
FT                   VYILVGYEQATIPPDNVALRWLAAEMLHTLDSGRLNSLPDAR"
FT   gene            102154..102789
FT                   /locus_tag="Mmcs_0087"
FT   CDS_pept        102154..102789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0087"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mbo:Mb0149
FT                   probable transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06209"
FT                   /protein_id="ABG06209.1"
FT                   /translation="MPHTASRGPGRPPAAKAAETRERILRAAREVFSELGYDAATFQAI
FT                   AIRADLTRPAINHYFASKRVLYREVVEQTNAWVISAGMERAHGEGTLLGRLSAFFSAAM
FT                   HAESEDRSAAAFLVTSVLESQRHPDLRSDEHDALRMSRSFVSWAVNDAIERGELSTDTD
FT                   IPSIVEMLVAVMWGMGFYAGYVGGQQELEVIVEKFELLMANKLWQLNA"
FT   gene            102898..103836
FT                   /locus_tag="Mmcs_0088"
FT   CDS_pept        102898..103836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0088"
FT                   /product="Protein of unknown function Mtu_121"
FT                   /note="TIGRFAM: Protein of unknown function Mtu_121; PFAM:
FT                   O-methyltransferase-like; KEGG: mpa:MAP3564 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06210"
FT                   /db_xref="GOA:Q1BFX4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BFX4"
FT                   /protein_id="ABG06210.1"
FT                   /translation="MSSLRTADDTWDIATSVGSTAVMVAASRAAETERDEALIRDPYAR
FT                   LLVTGAGTGIWESVLDAKFVETVAAADAEAAAIFEHMISYQAVRTHFFDAFFTAAAEAG
FT                   IRQIVILASGLDSRAYRLDWPSGTTVYEIDQPKVLEYKSATLAEHGVEPAATRREVGID
FT                   LRHDWPAALRGAGFDPSRPTAWLAEGLLMYLPADAQDRLFEQITELSAPGSRVAAETAG
FT                   VQAEDRRQQMRERFERIAEKFDMTASLDIQQLIYEDPDRADVADWLDAHGWTATAVSSQ
FT                   QEMRRLDRWALPADLTDDDAFSNFVTAEKQS"
FT   sig_peptide     102898..102987
FT                   /locus_tag="Mmcs_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.773 at
FT                   residue 30"
FT   gene            103833..104624
FT                   /locus_tag="Mmcs_0089"
FT   CDS_pept        103833..104624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0089"
FT                   /product="Protein of unknown function Mtu_121"
FT                   /note="TIGRFAM: Protein of unknown function Mtu_121; PFAM:
FT                   O-methyltransferase-like; KEGG: mpa:MAP3563 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06211"
FT                   /db_xref="GOA:Q1BFX3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BFX3"
FT                   /protein_id="ABG06211.1"
FT                   /translation="MRRQEAGTSSLATRVGPEVLTTAAVASVTGCDDPLAAVLLGRPKV
FT                   IEVLQRSAELIDRVPALAAAHHQIADYHAMRSRFFDAYLADAAAEGIRQCVVLAAGLDT
FT                   RAFRLPWPDGMTVFEIDQPTVLRYKENALTAHGARPAADWHPVGVESDMPWPRRLWESG
FT                   FNHNEPTIWLAEGLLPLPDATQDALISEIDGLSAAGSRIAFDDVLGMCSGRSDAPGWLT
FT                   SRGWWTDVVEARHLPELSGRRDDDAQSYTAHAALVTAEKIA"
FT   gene            104696..106108
FT                   /locus_tag="Mmcs_0090"
FT   CDS_pept        104696..106108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0090"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mpa:MAP3566
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06212"
FT                   /protein_id="ABG06212.1"
FT                   /translation="MTTDSAAQATQAAQADTDIPATVARLRRTFATGRTRDIEWRKRQL
FT                   RALERLMVENETAIAAALEQDLGRKPFEAWLADIASVAGEAKDAAKNVRKWTRRRYRML
FT                   ELSQLPGLGWVEYEPFGTVLIIGAWNFPFALTLGPAVGAIAAGNTVVLKPSEVAPACSA
FT                   LMAELVPRYLDNEAIVVVEGDGSVSQELIAQGFDYLLYTGGTEIGRKVYEGAAPHLTPV
FT                   TLELGGKSPVIVTADADIDVAAKRIAWTKLINSGQICIAPDYVLADAKIRDQLVDKIKA
FT                   AVQTFESENPDGKRIVNERHFDRLTAALAATKGDVVIGGGSDASKISIQPTVVVDPDPA
FT                   EPLMTDEIFGPILPIVTVQSLDQAIDFVNARPKPLAAYLFTKTKAIRERVVKDVSSGGM
FT                   VVNHLLFHFATSKLPFGGVGPSGMGAYHGRFGFETFSHHKTVMTKPTRPDVGAFIYPPY
FT                   TEKAWKLARRLF"
FT   gene            106183..107046
FT                   /locus_tag="Mmcs_0091"
FT   CDS_pept        106183..107046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0091"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06213"
FT                   /protein_id="ABG06213.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAREGAAVVVNDLGGARDGT
FT                   GAGSAMADQVVDEIKAAGGRAAANYDSVAEPEGAENIIKTAIDEFGKVDGVVSNAGILR
FT                   DGTFHKMTFENWDAVLKVHLYGGYNVIRAAWPHFREQSFGRVVVATSTSGLFGNFGQAN
FT                   YGAAKLGLVGLINTLAQEGAKYNIKTNAVAPIAATRMTQDILPPEVFEKLTPEYVAPVV
FT                   AHLMTEELTDTDSIFIVGGGKIQRAALFQNEGTTFTKVPTLDDVASRWGEITDLSAAQQ
FT                   ASFKLG"
FT   gene            107049..108014
FT                   /locus_tag="Mmcs_0092"
FT   CDS_pept        107049..108014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0092"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: mbo:Mb0154 putative quinone
FT                   oxidoreductase (NADPH:quinone oxidoreductase)
FT                   (zeta-crystallin)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06214"
FT                   /protein_id="ABG06214.1"
FT                   /translation="MKALLAQELSGPSGLVYTDVDDPASDGAVIIDVGAAGVCFPDLLL
FT                   LRGEYQLKLEPPFIPGMEVAGTVRSAPDSSGFMPGQRVSAFTLMGGFAERVAALPDSVI
FT                   PTPDGVDDASAAALLGNYYTMQFALARRGGLTPGETVLVLGSAGGVGTAAIQLAKAQGA
FT                   TVIAMVHRSGAEEFIRGLGADVVLPLTDGWRQAVLDATDGRGVDIVVDPIGGPAFDDAV
FT                   RVLAPEGRLLVIGFAAGGGIPTVKVNRLLLRNVSVVGVGWGEFVRRNPSAQAAVGAELA
FT                   ALVEAGLRPPPPVCYPLAEGPAALQALADGEIKGKLVLQP"
FT   gene            108026..108637
FT                   /locus_tag="Mmcs_0093"
FT   CDS_pept        108026..108637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0093"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2; PFAM:
FT                   Haloacid dehalogenase-like hydrolase; KEGG: bja:blr4364
FT                   putative haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06215"
FT                   /protein_id="ABG06215.1"
FT                   /translation="MLAFDVFGTVVDWRSSVIAQLEEFGRAHGVDADWAAFADAWRAGY
FT                   VPSMDRVRRGELPWTRLDDLHRMTLVDLLAAEHISVGDEAVDELTRAWHRLDPWPDSVA
FT                   GLTRLKRRYVITPLSNGNVSLLTNMAKRAGLPWDCVLSAELFRHYKPDPEAYLGCADLL
FT                   DVTPDELMLVAAHRSDLRAAREAGLRTAYVSRPLEYGPGR"
FT   gene            108738..109445
FT                   /locus_tag="Mmcs_0094"
FT   CDS_pept        108738..109445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0094"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase Methyltransferase
FT                   type 11 Methyltransferase type 12; KEGG: sil:SPO2042
FT                   methyltransferase, UbiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06216"
FT                   /protein_id="ABG06216.1"
FT                   /translation="MDTALTMAQRLLADPPEHPDVSKGYLDLLTDGGDRNTGTIQAVWS
FT                   SRLGSLLYDNSQTVIRRVSAAWQLPLEWLNVPVGGVALDVGSGPGNVTAALGRVVGPGG
FT                   LALGVDISEPMLARAVRAEAGPNVGFIRADAQRLPLRDESVDAVVSVAMLQLIPDPSAA
FT                   MAEMVRVLRPGRRMAVMVPTAGQMARLINVLPNAGARVFDEDELGDALEGLGLVGVRTK
FT                   TMGTVQWARGRRP"
FT   gene            109442..109924
FT                   /locus_tag="Mmcs_0095"
FT   CDS_pept        109442..109924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa53640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06217"
FT                   /protein_id="ABG06217.1"
FT                   /translation="MSAGGLLLVALAVAVGMVGIVVPLLPGTLLVFGAIAVWAVVEQNV
FT                   TAWVTLGVVTVILGAALLIKYLWPMRRMRAADVRTMSLVAGGVLGVIGFFVIPVLGLVI
FT                   GFVSGVYMAELGVRRDQRVAWASTVHAVKGVALSVGVELAGALLATVAWAVGVYLT"
FT   sig_peptide     109442..109543
FT                   /locus_tag="Mmcs_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.601) with cleavage site probability 0.334 at
FT                   residue 34"
FT   gene            complement(109978..110838)
FT                   /locus_tag="Mmcs_0096"
FT   CDS_pept        complement(109978..110838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06218"
FT                   /protein_id="ABG06218.1"
FT                   /translation="MSSDTLHRMKGPFLGSGALAAGMTRHALRTRYVAVHKDVYVAENT
FT                   EMTAIVRARACWLRSRGHGVLAGFSASALHGSRWIDGRRPATVIGNNRRREPGVTVWAD
FT                   AIGDDEICLINGMRVTTPLRTAIDLARRYPVDKSVPAIDALARATRLSVTDLRQALDRY
FT                   AGWKGIKQARTAIGLVDPGAESPKETWLRLLIVRAGFPRPETQLPVYDEYGMLIGEVDL
FT                   GWRDHKIAAEYEGDHHRTNRVVFRKDIRRIEALTEQGWLVIRVTALDTEGGIIRRLESA
FT                   FASHS"
FT   gene            complement(110914..111714)
FT                   /locus_tag="Mmcs_0097"
FT   CDS_pept        complement(110914..111714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0097"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: mtc:MT0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06219"
FT                   /protein_id="ABG06219.1"
FT                   /translation="MASAGDELSGAWNFRDVSSHTGVAPGVFFRASELSRLDDEGRAAL
FT                   SGYGVTDVADLRTLRELERHGPGRVPAGVDIHHLPFIETVASDAEAPHEHAFQRMMTDK
FT                   PEGESIAAAAARYMTEEYARIASAPLAQRAVRQVVTLLGSGRRVLAHCFAGKDRTGFTV
FT                   AVVLEAAGVDREAVMADYLHSNTAVPQLRESILVTVRERAAETPEVLEMAEARLTESVL
FT                   GVREEYLDAAFRTIAGEYGSLEGYLSAAGVSADELARLRSTLRG"
FT   gene            complement(111714..113015)
FT                   /locus_tag="Mmcs_0098"
FT   CDS_pept        complement(111714..113015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0098"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like Acyl-CoA
FT                   dehydrogenase, type 2-like; KEGG: mpa:MAP3570c acyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06220"
FT                   /protein_id="ABG06220.1"
FT                   /translation="MERRALGHRQWPGGPSAWASSYRDGMDFAMSAKALDYHQRLTDFM
FT                   VEHVFPAEADYHRYREEAGPKDHTVPPVVEDLKKLAKERGLWNLFLPSESGLSNLEYAE
FT                   LAELSGWSMEIAPEVINCAAPDTGNMETLHLFANDEQRKQWLDPLLNGEIRSAFAMTEP
FT                   AVASSDARNIETTMLRDGSDYVINGRKWWITGAADPRCKLLIVMGRTNPDAASHQQQSM
FT                   ILVPADTPGVDIQRSLPVFGWQDQHGHCEIVFDNVRVPVENLLHEEGSGFAIAQARLGP
FT                   GRIHHCMRALGAAERALALMIDRVQKRVAFGKPLAEQGVVREAIAKSRNEIDMARLLCH
FT                   KAAWTIDQEGNKAAHVLVSQIKSVAPQVACDVIDRAIQVHGGAGVSDDFPLARLYAWHR
FT                   AMRLFDGPDEVHMRTIARAELGREKSPFAAAVCR"
FT   gene            complement(113073..114215)
FT                   /locus_tag="Mmcs_0099"
FT   CDS_pept        complement(113073..114215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0099"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like Acyl-CoA
FT                   dehydrogenase, type 2-like; KEGG: nfa:nfa35480 putative
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06221"
FT                   /protein_id="ABG06221.1"
FT                   /translation="MPVDRLLPSDEARELIALTRDIADKVLDPIVDEHEKTETYPEGVF
FT                   AQLGAAGLLSLPQPEEWGGGGQPYEVYLQVLEEIAARWAAVAVAVSVHSLSSHPLLAFG
FT                   TDEQKQRWLPGMLSGSQIGAYSLSEPQAGSDAAALRCAAVPSDGKYVITGEKSWITHGG
FT                   RADFYTLFARTGEGSRGISCFLIPGGQPGLSFGKPEEKMGLHAVPTTTAHYDEARVDAD
FT                   RRIGAEGQGLQIAFSALDSGRLGIAAVAVGLAQAALDEATRYANERTTFGRKIIDHQGL
FT                   GFLLADMAAAVVSARATYLDAARRRDLGLPYSTQASVAKLIATDAAMKVTTDAVQVLGG
FT                   VGYTRDFRVERYMREAKITQIFEGTNQIQRLVISRSLTAR"
FT   gene            complement(114221..115660)
FT                   /locus_tag="Mmcs_0100"
FT   CDS_pept        complement(114221..115660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0100"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   sco:SCO7622 NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06222"
FT                   /protein_id="ABG06222.1"
FT                   /translation="MLSLETTATAAYVVAAILFILALAGLSKHETSRAGNTFGIAGMAV
FT                   ALIATIALALDHDIEPLGLGLLIGAMVIGAVIGLWRAKVVEMTGMPELIALLHSFVGLA
FT                   AVLVGWNGYLHVEGQPDGAEAAAIAAEGMLGIHSAEVVIGVFIGAVTFTGSIVANLKLS
FT                   ARIKSAPMMLPGKNALNVGALVAFAALTVWFVIDPQLWLLVVVTVLALLLGWHLVASIG
FT                   GGDMPVVVSMLNSYSGWAAAASGFLLANDLLIVTGALVGSSGAYLSYIMCKAMNRSFIS
FT                   VIAGGFGIEAGPAEDKDYGEHREINAEGAAELLSSASSVIITPGYGMAVAQAQYGVADL
FT                   TRKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDVVLVI
FT                   GANDTVNPAASEDPGSPIAGMPVLTVWNANHVIVFKRSMASGYAGVQNPLFFRDNTQML
FT                   FGDAKDRVDAINAALTVPEKV"
FT   sig_peptide     complement(115586..115660)
FT                   /locus_tag="Mmcs_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.741) with cleavage site probability 0.657 at
FT                   residue 25"
FT   gene            complement(115664..117187)
FT                   /locus_tag="Mmcs_0101"
FT   CDS_pept        complement(115664..117187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0101"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT-like; KEGG: sma:SAV404
FT                   putative pyridine nucleotide transhydrogenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06223"
FT                   /protein_id="ABG06223.1"
FT                   /translation="MLIAIPRESQPGETRVAATPQTVGQITKLGYSVVVESGAGVASSF
FT                   PDAAYVEAGAEIGDPWSADVVLKVNAPTDAEIAALRDGATLVGLISPALNPELVEKMST
FT                   RRITVLAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHTFGRFFTGQVTAAGKVPPA
FT                   KVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQVASLGGEYLAVDPAAAEVSATG
FT                   YAKEMGEDYKVREAALYAEQCKDVDIIITTALIPGRPAPRIITADMVASMKSGSVIVDM
FT                   AAANGGNVEGTVKDQAIVTDNGVTIIGYTDLAGRLPATASQLYATNLVNLLKLLTPNKD
FT                   GQLTLDFDDVVQRSVTVIRDGEVTWPPPPVQVSAAPAAKAAAPVEHKPAKQPMSMGRRL
FT                   GITFAAAAALFVLIALSPAALQVHLTVFALAIVIGYYVIGNVHHALHTPLMSVTNAISG
FT                   IIVVGALLQIGHGDPVVTAIATVAILLASINVFGGFSVTRRMLAMFSRS"
FT   gene            complement(117241..117927)
FT                   /locus_tag="Mmcs_0102"
FT   CDS_pept        complement(117241..117927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0102"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: nfa:nfa19220
FT                   putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06224"
FT                   /protein_id="ABG06224.1"
FT                   /translation="MHHGPERIVLITGASGGIGAEVARHLAGPDTHVVVHYREHSGAAD
FT                   AVAGAIRDAGGRASTLGADISDEAEAATLMDSVAASFGRLDALVLNTASRAELGADPRY
FT                   AMRLNRDAQRRLAQLAVPLMPAGARIVFVTSHQAHFFPNKAVPKGYVAVAASKRAGETA
FT                   LYGMRSVLAHAGIHLTVVSGDRIDGPTLRPLPTADEFAEAIVGATRTPFPPSIVYVGKT
FT                   DYLMTA"
FT   gene            118065..119672
FT                   /locus_tag="Mmcs_0103"
FT   CDS_pept        118065..119672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0103"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: sco:SCO2071 Na+/H+ antiporter; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06225"
FT                   /protein_id="ABG06225.1"
FT                   /translation="MDTSDPTSDRWKDHPALAALTLCLALLAATVVLAPAAQRLSVPYP
FT                   AVMLAFGLALAFIPGVPVLSPNPELILPLVLPPLLFAAARRTSWREFLDNRRPIALLAV
FT                   ALVGVTAVAVGATLHALVPTVPLIAAIALGAAVAPPDAVAATAVAQKLGIPRRLRTILE
FT                   GEGLSNDATSLVLYEVAVAGTMTGAFSAWGAGEALGLAVVLGVLVGLAIAVATRWLINK
FT                   LPAHPAGSGLVLVVPFAAYAAADAVHGSGVLAVVTVALAMSRYGDTQSSQTRLATGTTW
FT                   EIVELLLTGSAFAFVGLQMRAVADSIDMTFWELLQQGLIITLVVIVVRFLWIFPVATID
FT                   ERMHRRKAHVAEPIGWREMTVSSWAGMRGVVTLAAVLALPPQFPERERLVFYAFVVIVV
FT                   TLLLQGLSLPTVVRRLGVRASPHEEDDAVQALIRRARDAGFERLDEIRAREEADPEVIE
FT                   HARDNAERMWQSVGFAPPDAESHHAHTDHAMTLNALKDEILAAAREAVVKARSESGTDP
FT                   TVVDRVLRRLDTRGSQPE"
FT   sig_peptide     118065..118166
FT                   /locus_tag="Mmcs_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.549 at
FT                   residue 34"
FT   gene            119807..120667
FT                   /locus_tag="Mmcs_0104"
FT   CDS_pept        119807..120667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0104"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tfu:Tfu_1503 taurine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06226"
FT                   /protein_id="ABG06226.1"
FT                   /translation="MSVFVDLTPDESQLDSPVAPPRGKWAGRLTRAALPLISVAVFFGL
FT                   WQLAAASGIWNQTFVPYPGTVFRAFIEVSTTHDGARGYAGYLLVEHLYMTLRRVLAGVV
FT                   IGVALGVLLGLVMGSVSWVRSVLEPWLTFLRALPPLAYFFLLVIWLGIDEAPKITLLAL
FT                   AALPPAAVATTAAVLAAPVGLTEAARALGASRGEVIRDVVVPSALPETFTGIRLAVGMA
FT                   YSSVVAAELFNGLPGVGGLVKDASNYNNTPVVLVGIFAIGISGLIIDGLLRTIERRSTP
FT                   WIGKV"
FT   gene            120674..121699
FT                   /locus_tag="Mmcs_0105"
FT   CDS_pept        120674..121699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0105"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SMART: extracellular
FT                   solute-binding protein, family 3; KEGG: tfu:Tfu_1504
FT                   extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06227"
FT                   /protein_id="ABG06227.1"
FT                   /translation="MRLKALAAVAVAMLAVAGCSVDTSGQDAGKQTIRIAYQSFPSGDL
FT                   IVKNNRWLEDALPDYNIKWTKFDSGADVNTAFIAKEVDFGALGSSPVARGLSAPLNIPY
FT                   KVAFVLDVAGDNEALVARNGSGVNTIADLRGKRVGTPFASTAHYSLLAALDQNGLSPND
FT                   VQLVDLQPQAILAAFDRGDIDAGYSWLPTLDQLRRNGKDLITSRQLARDGKPTLDLAVV
FT                   ADEFAEAHPDVVDIWRQQEARALTVIKDDPDAAAKAIAAEIGLTPEEVAGQLTQGVYLT
FT                   PAEVASPEWLGSEGAPGNIAVNLESASQFLAEQKQIPAAAPLKTFQDAIYTKGLPGAIT
FT                   Q"
FT   sig_peptide     120674..120751
FT                   /locus_tag="Mmcs_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.384 at
FT                   residue 26"
FT   gene            121683..122462
FT                   /locus_tag="Mmcs_0106"
FT   CDS_pept        121683..122462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0106"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   tfu:Tfu_1505 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06228"
FT                   /protein_id="ABG06228.1"
FT                   /translation="MPSPSDGAIRLRGVSHRYGRGGQEVTAVGPVDLTVEPGAFLVLVG
FT                   ASGCGKSTLLRLLAGFEAPTEGTIAVAGAPPTPGVTAGVVFQQPRLFPWRTVGGNVDLA
FT                   LKYARVPRERRAERREQLLARVGLEGTADRRIWEISGGQQQRVAIARALAAETPLFLLD
FT                   EPFAALDALTRERLQEDVRQVSAESGRTTVFVTHSADEAAFLGSRIVVLTRRPGQVALD
FT                   LPVDLPRTNVDPDELRRSPEYTELRAEVGRAVKAAAA"
FT   gene            complement(122544..122672)
FT                   /locus_tag="Mmcs_0107"
FT   CDS_pept        complement(122544..122672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT2026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06229"
FT                   /protein_id="ABG06229.1"
FT                   /translation="MDPNPDYDASDEIEYFFNYFFWGLRGVSGPGGGYPPPAYPPV"
FT   gene            122821..123480
FT                   /locus_tag="Mmcs_0108"
FT   CDS_pept        122821..123480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0108"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mbo:Mb0163
FT                   probable transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06230"
FT                   /protein_id="ABG06230.1"
FT                   /translation="MSAEASPNGSTRRDELLRVATKLFAARGYHGTRMDDVADAVGLNK
FT                   ATVYHYYASKSLILYDIYKGAADFTVDALHDDPTASARETIYHFTRRLLVGIANDIERA
FT                   AVYFQEGPYIGEWFTEEQVEYIREKETQVYEHVRDVIDRGIASGEFYDCDSHVLALGYI
FT                   GMTLGAYRWLRPQGRRTAQEIAEEFSTALLRGLIRDEAVRTESPLGVDVRTGVGSD"
FT   gene            123473..124244
FT                   /pseudo
FT                   /locus_tag="Mmcs_0109"
FT   gene            124241..126007
FT                   /locus_tag="Mmcs_0110"
FT   CDS_pept        124241..126007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0110"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   nfa:nfa24470 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06231"
FT                   /protein_id="ABG06231.1"
FT                   /translation="MKSTLLSRRDLDFLLFEWLRVDELTQRPRFADHSHDTFTGVLDLC
FT                   EQLAERYFAPHNKKSDAHEPTFDGEKVTVIPEVKEAWEAFAAADLLAMGMDAELGGAQL
FT                   PATVAQAAFAWISAANLATSGYLMLTIANANLLAEFGTAEQIDRFVRPMLAGRFSGTMA
FT                   LSETQAGSSLADITTRAEPRDDGTYRLFGSKMWISGAEHEITENIVNLVLAKIPGGPPG
FT                   TKGISLFVVPKYLVAEDGSVGERNDVVLAGLNHKMGQRGITNTVLNFGEGVFNPGGEPG
FT                   AVGYLVGEPHRGITYMFRMMNEARLGVGMGAVALGYTGYLKSVKYARERPQGRPVTAKD
FT                   PATPQVPIIEHADVKRMLLAQKSYVEGALALALYCARLVDLGDNQDLLDILTPVAKSWP
FT                   SQWCLEANSLAIQVHGGYGYTREYDVEQHYRDNRLNPIHEGTHGIQSLDLLGRKVTQRG
FT                   GASLRAVGGALAATVAAAGECGGEAASLAEELDARWQRLVAVTTAMFGSGDIEAAMANS
FT                   VVYLEAFGHVVIAWMWLEQFLAAEGRTGDFYDGKRQAARFFYRYELPKVGPQLDLLDSL
FT                   DRTTLEMRDSWF"
FT   gene            complement(126004..127116)
FT                   /locus_tag="Mmcs_0111"
FT   CDS_pept        complement(126004..127116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0111"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: mpa:MAP3596c AdhE"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06232"
FT                   /protein_id="ABG06232.1"
FT                   /translation="MTMTIRGAVLEEIGRPRPFTESAPLSVSELQLDPPGPDELLIRIE
FT                   AAGLCHSDLSVVDGNRVRPVPMLLGHEAAGIVEQIGPGGSDLEVGQRVVMTFLPRCGHC
FT                   TACATGGLTPCEPGTAANSAGTLMHGDIRLHRDGQPVHHHLGVSGFATYAVVDRHSVVA
FT                   VDADVPPVVASLLGCAVLTGGGAVLNVGKPQPGQTVVVVGLGGVGMAAMITAMAHDGVD
FT                   VVGIDQLEDKLDRARAMGINAAYTPEEAAERGLKAAVVIEAVGHPSALETAIAHTAPGG
FT                   RTITVGLPRPDARISVSPLGFVAEGRSLIGSYLGSAVPARDIPRFVELWRSGRLPVETL
FT                   VSSTISLDEINAGMDRLAEGKAVRQVIEFD"
FT   gene            127151..127594
FT                   /locus_tag="Mmcs_0112"
FT   CDS_pept        127151..127594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0112"
FT                   /product="thioesterase superfamily"
FT                   /note="PFAM: thioesterase superfamily; KEGG: mbo:Mb0168
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06233"
FT                   /protein_id="ABG06233.1"
FT                   /translation="MPPESADRPTSRDFPVHWPVSTRWTDNDMFGHLNNAVYYALFDTA
FT                   INGWINTTVDVDPVSAPWLGVVAESGCQYFAELRFPDPLTVGLSVARLGNSSVTYRLAL
FT                   FERDAVQVAAIGHWVHVYVDRSTRRPVPIPEAIRSLLETARVE"
FT   gene            127611..128057
FT                   /locus_tag="Mmcs_0113"
FT   CDS_pept        127611..128057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06234"
FT                   /protein_id="ABG06234.1"
FT                   /translation="MPLVSKTVEVEAPAEAIMAIVADFERFPEWNPEIKGCWILARYDD
FT                   GRPSQLRLDVEVQGQAGTFINAVYYPGENQIFTLLQQGDHFDKHEQRFSVVSIGASSLL
FT                   TVDMDVETKLPIPKPMVKKAIGETLDYLADNLKARAEHLGAGSA"
FT   gene            complement(128079..128774)
FT                   /locus_tag="Mmcs_0114"
FT   CDS_pept        complement(128079..128774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0114"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   mpa:MAP3599c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06235"
FT                   /protein_id="ABG06235.1"
FT                   /translation="MNAAPVARRPARRRATRREQLSDEVAGHLRAAIMTGALRPGTFIR
FT                   LDETAAELGVSITPVREALRTLRGEGMVRLEPHRGHVVVPMTRGDIEDIFWLQATIAEK
FT                   LAEAATERISETQIEELEQLNSALAEAVEHQDPEEVAFAEFAFHRAFNHASGRIKLAWF
FT                   LLHVARYLPPLLYATDPSWGTDAVASHRELIAALRRRDAETVVRLTTGQFTDGAQRLIV
FT                   RLEKIGLWD"
FT   gene            128910..130580
FT                   /locus_tag="Mmcs_0115"
FT   CDS_pept        128910..130580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0115"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mbo:Mb0172 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06236"
FT                   /protein_id="ABG06236.1"
FT                   /translation="MTSEPDASEPSHTEQPYLARRQNWTNQLARHALMQPGDTALRFMG
FT                   RTTTWGELDDRVTKLAGALSRRGVGFGDRVLILMLNRTEFIESFLAVNKLGAIAVPVNF
FT                   RMTPPEIAFLVSDCAARVVVTEAVLAPVATAVRDLDPTLETVIVAGGATDDGILGYDDL
FT                   IAEPGEAPAPVDIPNDAPALIMYTSGTTGRPKGAVLTHVNIAGQAMTFLFTNGVDLNHD
FT                   VGFIGVPLFHIAGIGNTIVGLLLGRPTVLYPLGAFDPGALLDVLAEEKVTGIFLVPAQW
FT                   QAVCAAQRAKPRDLKLRVLSWGAAPASDTLLRDMAETFPGAQILAAFGQTEMSPVTCML
FT                   LGEDALRKLGSVGKVIPTVAARIVDEDMNDVPIGQVGEIVYRAPTLMAGYWNNPKATAE
FT                   AFEGGWFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPAIAEVAVI
FT                   GRAHEKWGEVPVAVAAVRGAEDAAKPPALSLADLDEFLTERLARYKHPKALEIVDALPR
FT                   NPAGKVLKTELRQRYAGPKPIDVGESSTAPTGSAAGPGS"
FT   gene            130793..131590
FT                   /locus_tag="Mmcs_0116"
FT   CDS_pept        130793..131590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0116"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mpa:MAP4082 putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06237"
FT                   /protein_id="ABG06237.1"
FT                   /translation="MTASSGGLTGYVRDQVRPGLEAVGGFVRMCVLTGKALFRPFQWRE
FT                   FILQAWFLFRVSFLPTVAVSVPLTVLIIFTLNILLAEFGAADVSGAGAALGAVTQLGPL
FT                   VTVLVVAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRVVASTFVALLLNGA
FT                   VITIGLVGGFIFGVYIQNVSAGAYVSTLTLVTGLPEVLISVVKATTFGLIAGLVGCYRG
FT                   LTVGGGAKGVGTGVNETLVLCVVALFAVNVVLTTIGVRFGTGR"
FT   gene            131592..132482
FT                   /locus_tag="Mmcs_0117"
FT   CDS_pept        131592..132482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0117"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mbo:Mb0174 conserved hypothetical integral membrane protein
FT                   YrbE1B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06238"
FT                   /protein_id="ABG06238.1"
FT                   /translation="MTTTQSHTSTGTVLRQRFPRGYARAEKLVAAPSRGLDSVGHVAWF
FT                   VVTAVGSIGHALRYYRKEVLRLIAEIGMGTGAMAVIGGTVAIVGFVTLSGGSLIAIQGF
FT                   ASLGNIGVEAFTGFFAALVNVRIAAPVVSGQALAATVGAGATAELGAMRISEEIDALEV
FT                   MGIKSISYLVSTRIMAGFIVIIPLYAMAIIMSFLSAQVTTTLFYGQSTGTYEHYFRTFL
FT                   RPDDVAWSFVQAIIISIIVMINHCYYGYYASGGPVGVGEAVGRSMRASLIAIVLVVLLA
FT                   SLALYGTDPNFNLTV"
FT   gene            132485..133705
FT                   /locus_tag="Mmcs_0118"
FT   CDS_pept        132485..133705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0118"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mtc:MT0178 virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06239"
FT                   /protein_id="ABG06239.1"
FT                   /translation="MAEPRSPVNKPRTPPYKLAGLILLVVFAVIATLVAFQFRGDFTPR
FT                   EKLTMMAARAGLNLDPGTKVTFNGVEIGRVAEVNAVSVGNDPRARITLEVDTKYMQLIP
FT                   ANVLADISATTVFGNKYVSFTTPPDPVPQRIKSTDVIDVTSVTTEFNTLFETVVSVAEK
FT                   VDPVKLNQTLTATAQALDGLGDRFGESIVNGNAILADLNPQMPQIRRDVRGLADLGEVY
FT                   ANAAPDLFDGLENAVTTARTLNEQRGNLDQALIAAVGFGNTGGEVFERGGPYLVRGAED
FT                   LIPTSALLDEYSPALFCTIRNFHDVEPKISSSLGGNGYSLNTHSEALGAGNPYVYPDNL
FT                   PRVNAKGGPEGRPGCWQPITRDLWPAPYLVLDTGASLAPYNHLELGQPIAIEYVWGRQI
FT                   GENTINP"
FT   sig_peptide     132485..132592
FT                   /locus_tag="Mmcs_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.720) with cleavage site probability 0.522 at
FT                   residue 36"
FT   gene            133702..134733
FT                   /locus_tag="Mmcs_0119"
FT   CDS_pept        133702..134733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0119"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP3605 putative ABC transport
FT                   system substrate-bindin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06240"
FT                   /protein_id="ABG06240.1"
FT                   /translation="MKITGTALKLGAFSLVLLLFTAIIIVVFGQMRFDRTTGYSAIFTN
FT                   VSGLRPGQFVRASGVEVGKVSKIELIEGGSRVKVDFKVDRSLPLFDESTASVRYLNLIG
FT                   DRYLELKRGDSDRKMPSGGTIPVERTEPALDLDALIGGFRPLFRALDPEKVNNIARSII
FT                   TVFQGQGGTINDILDQTASLTSALADRDQAIGEVIRNLNTVLDTTVRHQEQFDETLVNF
FT                   ERLITGLKNRADPIASSVADISDAAGTVADLLAENRSLLQDTVGYLEATQQPLVEQKGQ
FT                   LNDILVRLPNALKIIGRAGGVYGDFFNFYACDVTLKLNGLQPGGPVRTVKVWGQPTGRC
FT                   TPQ"
FT   sig_peptide     133702..133791
FT                   /locus_tag="Mmcs_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.815) with cleavage site probability 0.773 at
FT                   residue 30"
FT   gene            134730..136316
FT                   /locus_tag="Mmcs_0120"
FT   CDS_pept        134730..136316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0120"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mbo:Mb0177 MCE-family protein Mce1C"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06241"
FT                   /protein_id="ABG06241.1"
FT                   /translation="MRTLEGSNRLRGGLMGIIILVLVVGVGQSFASVPMLFAKPRYFAQ
FT                   FGDTGGINPGDKVRIAGVDVGEVLKTEIEGDKVVVGFTLGGTQIGSDSRAAIRTDTILG
FT                   RKNIEIEPRGSEALQSNGVLPLGQTTTPYQIYDAFFDLTKSASGWDTKSVRESLNVLSE
FT                   TIDQTYPHLSAALDGVARFSDTIGKRDEQLKQLLANANKIAGVLGERSGQVNALLVNAQ
FT                   TLLAAINERSYAVGQLLERVSAFSEQVEGFIDDNPNLNRVLEQLRVISDILVERKFDLV
FT                   DVLTTLSKFTASLAEAFASGPYFKVMLVNLAPYWILQPYVDAAFKKRGIDPQKFWRDAG
FT                   LPAYQFPDPNGVRQPNGAPPPAPATLQGTPEYPNPAVPRGDPCSYTPPADGLPTPGNPL
FT                   PCADLSVGPFGDNPYGPNYHGRPNVATSEPNPNGMLPTPGVASSGVPGQQAPVVPGTPV
FT                   PLPPAPPGARNEPPGPFPGPTAVGGQVNNVPPPPALPGPPPPPGPGQQLSPAQTGPLPG
FT                   NPPFLPPGSQQ"
FT   sig_peptide     134730..134825
FT                   /locus_tag="Mmcs_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.969 at
FT                   residue 32"
FT   gene            136331..137977
FT                   /locus_tag="Mmcs_0121"
FT   CDS_pept        136331..137977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0121"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mtc:MT0622 virulence factor mce family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06242"
FT                   /protein_id="ABG06242.1"
FT                   /translation="MSTIFNVRNMKMPTLSRASVIIGTLVVVLALVAAFAGWQLYKRLS
FT                   TNTVVAYFSDTLALYPGDKVQIMGVRVGTIDKIEPAGDKMKVTFSYESKYKVPANATAS
FT                   ILNPSLVASRTIQLAPPYTGGPVMEDDAVIPIDRTQVPVEYDELRDSLDRILTDLGPTP
FT                   DQPKGPFGDVIESFADGLSGKGKQINTTLNSLSEALTTLNEGRGDFFSVVKSLALFVNA
FT                   LYRSDQQFVALNDDLAQFTNSFTNTDRELATALQDLNELLTTTRGFLDENSEVLTKDIN
FT                   NLADVTNAILQPEPLDGLETGLHVLPNLGGNILNISSPVNGGIVGVPVINGMANPMQFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPILDALKFNFPPFGLNQISTAMTLPKMIAYSEDRL
FT                   RPPPGYKDTTVPGIFSRDTLFSHGNHEPGWVVAPGMQGVDVQPFTANMLTPQSLAALLG
FT                   GPDAPIPGAPPAFGTTRDGNLPGPPNAFDERNPLPPPWYPQPGPPPAPAPGVIPGDPGG
FT                   SPLSGPAPGPAPAAQAPAPAGPPLPAEAGAP"
FT   sig_peptide     136331..136441
FT                   /locus_tag="Mmcs_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 37"
FT   gene            137977..139125
FT                   /locus_tag="Mmcs_0122"
FT   CDS_pept        137977..139125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0122"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP3608 putative ABC transport
FT                   system substrate-bindin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06243"
FT                   /protein_id="ABG06243.1"
FT                   /translation="MKHRIRRLATRTVALAVAAVVLTSCGSWKGIANVPLPGGPGTGGD
FT                   AMTVYVQMPDTLALNVNSRVRVADVFVGTVRAIELKNWVATLKLGIQPGVELPSNALAK
FT                   IGQTSLLGSQHVELEAPPDPSSEPLRDGDTIPLKNASAFPTTERVLASIATILRGGGIP
FT                   NLEVIQTEVNNLLTGRAEQIREFLGRLDVFTDELNQQREDLTRAIDSTNRLLNIVASRN
FT                   DTLDRVLTEFPPLIEHFAETRDLFADAVIAVGRISRAADTYLGQAQDPLNTNLQNLQRP
FT                   LKQLARSSPYLIGALKLMLTAPFSIENVPKVVRGDYINVSLNVDLTLSAIDNGILTGTG
FT                   VSGMLRALEQAWGRDPATMIPDVRFTPNAHSAPNGPLVERGE"
FT   sig_peptide     137977..138066
FT                   /locus_tag="Mmcs_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.581 at
FT                   residue 30"
FT   gene            139129..140688
FT                   /locus_tag="Mmcs_0123"
FT   CDS_pept        139129..140688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0123"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mbo:Mb0180 MCE-family protein Mce1F"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06244"
FT                   /protein_id="ABG06244.1"
FT                   /translation="MLTRFIKIQLIIFTVLTVIALVALGWYYLRVPSLMGIGQYKLYAE
FT                   LPRSGGLYETANVTYRGTTIGKVTAVEPTERGAKATMSIDNRYRIPVDASANVHSVSAI
FT                   GEQYLDLVSTGNPGQYFSDGQTITKSTVPSEVGPALDAANEGLAVLPREKIDALLTETA
FT                   DAVGGLGPSLQRLVDSTTLIAQDFKDNLGPVNDIIANSAPILESQVNSGDNIAQWSRNL
FT                   NILAAQSAEQDAALRSGLQQAAPTADQLNAVFSGVRDSLPQTLANLAVVIDMLKRYNKG
FT                   LEQALVVLPQGASVAQAGTIFEGEGLLHFGLSINQPPPCLTGFLPASEWRAPADTSMKE
FT                   LPSGTYCKIPKDFQANVVRGARNYPCADVPGKRAATPKECRSDDPYVPLGTNPWYGDPN
FT                   QIRDCPAAGARCNQPVHPGRNGVIPAPSINNGMNPLPADQLPQPPSPVSDPLSPPGQGR
FT                   VECSGQQPNPCIYTPAPGPPGTAVYNPASGEVVGPDGVKYNVSNSSNPGDDGWKEMLAP
FT                   AS"
FT   sig_peptide     139129..139206
FT                   /locus_tag="Mmcs_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.792) with cleavage site probability 0.680 at
FT                   residue 26"
FT   gene            140658..141314
FT                   /locus_tag="Mmcs_0124"
FT   CDS_pept        140658..141314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0124"
FT                   /product="putative conserved MCE associated membrane
FT                   protein"
FT                   /note="KEGG: mbo:Mb0181 probable conserved MCE associated
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06245"
FT                   /protein_id="ABG06245.1"
FT                   /translation="MEGDAGTRQLNPTDAEETPDKSVAVSGDNPDDTESPAEDGVTTVP
FT                   SEDDGRRPPRLGRGWLTAICAVLLLLGAGAGVGGYLALRSHEESAQLAENEAAAVAAAR
FT                   DCVAATHAPDAAAMTASQAKILECSTGDFGVQAGLYGGLLVDAYRAAQVQVQVSDMRAA
FT                   VEKHNADGSIDVLVAVRVKVTNSESADQEQGYRLRVQMAPDDGTYKVARLDQVTS"
FT   gene            141311..142282
FT                   /locus_tag="Mmcs_0125"
FT   CDS_pept        141311..142282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0125"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD; KEGG: mbo:Mb0182 probable conserved MCE
FT                   associated transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06246"
FT                   /protein_id="ABG06246.1"
FT                   /translation="MTAVVDAPPDAPAAETTPAEPLARWHVRAAALAVDVLPGLAVVAT
FT                   TAPWVLAGPGIGWSWWVLTAVAAVALLAVIVNRVLLPSLIGWTLGRALCGIRVLRRDGG
FT                   EAALGRLLLRELAHVLDTVALFVGWLWPLWDRRNRTFADLLLRTEARVVARPDRDMRRF
FT                   TAKVLIGAVVVAVAAVGVTYLAVYRKEQGLDRARAQIAEQGPRIVEQMLSYGAETMDED
FT                   LNRAQTLTTEAYRPQLVAQQEAARKGGATTNEYWAVSSAVLSSSMDEAAMLLAMQGQRG
FT                   TKAEDLKFITATVRVDFDKIGDNWRVDNLTVLKAPLMQGAGQ"
FT   gene            142279..142830
FT                   /locus_tag="Mmcs_0126"
FT   CDS_pept        142279..142830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06247"
FT                   /protein_id="ABG06247.1"
FT                   /translation="MSPRRRVDGDEPDFFAVSPRRPRRWGLPLIATVAALLLAAALTVS
FT                   TLMLVSHETDRRAEVRDAAALDYVRSFMTSYTTLDPFNANAYADRILAQGTGEFAKMFK
FT                   EKMNEIVIQVARAEPTEGNVVEAGVQRWNDNGSVDVLVATTTTSKTPDGKKTIESGNRW
FT                   VATTTQEGQQWKISQLIQVI"
FT   gene            142797..143750
FT                   /locus_tag="Mmcs_0127"
FT   CDS_pept        142797..143750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06248"
FT                   /protein_id="ABG06248.1"
FT                   /translation="MEDQPADSGDLTTDPAGTGSAEPKRGRRLPWRRAKKAAAESDSPG
FT                   VAAEEPATPEEPSTPDEQAPRMPTGKARRSPKPVSATDTEPEPEPEPEVAVEKEPDAEP
FT                   EGEAQAAEPEVEAETADGAGESDAAGESEGEPEPEPVLVPHRPAGRRLLIAAAAASVVF
FT                   VGAGAFAGAMLQPYLADRAEVDTKLNIARTATEAITTLWSYTPEDMATLPDRSSRFLTG
FT                   DFATEYRRYIDAIVSTNEQAKVTNTTQVMGTAVESLTPTEATALVYTNSVSTSPVSKNV
FT                   PSLRYLSYRLTMERDGADWLITGMNAVTKLDLTPQL"
FT   gene            143767..144441
FT                   /locus_tag="Mmcs_0128"
FT   CDS_pept        143767..144441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0128"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   mpa:MAP3614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06249"
FT                   /protein_id="ABG06249.1"
FT                   /translation="MAVRSPVSNRLTVTALLLLTFATGLIDAVSVLVLGHVFVANMTGN
FT                   VIFLGFWFVPHSGVDLTAALVAFVSFLIGAVIGGRLARHLGSRPRPWLSVALGVEVVAL
FT                   MVLAVLAGTGVLDYRDNTKLVLIACLAMVFAIQNATARQFGVQELSTTVLTQTIVGIGF
FT                   DSRLAGGSGEREKLRYGVVLTMCAGAVVGATLTLVTVAPVIALAGAVVATAAALFRFGP
FT                   PA"
FT   sig_peptide     143767..143853
FT                   /locus_tag="Mmcs_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.839) with cleavage site probability 0.725 at
FT                   residue 29"
FT   gene            144438..145208
FT                   /locus_tag="Mmcs_0129"
FT   CDS_pept        144438..145208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0129"
FT                   /product="fructosamine kinase"
FT                   /note="PFAM: aminoglycoside phosphotransferase fructosamine
FT                   kinase; KEGG: mpa:MAP0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06250"
FT                   /protein_id="ABG06250.1"
FT                   /translation="MTEFVKRNPDAPPGFFACEAAGLRWLAAAAGAPCVPVIDCDATSL
FT                   TLEHLDSAAPSRSAAAAFGARLAVTHDAGASGFGAGPDGWGGPGFFGPLQKPLPMSLTA
FT                   HPTWGEFYADERLGPMGEHAAPRLTAAGREALAAVRDLCRAGRFDDGDPPARLHGDLWS
FT                   GNLMWTPDGVVLIDPAAHGGHRETDLAMLALFGCPHFDEVIAGYQSVRPLRGGWRERIA
FT                   LHQLYPLLAHVVLFGGGYIRQTESALRSVLSDFA"
FT   gene            145581..147872
FT                   /locus_tag="Mmcs_0130"
FT   CDS_pept        145581..147872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0130"
FT                   /product="AAA ATPase containing von Willebrand factor type
FT                   A (vWA) domain-like protein"
FT                   /note="KEGG: ehi:244.t00012 hypothetical protein PROSITE:
FT                   ASP_RICH GLU_RICH TYR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06251"
FT                   /protein_id="ABG06251.1"
FT                   /translation="MAKHRGAKRRSKKIAALGAVTVTATALTVGAAPAPQASAAAARST
FT                   DAVDLTADFRLFPPPQAIPDLTGGAGEAAYDLKNEFADFVFRSIFENLNLAAFAQAAGV
FT                   DPQSILERVLDNLPLALLTDPIFVDLLGGITLPLAAALGALPVLNQIPLLRDLLTQGLN
FT                   VAGLNTISGLLDILGLDLSNLADLTGLGERVGVNLVTSGDVFTLLKVLGTDLGWVPTLP
FT                   NSVADDVNETEYLGIGVDGVLDLVDTGIINVPGLLNQLLDLLNLNTDQIPDVLKVRAPV
FT                   VIGEGVGAFAAGMAYQDILAQLPNQPGGANYNGVEADPLLGSVTVLPMLLLRNPGRANG
FT                   GLFARLYPLAGLFGIDTVTPDTEVSNSGGVRLPGGLYVGGATLIPVKIDVTLQHDWLSD
FT                   VPAWPNPFSLLNTLTAVVAPTYILRGLDTGLVAGAVAGQLGPQIGEVVGGIAEDDPLAL
FT                   DFYVTVPIDALPLLEPTYLFFDAINLLTGANLNNPIGTALGPALSSLVNLGYTDVVRQW
FT                   NDDGDYWEYVRTFDDTDVPTAFGSFPDINWMNVPGDIAGAFAAGVRQAFEDGLVNRDGP
FT                   VKNALATLLNLIGLDNGLPGGIGGAGLNGVLDQIRDTIDDVLGGLDLPRPSTAAVNSVP
FT                   DDASPRIALRTVGGEDTPAEEADDDTKDHVEDVPVADTDTDGDADTDTDIDTGTDTENE
FT                   PVDEPEDQLEEDETTVEDDTTVEDEDASETEPADDTADTEDTADTKDTGDTGDTKDGDT
FT                   GESGAGDKAA"
FT   sig_peptide     145581..145700
FT                   /locus_tag="Mmcs_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.567 at
FT                   residue 40"
FT   gene            complement(147876..150056)
FT                   /locus_tag="Mmcs_0131"
FT   CDS_pept        complement(147876..150056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0131"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mpa:MAP4010c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06252"
FT                   /protein_id="ABG06252.1"
FT                   /translation="MTDVTNPPISRVTSRRGVSAGGRSGAPSRTFRTDIEGLRAVAVLA
FT                   VVLYHAGMPGLGGGFIGVDVFFVVSGFLITGLLWRQVAAGGGVRLGAFYAARARRLLPA
FT                   AALVLVATAVGAVLLLPPLQARAVLGDAIAGALYVGNYRFAIQGTDYLAATEPSPLQHY
FT                   WSLGVEEQFYLVWPLLIVGTAWLIARRFGPGAARSVLPFAAVLSAAAAASYAVSLAWTG
FT                   DWPAWAFFSLPTRAWELAAGGLVALSVGWWRRLPPVAAAAVGWSGLVLIVAACTRVTAT
FT                   TPFPGTAALLPVAGTALVIVAGCATPNLGVGRLLSKPLPRAIGRVSYSWYLWHWPVLIL
FT                   APAMFGTDLGLASRLAMIVISLGLAILTLHLVENPARFAAALRGSAVRSLAVGGVATAA
FT                   AVCAAIVLLVIRPVPTGDGPAATPVALTAPAPRATAGPAPEVAPSAPTPRQQVQAAVAA
FT                   SAEMRSVPADLSPSLGNVTKPEVFVNGCVLSWRDVDQPECVSGDAESAVSVALVGDSHA
FT                   AMWQPALETVAEQNHWRLETMSKVTCPLMDLPITSPYLGRTFSECEQWRRDVLARLESE
FT                   RPQLIVVDMSRRYGADFGFVSYDPAWVEGLGRLVSRLRATGAAVLVLGPAPDPLSTVPS
FT                   CVSDHMDDVVACSPGRAAALNAGGIAAEANAAQAAGGSYADLGDLFCTSQRCPVIVGNT
FT                   LVYRDDNHITGEYAQWLAPVIGEITHGAFAPN"
FT   gene            complement(150107..151138)
FT                   /locus_tag="Mmcs_0132"
FT   CDS_pept        complement(150107..151138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06253"
FT                   /protein_id="ABG06253.1"
FT                   /translation="MFALCAALGTMGEPHARASDPKSLLLGAIANTKGSYLVYNFGGEF
FT                   AAPFRAADGREYTLNNGGHLMTIKNASSRLNPRLLVDTHQGYQARCERDPRARTGEGLW
FT                   QASETFTPHQAWQALGQPTIAVNANFFDVRGQQGGSWRETGCSSPLGAYVDNTRGLGRA
FT                   NAPITGTIAYAGKQGLSGGDETWSALATMILPVGGAPYVVMPKGKQDFDAASPEIQKLM
FT                   DRNARFVAVAGLGLLAPGETGQLNDPGPSAARTAVAYSSASDQLYVFQGGNYTPDNMQD
FT                   LFRGLGAEHALLLDGGGSSAIVLRRDTGGMWSGAGSPRGSCDTRQVLCDSRERALPSWL
FT                   AFN"
FT   gene            151427..151717
FT                   /locus_tag="Mmcs_0133"
FT   CDS_pept        151427..151717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM1797 putative
FT                   transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06254"
FT                   /protein_id="ABG06254.1"
FT                   /translation="MIGTILGALVVGLIVGALARLIMPGKQNIGVIMTIVLGALGSFLG
FT                   SWLTYQLGYSNSNGGFEIIPFLVGIIVAIVLIAIYVGVTGKRGSRPGSTVR"
FT   sig_peptide     151427..151486
FT                   /locus_tag="Mmcs_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.624) with cleavage site probability 0.613 at
FT                   residue 20"
FT   gene            complement(151773..153056)
FT                   /locus_tag="Mmcs_0134"
FT   CDS_pept        complement(151773..153056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0134"
FT                   /product="SMP-30/Gluconolaconase/LRE-like region"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like region; KEGG:
FT                   gvi:gll3269 probable L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06255"
FT                   /protein_id="ABG06255.1"
FT                   /translation="MRICLPYKAFGVLAVAALAGCSTSAPDETAPSPSTSTSAPAPASA
FT                   DRTVTVEVPAGMDAAPFDEARRVSIPAGWTMAVWARVPKARFARWAPDGALLVSVPSTG
FT                   EILKLDGSGSTPLLEGLTQPHGMAFAGSTLYVAESDEISAYDYVDGRAGNRRTVAAGLP
FT                   DAESPDLRGAYAHALKSVAVGPDGAVYFSIGSTGNISAEDRDATPPRATIMRVPPGGGP
FT                   AEPFATGVRNGTGLAVAPDGSVWTAVNGRDNVADPATGEVDPAYVNDHPPEQLAKLTPG
FT                   RELGWPYCNIDGGPADVPFIRDVQTNADGDKLDCAALPPVEQSFGAHSAPLGLSFVDGE
FT                   LPEPYARGALVGIHGSWNRRPPRAPEVSFYPWRDGGLGDQQTLVGGFQDEDGSRWGRPV
FT                   DAVAGPDGAVYITDDDAGAVYRLAPPGR"
FT   sig_peptide     complement(152982..153056)
FT                   /locus_tag="Mmcs_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.790 at
FT                   residue 25"
FT   gene            complement(153034..153798)
FT                   /locus_tag="Mmcs_0135"
FT   CDS_pept        complement(153034..153798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0135"
FT                   /product="Pirin-like protein"
FT                   /note="PFAM: Pirin-like; KEGG: fra:Francci3_2960
FT                   pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06256"
FT                   /protein_id="ABG06256.1"
FT                   /translation="MTTAERIDVRRAGERPRTRISWLDSKHSFSFADHYDPANTHHGLL
FT                   LVNNDDTVTPGSGFETHPHRDMEIVTWVLRGSLVHQDSTGNSGVIYPGLAQRMSAGRGI
FT                   LHSEKNDSWTLTGEASHREPVHFVQMWVVPDESGIAPGYQQLEIDDEQLRGKFVTIASG
FT                   MPEHRDDTAITIRNRYAALHGARLEPGDNVELPQAPYLHLFVPRGEVTLEGAGALTEGD
FT                   AVRFTASGGQRVTAVEPAEILVWEMHANLSAV"
FT   gene            153871..154326
FT                   /locus_tag="Mmcs_0136"
FT   CDS_pept        153871..154326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0136"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pac:PPA2256
FT                   putative MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06257"
FT                   /protein_id="ABG06257.1"
FT                   /translation="MYSVWLSDEEQQVWRGYLAMVAELQAAMNRQLQHDCGLSLADYEV
FT                   LVALSERGGRRMYELGETLAWEQSRLSHQLRRMRERGLVSRRGATDDRRGATVALTDAG
FT                   RAALRTAAPGHAALVRRVLFDGMPTARRKAFSDVIDTVRERLRDSPV"
FT   gene            complement(154315..155439)
FT                   /locus_tag="Mmcs_0137"
FT   CDS_pept        complement(154315..155439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0137"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: nfa:nfa16040 putative
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06258"
FT                   /protein_id="ABG06258.1"
FT                   /translation="MRTKGALLWELNAPFRVDEIEVGDPVDDEVQIRVHAAGMCHSDYH
FT                   LTTGATPIGLPALGGHEGAGVVTKVGRNVTGIEEGDHVILAFIPACGQCQPCLKGYRSL
FT                   CDRGALLLGGKAIADGTSRVHAGSTEVSPMNLLGTFAPYMTVHKDSVVKIDHDVPFETA
FT                   AIMGCAVPTGFGSATNVAEVQPGETVVIVGVGGIGLSALQGAVIAGARNVVAVDPVEFK
FT                   RDQATKFGATHVFSSMAEAIGPVLELTHGFMAEKTIIAVGEMRGEYIEEAMTLTAKTGT
FT                   CVVTGMGSMFDADVKLNLFLFTMLQKTLKGNIFGGGSSHVETPRLVGLYKSGLLKVDEM
FT                   VTNTYRLEDINQGYQDMLDGKNIRGVITFDESDW"
FT   gene            155634..156536
FT                   /locus_tag="Mmcs_0138"
FT   CDS_pept        155634..156536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0813c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06259"
FT                   /protein_id="ABG06259.1"
FT                   /translation="MMGPFLGTEALAAGMVTRRQLGRRYRALYRNVYLPAEQELTAVTR
FT                   AKGAWLWSGRDAVAVGLSASALHGSKWIEANEPAELIRIGDAVSGILIRRDRLPEDEVC
FT                   VRLGIPTTTAARTAFDLGRRGNLTAAVQRIDALANATLLTRADVDPLLERHRGARGIVQ
FT                   ARRAIDLMDGGAESPPETTVRLMLIAARFPRPETQIVVRDQFGRFVGRIDMGYREYQIG
FT                   VEYDGPQHWTDPIQHARDIDRQAELAAQGWVIIRVSRDILRHRRDVAIRRTRDAMRAAG
FT                   WPNWAQVRVDPRISVERWA"
FT   gene            complement(156564..157577)
FT                   /locus_tag="Mmcs_0139"
FT   CDS_pept        complement(156564..157577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0139"
FT                   /product="RNA polymerase, sigma-24 subunit, RpoE"
FT                   /note="PFAM: sigma-70 region 2 sigma-70 region 4 Sigma-70,
FT                   region 4 type 2; KEGG: mpa:MAP3621c RNA polymerase sigma-70
FT                   factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06260"
FT                   /protein_id="ABG06260.1"
FT                   /translation="MSAIVRKLASVTVLARTVDDGPDEDAFLADAQKYRRELLAHCYRM
FT                   TGSLHDAEDLVQETYLRAWKSYKGFQGKSSVRTWLYRIATNTSLTALDGRARRPLPTGL
FT                   GAPSSDPVDDIHERAEVPWLQPLPDDAGDPSSIVGSRESVRLAFIAALQHLSPRQRAVL
FT                   VLREVLQWKAAEVADALGTSTAAVNSLLQRARAQLDAIGPSEDDDLRPPESPEARDLLT
FT                   RYIAAFETYDVDRLADLFTAEAVWEMPPFDGWYQGPHDIVLLSKTHCPAERAGDMQLIP
FT                   TTANGQTAAALYMRNPATGRHEAFQLHVLDVTADGISHVVAFHATTFAPFGLADTL"
FT   gene            157622..158461
FT                   /locus_tag="Mmcs_0140"
FT   CDS_pept        157622..158461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0140"
FT                   /product="Acylglycerol lipase"
FT                   /EC_number="3.1.1.23"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mpa:MAP3622
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06261"
FT                   /protein_id="ABG06261.1"
FT                   /translation="MASTRSERHFDGVGGVRIVYDTWTPDAPARGVVVLSHGYAEHARR
FT                   YDHVAQRFGEAGLIVYALDHRGHGRSDGKRVYLRDIAEYTGDFHTLVGIAAREHPDLPR
FT                   IVLGHSMGGGVVFAYGAEHPGDYAAMVLSGPAVYAQSAVKPWLVTVAKLLGRIAPGVPV
FT                   EQLDADAVSRDPEVVAAYKADPLVHHGKLPAGVARGLFTVGETMPQRAGALTAPLLVVH
FT                   GEKDRLIPVEGSHRLVDRVASQDVHLKVYPELFHEVFNEPERATVLDDVISWIEVRL"
FT   gene            158458..159471
FT                   /locus_tag="Mmcs_0141"
FT   CDS_pept        158458..159471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0141"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: sco:SCO0145 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06262"
FT                   /protein_id="ABG06262.1"
FT                   /translation="MKAVVRLAASCIAAALLVAGCGSDDKAADETAPAQTGWVDDEVTF
FT                   TADGLTIHGTYRHRDGSGPAALLISESGQTDRNGDNAVAGPVGNMRQLAELLSERDVAS
FT                   LRYDKVGTGRTGLGPYATRPADVGTAVYTAGAAAALRFLADQPDTASDRISVYALGEGT
FT                   VHAMSLAAANDPAVHSLALLQPLAARYLDIITGRVRAEADPTVLANWLAAVEEIRTKGT
FT                   VPAQLPEGLGAIVNPGNIKAVIEADRVDPLALAAKVPAGTPVLLTCSNSDGQAKCDALR
FT                   PLMDALRHTELTVVELDGVNHVLRDDPSDNVANYAQQAPLSPQVVKALDEFVGEQP"
FT   sig_peptide     158458..158541
FT                   /locus_tag="Mmcs_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.384 at
FT                   residue 28"
FT   gene            159482..160231
FT                   /locus_tag="Mmcs_0142"
FT   CDS_pept        159482..160231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06263"
FT                   /protein_id="ABG06263.1"
FT                   /translation="MSDDKMLARIAALLRQAEGTDNVHEAEAFMAAAQRLATATSIDLA
FT                   VARSHSDQRTKAQTPVQRTITIGEAGTRGLRTYVQLFVVIAAANDVKCDVASNSTFVHA
FT                   YGFAEDIDASHALYASLVTQMVKASQAYIESGAHRPTPTITARLNFQLAFGARIGVRLT
FT                   EAREEALAAATEAEDSRPGTAIALRDKDLELKDFYRQASQARGTWRATSATAGYSSAAR
FT                   RAGDRAGRRARLGPSQELAGARTALET"
FT   gene            160228..160743
FT                   /locus_tag="Mmcs_0143"
FT   CDS_pept        160228..160743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06264"
FT                   /protein_id="ABG06264.1"
FT                   /translation="MSGRDTQRAKVYAAEQFVRTLFDRAAERGNRIVEFFGTQLTLPPE
FT                   ARFASVASVQAYVDDVLAHPRMRTGWPGAGALTVRPRRGATAAHYEVGDGRALIAVPER
FT                   HSTWALRELVVLHEIAHHLSRAEPAHGPAFVSTFCEVAEAVMGPEVAHVLRVVYAKEGV
FT                   RMGGGSKG"
FT   gene            160747..161412
FT                   /locus_tag="Mmcs_0144"
FT   CDS_pept        160747..161412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0144"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase O-methyltransferase, family 3 conserved
FT                   hypothetical protein 95; KEGG: mbo:Mb0193 probable
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06265"
FT                   /protein_id="ABG06265.1"
FT                   /translation="MRVSEPNPQAVDQLFDRLLHTEDDALIAARESAAAAGMPQIEVSA
FT                   QHGRLLLLLASVTHARRVLEIGTLAGYSTINLARGVGPDGRVVTLEFDPRHAEVARTNL
FT                   ARAGVADQVEVLVGAALDTLPTLQHGAPFDLVFIDADKENNVAYVEWAIKLGRPGTVIV
FT                   VDNVTRMGRIYDPAPDDLQAQAVREMLEMMGSHPRLSTAAIQTVGAKNWDGFAVAVVT"
FT   gene            161439..161837
FT                   /locus_tag="Mmcs_0145"
FT   CDS_pept        161439..161837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06266"
FT                   /protein_id="ABG06266.1"
FT                   /translation="MGICYRNGMLTVDRVVNASPAEVWSVLIDLDAWPKWGPTVAGAEL
FT                   LDGTELGLGERGKVYTPVGIPLPFTITEFEPGRRWSWQVAGIPATAHGVEPTEAGTRLY
FT                   MGAPVWAGAYLPVLAVALQRIDRMVSGG"
FT   gene            complement(161931..163673)
FT                   /locus_tag="Mmcs_0146"
FT   CDS_pept        complement(161931..163673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0146"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: nfa:nfa11740 putative phosphogluconate
FT                   dehydratase; TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06267"
FT                   /protein_id="ABG06267.1"
FT                   /translation="MPSGSSGTPADALRASDSSPDIKPRSRDVTDGLEKTAARGMLRAV
FT                   GMGDDDWVKPQIGVGSSWNEITPCNMSLQRLAQSVKGGVHSAGGFPLEFGTISVSDGIS
FT                   MGHEGMHFSLVSREVIADSVETVVQAERLDGTVLLAGCDKSIPGMLMAAARLDLASVFL
FT                   YNGSIMPGVAKLTDGSEREVTIIDAFEAVGACARGLMSREDVDIIERAICPGEGACGGM
FT                   YTANTMASAAEALGMSLPGSASPVAIDKRRDEYARKSGEAVVEMLRRGITARDILTKEA
FT                   FENAIAVVMAFGGSTNAVLHLLAIAWEANVKLTLEDFTRVGQKVPHLADVKPFGRHVMK
FT                   HVDEIGGVPVVMKALLDAGLLHGDCLTITGETMAENLAHIEPPDPDGKVLRAMNNPIHP
FT                   TGGITILHGSLAPEGAVVKSAGFDSDVFEGTARVFERERAALDALEDGTITHGDVVVIR
FT                   YEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDGGPI
FT                   AFVRDGDRIRLDVAKGTLDLLVDEAEFESRKAGFEPLPPVYTTGVLAKYTKLVGSAAVG
FT                   AVCG"
FT   gene            163753..164361
FT                   /locus_tag="Mmcs_0147"
FT   CDS_pept        163753..164361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0147"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   nfa:nfa38100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06268"
FT                   /protein_id="ABG06268.1"
FT                   /translation="MTSRALRPLALSAALLTALFLSACTSTEQPQSEGSTSHAHSETAG
FT                   DAHAPHNADDVAFARDMMPHHQQALQLVDLARDRSSDPALQGIASAIAAAQGPEMDQLA
FT                   GMLRGWGQDPEAGMHHGGHGMAMPGMVDDATMKRLESLRGAEFDRLWLESMISHHQGAV
FT                   EMAKAEIANGDNADAKAMAEHIIEAQEAEIAQMKQMLEG"
FT   sig_peptide     163753..163824
FT                   /locus_tag="Mmcs_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.638 at
FT                   residue 24"
FT   gene            164364..164675
FT                   /locus_tag="Mmcs_0148"
FT   CDS_pept        164364..164675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0148"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   mpa:MAP3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06269"
FT                   /protein_id="ABG06269.1"
FT                   /translation="MSTGAPEDVAVHGYSAQKENYAKRLRRIEGQVRGIAKMIEDDKYC
FT                   IDVLTQISAVNSALQSVALGLLDEHLGHCVTQAVAEGGEQADAKLAEASAAIARLVRS"
FT   gene            164703..165200
FT                   /locus_tag="Mmcs_0149"
FT   CDS_pept        164703..165200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0149"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa28900 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06270"
FT                   /protein_id="ABG06270.1"
FT                   /translation="MLPASVEHLTALRDDRTAFGELLGCAVPDGWPEFPESIEFTIGQL
FT                   TEHPHQAGWWMHFFLADGGAVLVGSGGFVGPPQDGVVEIGYEIAPEFRGRGYATAAARA
FT                   MIDKAKTATARLTTVVAHTLAHENPSTAVLRRLGFIRVAEIEDSDDGPLWRWEVAVPAG
FT                   AR"
FT   gene            165208..166410
FT                   /locus_tag="Mmcs_0150"
FT   CDS_pept        165208..166410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0150"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mtc:MT0201 sugar transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06271"
FT                   /protein_id="ABG06271.1"
FT                   /translation="MTRAWTPRVAGQLTVLAAAAFVYVTAEVLPIGALPAIAADLRVSE
FT                   ALVGTLLAGYALVAAVTTMPLVRLTASWPRRRTLLLTLVCLTASQAVCALAPNFAVLAG
FT                   GRVMCALTHGLMWSVIAPIGVRLVPADHAARATTAVYAGTGLALVVGNPLTAAMSQLWG
FT                   WRTAVVVVTAAAATVTVAAWRALPPMRSPANVATRVAPRPRNPRLVTLAALTLLGVTGH
FT                   FMAYTFVVVVIRDVVGVPGAQSAWLLAAFGVAGLVGMAALARPGDRRPHLAVVGCLAVM
FT                   VLSFGVLTGLAAGHRTGLLVLGVGALAVVAWGAASTAVPPMLQAAVMRTAPEDPDGASG
FT                   VYVAAFQIGIVAGALGGGLLYERAGAGLVLAGSTAVTAVVLACVLRRSDLLRAPATVSE
FT                   R"
FT   sig_peptide     165208..165288
FT                   /locus_tag="Mmcs_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.921 at
FT                   residue 27"
FT   gene            166487..167473
FT                   /locus_tag="Mmcs_0151"
FT   CDS_pept        166487..167473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0151"
FT                   /product="peptidoglycan transpeptidase precursor,
FT                   ErfK-YbiS-YhnG family"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG; KEGG: mbo:Mb0198
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06272"
FT                   /protein_id="ABG06272.1"
FT                   /translation="MPQQTMRKLTTAIFAAGLFGGLVLSAAPALAQPAPPPPPPAPVDP
FT                   FAPPPPPANPFAFPAPAAADPFAPTAQPLPIPEGTPAGQNPTPYVGKPVFAPPTFNPVN
FT                   GSIAGAAKPIYIDFQRPIANRALAEQAIHISSNPPVPGRFYWTSDTQVRWRPQDFWPAG
FT                   TVVNIDASGTKSSFTVPEQLVATIDNKSLQMEIHRNGELVKTFPVSMGKKGYDTKNGTY
FT                   YVLEKFADIVMDSSTYGVPVDDPSGEGYKLKVQDAVRIDNSGVFVHSAPWSVGSQGESN
FT                   VSHGCINLSPANAQWFFDNFGSGDAVVIKNSTGIYNQPDGASDWQMF"
FT   sig_peptide     166487..166582
FT                   /locus_tag="Mmcs_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            167572..168534
FT                   /locus_tag="Mmcs_0152"
FT   CDS_pept        167572..168534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb3191c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06273"
FT                   /protein_id="ABG06273.1"
FT                   /translation="MPGADKATARTVTVIVLILLAGVALRGRIPGAEPAADEPTDSGPG
FT                   SLIAVLVMLGLSMAVIAVSVVSQARHPVTRPGTAADPPRFRGGDGARFTWRMVLVMVGA
FT                   LLVWLLVVLTLMRISGWLDVSVDPPAAPSPDPDPGSSSAADSEPPPPPPDSEPPVSNAV
FT                   LGYFAAAAALFVLLSVIGVMAGRNARRRPATVVATDDEGDGDAPSTSRTQSLARAAERG
FT                   LIEIGDLSREPREAIIACYAAMERELGKSPGAMPQDSDTPTEVLARAVDRRLLHGESAT
FT                   ELVDLFEEARFSAHVMGEDHRDAAVRVLRLVLRELQDAA"
FT   gene            168531..169016
FT                   /locus_tag="Mmcs_0153"
FT   CDS_pept        168531..169016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3219c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06274"
FT                   /protein_id="ABG06274.1"
FT                   /translation="MTRAVAAAMLMLVAVEIYAVVRLDRDDVLTVSAVMLAGALIAARF
FT                   ALRGEVAPASTATDADERGAALRRWVDRTETMIGWSEASRADWDGRLRPLLARQFELAT
FT                   GQRKARDARAFHATGQMLFGPELWQWVDPENVSRTGADEPGPGREALGEILRRLERV"
FT   sig_peptide     168531..168590
FT                   /locus_tag="Mmcs_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.686) with cleavage site probability 0.660 at
FT                   residue 20"
FT   gene            169027..169989
FT                   /locus_tag="Mmcs_0154"
FT   CDS_pept        169027..169989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0154"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3 ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mpa:MAP3218c MoxR3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06275"
FT                   /protein_id="ABG06275.1"
FT                   /translation="MNMPATTTTAHCEAVLDEIGEVVVGKRRALALILTAVLARGHILI
FT                   EDLPGLGKTLIARSFAAALGLQFTRVQFTPDLLPADLLGSTIYDMHSGRFEFRHGPIFT
FT                   NLLLADEINRTPPKTQAALLEAMAERQVSIDGVTHPLPTPFLVLATDNPIEYEGTYPLP
FT                   EAQLDRFAIRLELRYLSGPDEVTMLRRRLDRGSAAPTVQQVVDGDGLLAMQESVEQVTV
FT                   HEDVLQYVVSLAAASRQHPQVAVGVSPRAELDLVQLSRARALLAGRDFVIPEDVKSLAV
FT                   PALAHRISLRPEMWVRRVQGADVVEELLRRLPVPRTGNP"
FT   gene            169989..171215
FT                   /locus_tag="Mmcs_0155"
FT   CDS_pept        169989..171215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0155"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mtc:MT3252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06276"
FT                   /protein_id="ABG06276.1"
FT                   /translation="MYDVELHWRASPLARALATCAAVGLAAALFTLRWELVAFVAPMLG
FT                   VLCSVGWQPRPPGVSVSTSTPLQRCFETEPSTVDIRAVADDGSDVTMTPSTLDGADLAT
FT                   AADGTGATVTLTAARWGRYPVRANVRVAGRGGLLEGTGSVDAAHVCVFPLAAPQSVSVP
FT                   RTDLLDRLGTHLTRHIGPGVEYADIRGYVPGDHLRTVNWSVSARRRSLHVTQRLTDRSA
FT                   DVVVLVDTYAQPPGPATAATERIARGAVQVVQSALRYGDRAGLVTLGSRRTRWLGADIG
FT                   QRQFYRILDVLLAAGDFDATTGSLAPQAAVPPGAIVVAFSTMLETEFALALIDLRKRGH
FT                   TVIAVDVLEGSPLDGDRDPLIDRMWALQRSFMYRDMGTIGVDVVSWPADATLDQAMALT
FT                   RHRRTGARR"
FT   gene            171212..171682
FT                   /locus_tag="Mmcs_0156"
FT   CDS_pept        171212..171682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT3251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06277"
FT                   /protein_id="ABG06277.1"
FT                   /translation="MKALLPSVFGVLMVAAVGYRADGPALVTAVAALVAVTVSVWWRPA
FT                   AVVAVVLTVSAVVLAPSAPMSTALAGLAAAAYLVLRHNSGHGEARATPPTMVAAVAFAL
FT                   TATAVVALPVDIPWLPLAAPVALLVGYVLTLRPFSDFGVLGRAQHDPARRNP"
FT   sig_peptide     171212..171277
FT                   /locus_tag="Mmcs_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.760) with cleavage site probability 0.700 at
FT                   residue 22"
FT   gene            complement(171679..173697)
FT                   /locus_tag="Mmcs_0157"
FT   CDS_pept        complement(171679..173697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0157"
FT                   /product="endothelin-converting enzyme, Metallo peptidase,
FT                   MEROPS family M13"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin peptidase M13; KEGG:
FT                   mbo:Mb0204c probable zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06278"
FT                   /protein_id="ABG06278.1"
FT                   /translation="MRFWQHVGVTVEATIKSGIDLSYLDTAARPQDDLFGHVNGRWLAD
FT                   YEIPADRAADGAFRTLYDRAEEQIRDIITEAADANAADGTDEQRIGDLYASFLDEATVA
FT                   RIGVQPLLDELALVDAADSPDALAAVLGGLQRTGVGGGAGVYVDTDSKNSTRYLLHFSQ
FT                   SGIGLPDESYFRDEQHAEILAAYPGHIAAMFALVYGGDHTQTAERIVALERKLAAAHWD
FT                   VVKRRDADLTYNLRTFADLSAEAPGFDWAGWVTALGTTPESVAEVVVRQPDYLTEFAAA
FT                   WSSEPLEDWKHWVRWRLIHARAFLLTDELVAEDFAFYGRLLSGTEQIRDRWKRGVSVVE
FT                   NLMGEALGKLYVQRHFPPNAKARMDELVANLREAYRVSINRLEWMTPETREKALAKLDK
FT                   FTPKIGYPVRWKDYSQLVIRRDDLYGNYRRGYQLASDREVQKLGGPVDRDEWFMTPQTV
FT                   NAYYNPGMNEIVFPAAILQPPFFDADADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDG
FT                   NLVDWWTDADRTEFGARTKALIEQYEQYTPRELEGQNGHHDAHVNGAFTVGENIGDLGG
FT                   LSIALLAYELSLKGEPAPVIDGLTGVQRVFFGWAQVWRTKYRSAEAIRRLATDPHSPPE
FT                   FRCNGVIRNLDAFYEAFEVGADDALYLEPERRVRIWN"
FT   gene            173714..174328
FT                   /locus_tag="Mmcs_0158"
FT   CDS_pept        173714..174328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mle:ML2614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06279"
FT                   /protein_id="ABG06279.1"
FT                   /translation="MPDELTDERADAAESADGRVLTGFGVASAVLAALSVAAVVLAVMI
FT                   WSGHREASAERAYQTRVLQAAADWTSVLVNMNKDSVDASMQRLHENTIGDLNADFDSAV
FT                   EPYRQLVQRLQTRTRGQVDSVSIESLHHPVPGPDGGPALAPPPDPQLSAFASRTDTVLV
FT                   VATSISDNVGNKEPQTVRWTLRLDVSDVDGKLMISRLEPIR"
FT   gene            174325..175014
FT                   /locus_tag="Mmcs_0159"
FT   CDS_pept        174325..175014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0159"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mbo:Mb0206 possible conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06280"
FT                   /protein_id="ABG06280.1"
FT                   /translation="MRNRLRVLVFDILAPVAAIAGLLYIGLALGWPLWWVSVCSVLCLL
FT                   IVQGVIVNVALMRRDGVTVGTDDDGPGLRLAVMGLATVAVVAAVALGYQRWTVPDRAFT
FT                   ADSAEVVRIASSVSEATATFSPQSPTASIDRAAAQMVPERAQAFKDEFAGVAKQLTSKN
FT                   VSAQASTVSAGVEAIGPEAASVAVVLRGTQSVPGQPVDNAVLALRVTLSKTDGRWMVDD
FT                   VTPIHAR"
FT   sig_peptide     174325..174417
FT                   /locus_tag="Mmcs_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.927) with cleavage site probability 0.910 at
FT                   residue 31"
FT   gene            complement(175063..175482)
FT                   /locus_tag="Mmcs_0160"
FT   CDS_pept        complement(175063..175482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0160"
FT                   /product="CoA-binding protein"
FT                   /note="PFAM: CoA-binding; KEGG: mag:amb2851 protein YccU"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06281"
FT                   /protein_id="ABG06281.1"
FT                   /translation="MTEWIEPEHDDLRRIMRETRTVAVVGASPNPMRPSYGVWDYLRSA
FT                   SHYELYLVNPTVSEIDGTPVYPSLADLPVVPDMVDVFRRSSELPGVLRDTISVGAKTLW
FT                   LQQGLWDEQIARDGVAAGLEVVMDRCLKVDYARLL"
FT   gene            complement(175511..176041)
FT                   /locus_tag="Mmcs_0161"
FT   CDS_pept        complement(175511..176041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mle:ML2616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06282"
FT                   /protein_id="ABG06282.1"
FT                   /translation="MTLTSDARGTRRDAATAATRPLTAASRRASIDDRPVEFWSTAAIR
FT                   DALETDDLTVWQRIVTAIKRDPYGRTARQVEEVLEKAKPYGVSKALAEVLVRTREQMAA
FT                   AERAEVGHHVQLLLNRSGLGAPEFASRIGVGVDEFQSYIDGEVSPSASLMIRMGRLSER
FT                   FAKIRAQRANNPR"
FT   gene            complement(176038..178989)
FT                   /locus_tag="Mmcs_0162"
FT   CDS_pept        complement(176038..178989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0162"
FT                   /product="MmpL11"
FT                   /note="KEGG: mpa:MAP3637c MmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06283"
FT                   /protein_id="ABG06283.1"
FT                   /translation="MMRLSGTLRRFRWAVFGAWVLLLVPAIYLALNHSSNLTGGGFEVE
FT                   ASQSLHVQYELEDHFPDQGASPLALVAAPRADASYDDMNAAVAHLEQIATQVPSVKISP
FT                   NPQQPPPQPDRPYVITLSLDFNNTGATDVAKDLRTRVGIDGEEPGEFRDGKVKMYVIGQ
FT                   GALGAAASQAIKTDVAQAEQWNLPIVLIVLLAVFGSFAAAAMPLLLGVCTVAVTMGLVY
FT                   LLSTITTMSVFVASTVSMFGIALAVDYSLFILMRFREELRAGRDAQQAADAAMATSGLA
FT                   VLLSGMTVIASVTGIYLINTPVLTSMATGAILAVAVAVLTSTTLTPAVLATFGRAAAKR
FT                   SSYLHFSRRPDTTQSRFWTRWTGWVMRRPWVAATSAALVLLTMAAPAFMMELGNSMQRQ
FT                   FEPTHEVRGGVNAAAEALGPGALGPVRVLVTFPDGNPASAAAKEPTLEAVRAEMSKAPN
FT                   VATVTPAEFGDDYRSALLSAVLTVDPEDKGARETVDWMRANLPSTAGPNVSVDVGGPTA
FT                   LIKDFDDRVSATQPLVFGFVALIAFLMLLISIRSVVLALKGVLMTVLSVAAAYGSLVAV
FT                   FQWGWLEPLGFEPIPSLDSTIPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGNTRDAVA
FT                   YGVSTSARTITSAALIMIAVFIGFAFAGMPLVAQLGVACAVAIAVDATIVRLVLVPALM
FT                   AMFDRWNWWLPKWLDRVLPSVDFEKPLPKVQIDDLVIIPDDISALGPSGADLRGMVKSA
FT                   ARMKTLAPQTVTVADPLAFSGCQPIKQRMVARNGGDQTVKLRTGAGLWRGGRNGHGDGN
FT                   GSTVRTTLPVHPVTLWRGRLSVALDALETAQQTEAETDRAPVERRTPVETTNVQLPTGD
FT                   RLQIPTGAETLRLKSYLIMCRNSSRDYAEFAELVESMETQTAAIVLSGMDRYYCGQQPK
FT                   KQWVATQLVRRLADPQPSDEHDAAISDPDAESDWALVRQRCLSVAVAMLEEAR"
FT   gene            179315..179803
FT                   /locus_tag="Mmcs_0163"
FT   CDS_pept        179315..179803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06284"
FT                   /protein_id="ABG06284.1"
FT                   /translation="MRSITLGRHRLGRSVCAAFAVTAAGGVAAAALTMPATPATAAPDP
FT                   CAASQVAKTVAAVATNTSNYLAANPETDQALTTIAQQQAGPASLASLKAYLDANPQVGS
FT                   DMQKLQQPLTNLSGRCKLPVTIPQVLGLMQAAQQSGAAQPAAPAAASPVSPAAATGHR"
FT   sig_peptide     179315..179440
FT                   /locus_tag="Mmcs_0163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 42"
FT   gene            179942..180340
FT                   /locus_tag="Mmcs_0164"
FT   CDS_pept        179942..180340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP1972c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06285"
FT                   /protein_id="ABG06285.1"
FT                   /translation="MLLPARTARRVVVGAAGAGAIAGAMLFGAVPAMAQPAPPPPLPPN
FT                   CTAADLAGVASGVSASTSAYLFTHPPVNDFFTSLEGQSRDQIRPQVEEYLNANPQVKAD
FT                   LTGIRQPLVDLKTRCGTATPPEDDVDTP"
FT   sig_peptide     179942..180046
FT                   /locus_tag="Mmcs_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            180346..181077
FT                   /locus_tag="Mmcs_0165"
FT   CDS_pept        180346..181077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0165"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: nfa:nfa6640 putative
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06286"
FT                   /protein_id="ABG06286.1"
FT                   /translation="MRAETGEPEPAAQDTPGRTVLMVDDDPDVRTSVARGLRHSGFDVR
FT                   VAANGKEALRLLSAESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARDTVNDR
FT                   IAGLEAGADDYLTKPFDLGELVARLHALLRRAHHSDRPSDTMTVGPLTIDTARRLVFVD
FT                   GERVDLTKREFDLLAVLAENNGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLER
FT                   DGLPRVIHTVRGIGYVLRDEP"
FT   gene            181082..182419
FT                   /locus_tag="Mmcs_0166"
FT   CDS_pept        181082..182419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0166"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like; KEGG:
FT                   nfa:nfa6630 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06287"
FT                   /protein_id="ABG06287.1"
FT                   /translation="MWLPRLFRSTSLRTRVAVASAAAASAVVAAFTILTSVVLASNDDA
FT                   QLDRRLDSIVDASMYPEQLQDPRRGVLTTGRDRSTGQVVFQRGFQLPKLPPGTETVEVN
FT                   GVDYRVRTLVVDQEGGVLVSIGIRADSILLSRGRIPEYVLVGLVTVLIAGGLGWVLAGP
FT                   AIRPLRKLTEQTSKLSTGTDEMPEVRGAREAEELSAAMSAMLRRLAAAQQATTNSLQAA
FT                   QDFAANAAHELRTPLTAMRADLDTLRIHDLPEDERAEVVADLSRAQRRVEAIITALGQL
FT                   ASGQLAQAADREPIDITDTLDRVARENMRSAPQVDIQVDAEDLGTVWGLPDGLRLAVDN
FT                   LVRNAITHGGAGRVVLTARRTDGWLTIVVDDDGRGLPAEEHEMVLGRFRRGSTAAPGGS
FT                   GLGLALVAQQAELHGGTIELADSPLGGLRATLTVSTSTTGGDPQLR"
FT   sig_peptide     181082..181204
FT                   /locus_tag="Mmcs_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.828 at
FT                   residue 41"
FT   gene            complement(182407..182790)
FT                   /locus_tag="Mmcs_0167"
FT   CDS_pept        complement(182407..182790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0167"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mbo:Mb0407 probable conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06288"
FT                   /protein_id="ABG06288.1"
FT                   /translation="MPTVDRRTAALALLADLVCVVVFCTIGRRSHAEGLTVAGIAETAW
FT                   PFLAGTAVGWLAARAWRRPLSLTPTGVLVWVCTVTVGMVLRKLSGQGVAVSFVIVASLV
FT                   TALLLLGWRGVATALRHKQIQRS"
FT   gene            complement(182850..183986)
FT                   /locus_tag="Mmcs_0168"
FT   CDS_pept        complement(182850..183986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0168"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mpa:MAP3639c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06289"
FT                   /protein_id="ABG06289.1"
FT                   /translation="MSHDATANDAKRGRADPDGSTRGKYWWVRWAIITVAVVVLTVEVV
FT                   LVWDQLAKAWKSLVSANWWWVVAAVVASLASMHSFAQIQRTLLRSAGVHLKQWRSEAAY
FT                   YAGNALSTTMPGGPVLSATFLYRQQRLWGASPVVASWQLVMSGVLQGVGLALLGLGGAF
FT                   MLGASKNPLSLIFTLGGFAALLVLAQAVASRPELIDGIGARLLARFNSLRNKPLDTGLA
FT                   KWRELLRQLESVQLGRRDLSMAFGWSLFNWIADVACLAFACYAAGGHPSLAGLTVAYAA
FT                   ARAVGTIPLMPGGLLVVEAVLVPGLVSSGMTLAGAISAMLIYRLVSWIFLAAIGWVVFF
FT                   FVFRTEKDIDPDAPVKGAHKAGEPIRNQPPRSAREDLG"
FT   gene            184106..185251
FT                   /locus_tag="Mmcs_0169"
FT   CDS_pept        184106..185251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0169"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mpa:MAP3640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06290"
FT                   /protein_id="ABG06290.1"
FT                   /translation="MSDGVSLEDQSVSPLVRKAAAWSWRLLIIFGALVAVLWLVARLEI
FT                   IVVPVALATMLAALLMPAVDFLDRRGAPRGGAVALVLLSGIAVVGGILTFVVSQFVEGM
FT                   PALGEQVTRSIDGMRRWLVEGPLDLSREQIDNAGNAAIEAVRNNQERLTSGALSTAGTI
FT                   TEIVTGALLVLFTLIFLLHGGRNIFGFITKVFPPDVRDRVRGAGRAGFHSLIGYVRATF
FT                   LVALVDAIGIGTGLAIMSVPLALPLASLVFLGAFVPLVGAVVTGFLAVIVALLTKGLVY
FT                   ALITLGLILAVQQLEGHVLQPLVMGRAVSIHPLAVVLAIAGGGVLAGIVGALLAVPAVA
FT                   FLNSAIRVLLARDQSAAVENLEADEGPRIQAEPDDVEEKVD"
FT   gene            complement(185252..186580)
FT                   /locus_tag="Mmcs_0170"
FT   CDS_pept        complement(185252..186580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0170"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: protein of unknown function DUF222; SMART: HNH
FT                   nuclease; KEGG: mpa:MAP2495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06291"
FT                   /protein_id="ABG06291.1"
FT                   /translation="MDGLSGAVDHLVASIAAMQTASIDELSHEQIVAELDRIKAAVWAV
FT                   PSVEHRLTARLMDADPHELGATSLKRLLADRLRISDKTAGERLTDARQLGPRHTLTGER
FT                   VQTELAHTADAVARGDIGTAHVRIIQDFVKKLPAWVSWDRREDYERDLVGHAVALRPED
FT                   FRKVADTLLGFIDQDGTEPDHHTHQRRREFTVGRQQADGMSRVQGWLTPEARAYWDVIA
FT                   AKYAAPGTSVPHDDAVTGRDDRTTGQRHHDALTRAMRHTVESGSLGHVAGVPATIVATT
FT                   TINELERAAGWAHTGGGNRLPIRDLIRMAAESRHYLAVFDDHTEEILYLGRAKRCATTA
FT                   QRLALFARDKGCTHPHCTVPFYWTEAHHTRDYAQGGCTDIDDLTLACQPANLLIEKTGW
FT                   TTHRPGNGRTQWTPPTNQDTGQPRINHHFHPQRYLTDNDDEPG"
FT   gene            complement(186760..190041)
FT                   /locus_tag="Mmcs_0171"
FT   CDS_pept        complement(186760..190041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0171"
FT                   /product="drug exporters of the RND superfamily-like
FT                   protein"
FT                   /note="KEGG: mtu:Rv0206c conserved large membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06292"
FT                   /protein_id="ABG06292.1"
FT                   /translation="MFAWWGRNVYRYRYIVIGVMVALCIGGGIYGISLGNNVTQSGFYD
FT                   EGSQSVQASVAGDEVYGRDRTSHVVAILTPPDGEKVDNPEWQREVVGELDALVKDHPDQ
FT                   VVSWVGWLRAPDAASATVQQMKTEDLSKTFVSVPLKGDTDDEILKNYQVIEPDLQEIND
FT                   GNIQLAGLNPLASELTGSIGEDQKRAEVAAIPLVCVVLFFVFGGVIAAALPGLIGGLTI
FT                   AGALGIMRLLAEIMPVHFFAQPVVTLMGLGIAVDYGLFMVSRFREELAEGYDTEAAVRR
FT                   TVMTSGRTIMFSAVILVASSVPLLLFPQGFLKSITYAIIASVMLAAVLSITVLAAALAI
FT                   LGPRVDALGVKTLIKFAEPDPISSDPAVQKTNTFAIASIPLGLLVPPVGIALGHIARKR
FT                   IKQTGEQGANLALIGLVLGYTVLYGAMAYGVIALKDNGTIGSGVYWMLLGIVAFLVIVT
FT                   FGLTLARYVPLARRPIVWWLHWLAEKTQKTKTRAEVEQGFWGKLVTHVMKRPGTFAFPI
FT                   IVVMILLIIPLGQLSLGGISEKYLPPDNSVRQAQEDFDRSFPGFRTEPLTIVLKSDNGD
FT                   PVTDQQVADIRAKAMSISGFIDPDNDPSKMWQERSVQEGGSEDPSVRVIQNGLENRNDA
FT                   ATKIEELRALSPPRGVSVWVGGTPALEQDSIHSLFDRLPLMVTILIVTTTILMFLAFGS
FT                   LVLPIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLIIAVIWGLST
FT                   DYEVFLVSRMVEARARGLSTAEAIRVGTATTGRLITGAALVLAVVAGAFVFSDLVMMKY
FT                   LAFGLLLALLLDATIIRMFLVPAIMKMLGDDCWWAPRWMKRLQERLGLGEVELPDERKR
FT                   PLVRDPSEDQALVGAGAPVPPRPRPPHDPTHPGVEGRVGPTRIPPGPPRLNGPSVAGTS
FT                   RIPTNRPAPGHEPPTTRLSMAKNAVRGAVNTATTPRAPRPTGPAPKREEREIESWLGEL
FT                   RGGPAGPGGGQPPRPPQPSAEPTTAMRAGAPRPEPEPEGNEPTTAIPVQRPPQPEESDA
FT                   TTKIPTQQDAGTDSASTEKLNAPEEQKRRGGGMSAAELLRREGRM"
FT   gene            complement(190088..190786)
FT                   /locus_tag="Mmcs_0172"
FT   CDS_pept        complement(190088..190786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3642c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06293"
FT                   /protein_id="ABG06293.1"
FT                   /translation="MSVTEDLPQEIPQVTPPPPPAGPPAGTQRVLLVWDAPNLDMGLGS
FT                   IIGGRPTAAHRPRFDALGRWLLGRTADLSAGREDVTLEPEATVFTNIAPGSADVVRPWV
FT                   EALRNVGFAVFAKPKIDEDSDVDSDMLDHIALRRREGLAAVLVASADGQAFRLPLEEIA
FT                   REGIPVQVLGFREHASWALASDTLEFVDLEDIPGVFREPLPRIGLDSLPEQGAWLQPFR
FT                   PLSALLTSRV"
FT   gene            complement(190783..191610)
FT                   /locus_tag="Mmcs_0173"
FT   CDS_pept        complement(190783..191610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0173"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: mpa:MAP3643c tRNA
FT                   (guanine-N7-)-methyltransferase; TIGRFAM: conserved
FT                   hypothetical protein; PFAM: putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06294"
FT                   /db_xref="GOA:Q1BFP0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BFP0"
FT                   /protein_id="ABG06294.1"
FT                   /translation="MRHHGRMHARESDVAGGPARDSAGGPARDSAGGPARDSAGDDSPS
FT                   AHRHRRVTSFRSRRSALSGGQQDTWERLWPELGTEARDDDGRPAALIDTAAWFGRTAPL
FT                   VLEIGSGTGTSTLAMAQDEPDIDVIAVEVYRRGLAQLLTGIDRAGVRNIRMIRGDGVDV
FT                   LEYMVASGSLTGVRVFFPDPWPKARHHKRRLLQPSTVALIADRLRPGGILHAATDHAGY
FT                   AEQIAAVGDAEPLLRRVDLTDDLPISVRRPVTKYERKALAGPDVAELLWEKVP"
FT   gene            191705..192715
FT                   /locus_tag="Mmcs_0174"
FT   CDS_pept        191705..192715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06295"
FT                   /protein_id="ABG06295.1"
FT                   /translation="MPRFPRDPTRREGATIFVPDFDDVLTRFAQECGDAAVAAVAARLA
FT                   APLRVAVTGRAGVGRTTLARALARDGRRVAEHTPDVAVVVVAEAVKPEDVASVAGWRDA
FT                   DVPVVVVGNKADLTGPIPPDALRRYRSGEHGDVPVESVVALLAVVSLDDDALGALQLLA
FT                   AQPAELRSANAFLDAAHPLPRDVRMRLLRTLGLRGVEHSVRALRDGADPHDLPTLLREV
FT                   SGFDRVLDRLDALAAPARYDRIRAALAELQGRAAGDDRIAAFLADDDTVLAVMTAAVDV
FT                   VQAAGLAVDPGDDAATHLRRAVWWRGYSRGPVSPLHRACGADIARGSLRLFERRR"
FT   gene            192712..194205
FT                   /locus_tag="Mmcs_0175"
FT   CDS_pept        192712..194205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06296"
FT                   /protein_id="ABG06296.1"
FT                   /translation="MSAASDPVAAADAVVAAVDPALDSPGVQSSDSVLVTGPWLAGVSS
FT                   LIAVLRDRLPEVSFVEADELPAGSAPVAVVFAVSAVSALAGSDCELLDLAADHTDCVIG
FT                   VVTKIDVHLDWREVMAADRELLGAHRRRYAALPWVGVAAAPDDGDPMVDDLVDLLRDTL
FT                   GDPEVLRRNRLRAWESQLEKVVARYRADGEGADRHARVSALRAQRDEIRRARRVEKSQR
FT                   AIALRSQIQQARVQLTYFARNRCASVRGELQEDIAELGRRRLDAFEQTVRGRAAEVMTE
FT                   VDEGVTTHLTAVAADLHLDDVPPPPQPIPVPDLPGPSLRSRRLETRLMMLLGAGFGLGV
FT                   ALAVSRLFSGVDPGLTVAGVLAGAAAGLAVAVWVVGIRGLLHDRGVLDRWVADVTATLR
FT                   SAAEEAVATRVLAAEAALTAALAAEEEADADAAAVRIAEIDAELREHAAATARAAALRD
FT                   RRLPGLQRALEAVCAELYDKKADEFTEANERNSGKNVGY"
FT   gene            194404..196233
FT                   /locus_tag="Mmcs_0176"
FT   CDS_pept        194404..196233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0176"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   mbo:Mb0217 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06297"
FT                   /db_xref="GOA:Q1BFN7"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BFN7"
FT                   /protein_id="ABG06297.1"
FT                   /translation="MTSATIPGLDTAPTEHEGLLAWVREVAELTQPDRVVFTDGSEEEC
FT                   ARLTEQLCEAGTFQKLNEEKKPNSYLALSDPSDVARVESRTYICSEREIDAGPTNNWMD
FT                   PAEMRGIMTDLYRGSMRGRTMYVVPFCMGPLEAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   QAALDKMGTDGFFVKALHSLGAPLEPGEKDVPWPCNDTKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYFIAAAFPSACGKTNLAML
FT                   QPTIPGWRAETVGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWSSNPNAMKTIEAGN
FT                   TVFTNVAKTDDGDVWWEGLEGEPDHLIDWKGNDYILRETETKAAHPNSRYCTPISQCPT
FT                   LAPEWDDPQGVPISAILFGGRRKTTVPLITQARDWQHGVFIGATLGSEQTAAAEGKVGT
FT                   VRRDPMAMLPFLGYNVGDYFQHWIDIGKNADESKMPAVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWAIERIEHKADGRSTPIGIVPTAQDLDLEGLDVDPEDVDAALAVKPEEWRQEL
FT                   PLIEEWFEFVGEKLPTGIRDEFDALKHRLAEEA"
FT   gene            196381..197901
FT                   /locus_tag="Mmcs_0177"
FT   CDS_pept        196381..197901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0177"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpa:MAP3649 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06298"
FT                   /protein_id="ABG06298.1"
FT                   /translation="MQIRDTAVATPDKPAIIMYPSGTVVTFGELEARANRLAHLFRDAG
FT                   LVEGDAVAILMENNEHIHAVMWAARRSGLYYVPINTHLTAAEVAYIVDNSGAKAIVGSG
FT                   KLADTLAGLEAELPHGLPPVRLIAGAQLDGWQSYPDCVADKPDTPIADEIEGDLLQYSS
FT                   GTTVRPKGIKRELPHVPPSESPGMMAALVSFWMHPDAVYLSPAPLYHTAPSVWSMQTQA
FT                   GGITTVVMEKFDAEGALDAIAKYKVTHGQFVPVMFTRMLKLPEDVRKSYDVSSLERVMH
FT                   AAAPCPVEIKKQMIDWWGPIVDEYYASSEAHGSTLITAEEWLTHPGSVGRPLTGVLHIV
FT                   GEDGNELPPGQAGEIYFEGGYDFEYLNDPEKTASSRHPLGWKTVGDIGYLDEEGYLYLT
FT                   DRRHHMIISGGVNIYPQEAENMLITHPKVMDAAVFGVPDDEMGQSVRAVVQTVDPADAT
FT                   DAFAEELISWLRDRLAHYKCPRSLSFEPQLPRTDTGKLYKQELIKKYS"
FT   gene            197910..198785
FT                   /locus_tag="Mmcs_0178"
FT   CDS_pept        197910..198785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0178"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mpa:MAP3650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06299"
FT                   /protein_id="ABG06299.1"
FT                   /translation="MELAGGIRVAVETPCDDASFTLTEAPSDDPRLVTVASVADTLAEL
FT                   DERCRRWPQAAAVCDDVLRSFDPARSTFAGVITESLAYSTLQSGPEFGRWLAERGSAQA
FT                   PETANPVVAERNDGRLTVRFNRPDRHNAFSTGARAALLEALEVARLDPSVDEVVLSGVG
FT                   RSFSSGGDLAEFGSFDDPASAHLARTRHSPALVLDEVTARLGRRCRAQVHGQVLGSGLE
FT                   MAAFCGWVVSSPDAVFGLPELTLGLIPGAGGTVSITRRIGRWRTGYLVLSGRTIDPSTA
FT                   LRWGLVDAVE"
FT   gene            complement(198940..199683)
FT                   /locus_tag="Mmcs_0179"
FT   CDS_pept        complement(198940..199683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0179"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: sco:SCO0522
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06300"
FT                   /protein_id="ABG06300.1"
FT                   /translation="MLGHMTDSKIILVTGASSGIGAAVATHLARAGHHVIAGARREDRL
FT                   RELADGAADLERGSLSVRRLDVTDRAEMAAFVDDAVSTHGRLDVLVNNAGIMPLSRLDA
FT                   LLVDQWDAMIDVNVRGLLNGIAAALPHFHRLGGGHFVTVASIGAHEVVPTSAVYSATKY
FT                   AAWAITEGLRQESDPSIRVTTVSPGVVESELASTITDPGAAAAMQEYRAAAITPDAIAR
FT                   AIAYAISEPEEVDVNEVIVRPARQR"
FT   gene            199725..200591
FT                   /locus_tag="Mmcs_0180"
FT   CDS_pept        199725..200591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0180"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: Helix-turn-helix type 3; KEGG: sco:SCO7706
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06301"
FT                   /protein_id="ABG06301.1"
FT                   /translation="MQHTQAPAPSRPYRGDMAELGDYLRSRRAQVQPRDAGLVATGTRR
FT                   VPGLRREEVAWLAGLSVDYYVRLEQGRERSPSAPVLDALAAALRLDHDGHRHLFRLAGL
FT                   APRLDVAKTPDRVDPALSRLMAAWPDNPALVYNRAYDVLAANPLAQALFGDFGAGENLM
FT                   LLAFGEPRAREFYVDWQDVAENAVAGFRLNHAAAPADPRVQAVLGELLNGSAEFRTLWE
FT                   RHDARGKSLTSKAFRHPEVGVLELTMQTFDVRSAPGQELVVYDAAPDSPSADALKLLGS
FT                   IAATAAT"
FT   gene            complement(200645..201247)
FT                   /locus_tag="Mmcs_0181"
FT   CDS_pept        complement(200645..201247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0181"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated; KEGG:
FT                   mbo:Mb0816c probable transcriptional regulatory protein
FT                   (probably GntR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06302"
FT                   /protein_id="ABG06302.1"
FT                   /translation="MRRAFQDLVAEGIVYRVPGRGTYARETGRYLRQLGSIEDLMSLSQ
FT                   DTTMEVLRGLTRRVDIQAASRLRLDDDVVHTVVFRRLHGPPGQGVPFVSTTVHLPPSIA
FT                   RHIAGDDALQTGAVSTHTVIGLLEPHLDAPIAQAAQSITVAPADEAVAGAVGCAPGHPM
FT                   LRVDRLYSDDADRPVELSVSHFLPEQYTYRVTLRRSG"
FT   gene            complement(201392..202549)
FT                   /locus_tag="Mmcs_0182"
FT   CDS_pept        complement(201392..202549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0182"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like Acyl-CoA
FT                   dehydrogenase, type 2-like; KEGG: mpa:MAP3651c acyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06303"
FT                   /protein_id="ABG06303.1"
FT                   /translation="MSRLSEEETMLVETVRAFVDRDVKPTVREVEHANEYPEAWIEQMK
FT                   RIGIYGLAIPESYGGSPVSTACYVEVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEEQ
FT                   KRTYLPGMATGEIRATMALTEPGGGSDLQNMTTTALPCEGDGLAVNGSKTWISNARRSG
FT                   LIALLCKTDPSATPRHKGISVVLVEQGTTGLSVSRDLPKLGYKGVESCELVFDDCRVPA
FT                   TAILGGEPGRGFAQMMKGLETGRIQVASRALGVATAALEDALRYAQERESFGQPIWKHQ
FT                   SIGNYLADMATKLTAARQLTRYAAERYDSGERADMEAGMAKLFASEVAMEIALNAVRIH
FT                   GGYGYSTEYDVERYFRDAPLMIVGEGTNEIQRNVIAAQLVARGGI"
FT   gene            202615..203610
FT                   /locus_tag="Mmcs_0183"
FT   CDS_pept        202615..203610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06304"
FT                   /protein_id="ABG06304.1"
FT                   /translation="MTLYGQIAGGPYFDDLTAGQVFDSAPTMTLSAGAAAVHQSILGDR
FT                   LRLALDGELAAAVTGSTAPLAHPALVCDVAIGQSTLVTQRVRANLFYRGLAFHRYPVLG
FT                   DSLFTRTEVVGLKQNSVKPGRPRTGLAALRMTTVDQLGRLVLDFHRCAMLPLRDGAADT
FT                   GHADDLSAIGADASAPEPTAEWDAQAWRTRVRSSFDAGLAGTVLHSTADVVTSAPELAR
FT                   LTLNIAATHHDSRVGGGRRLVYGGHTIGLALSQATRLLPNLATVLAWESCDHTGPVYEG
FT                   DTLYSALHVDGATPLPDGRGGVLKLRSLVYAVDDQDDRQVLDWKFSALHF"
FT   gene            203703..204809
FT                   /locus_tag="Mmcs_0184"
FT   CDS_pept        203703..204809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06305"
FT                   /protein_id="ABG06305.1"
FT                   /translation="MVSAFAIPAAVLTHAGRVAAGLPVGVDIPELLTGRAALLDLPAPG
FT                   RVSAGGASQLLRARDGWCALTLSRPDDLAAVPALLEADHIDVDPWRAIGDWLAACSADT
FT                   AVARARLLGMPAAMLVEAAPAQPVVQRITTQAPPRPWTDLLVIELASMWAGPLLGRMLV
FT                   RAGATVVKVESLARPDGTRRGSPEFFDWMNGGKHCITVDFDETTQLSALLAAADVVIEG
FT                   SRPAALARRGLGPDVVPAREGRVWVRITGHGTVGDRADWVAFGDDAAVAGGLVGAAADG
FT                   PVFVGDAIADPLTGLEAMHAVVESLHRGGGELVEVSMAAVAAGYAALPDEGTVEVAARA
FT                   PAPGPPAAHLGADNATVRAVVERRLAAC"
FT   sig_peptide     203703..203765
FT                   /locus_tag="Mmcs_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.835) with cleavage site probability 0.606 at
FT                   residue 21"
FT   gene            204803..206098
FT                   /locus_tag="Mmcs_0185"
FT   CDS_pept        204803..206098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0185"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mpa:MAP3654
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06306"
FT                   /protein_id="ABG06306.1"
FT                   /translation="MLIRRATLLDGTRVDIRAAERIGDVADSLVPERGETVLDAAGATV
FT                   IPGLHDHHVHVHAAAAALGSVRVGPADVGDRDGLLRALRSTTPGEDGWIRAVGYHEAVA
FT                   GPLDRALLDTLRPDVPVRVQHRSGVLWTLNSAGLTRLGLSGHPDGTLRSADGEWGAELE
FT                   RRQVPLGEFSRALARRGVTGITDATPDLDVTTVGDWSGEIVQRLHVLAPGKRILHDDAL
FT                   DLDELVAWMTDRHDGGTPVAVHCVTAAQLVVTIAALSIAGARPGDRIEHAAVVPDDCIP
FT                   DLVELGVTVVTQPNFVAERGDQYRADVPAPEHRELWRVGSLLKAHVRVAFSTDTPFGDG
FT                   DPWAAMRAAVHRLTPSGAPLGTTERVDAATALALFCGSADSPTTPRAVAPGEPGDLCIV
FT                   EGSPDEVLAELDGDRVRATIVGGEPVWGPGRA"
FT   gene            complement(206111..207046)
FT                   /locus_tag="Mmcs_0186"
FT   CDS_pept        complement(206111..207046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0186"
FT                   /product="Ion transport 2"
FT                   /note="PFAM: Ion transport 2; KEGG: dra:DR1911 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06307"
FT                   /protein_id="ABG06307.1"
FT                   /translation="MGFDGRDSDADTGPAVEETPYMEWTATVAGIALIAVIVRDVFHTL
FT                   FHPIGHGSIAPTVMKLIWRLLGLLPPQRRIASLTGPLGIAMVVLAWGVIAVAGWTLIYW
FT                   AQMPEGFAYGTELDPNERHDIVDSLYLSLVTIGTLGFGDVVPTSVTLRLAAPIEALFGF
FT                   MLLTAAVSWVLEIYPALHRRRVLALQLSTLRRAREGDPVLPIDSVPVEVLTSLAAGIVE
FT                   ARNDFTQYSATYYFRDLETDASLAASLEYATQLAAEAMASAQDHVRTAGRLMKIAVDSL
FT                   AELLDQEFLQLGGDTDAVVQAYAVDHRHIN"
FT   gene            complement(207093..209390)
FT                   /locus_tag="Mmcs_0187"
FT   CDS_pept        complement(207093..209390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0187"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mpa:MAP1643 socitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06308"
FT                   /protein_id="ABG06308.1"
FT                   /translation="MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQR
FT                   GTIPVDHTVAREAATAFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWA
FT                   TSAKGSTDEDPGPDLASYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPP
FT                   VDFRPFIIADADTGHGGDPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPS
FT                   DEQIKRLNTARFQLDIMGVPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYK
FT                   SCFLAMMRSFHDAGVTALNGHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGD
FT                   PSNDALYDDVESQFIAAWEEDAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRA
FT                   SLYTAGKKARELGVDVDWDCELAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKT
FT                   ADLADAREFAEAIHAEYPDKMLAYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFI
FT                   TYGGHQVDGVASEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLA
FT                   SSGRTATTKAMGKGSTQHQHLVQTEVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGG
FT                   EVLELGIYGERDGGEEKLADVLVDPIKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLW
FT                   LVHRFKADAVYYVTPTDDNVYQTEKMKSHGIFSDVHKDVGEIIVAEVNRARIEELLAPD
FT                   REALGRLIRKED"
FT   gene            209526..210314
FT                   /locus_tag="Mmcs_0188"
FT   CDS_pept        209526..210314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0188"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rso:RSc2321 probable dehydrogenase/reductase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06309"
FT                   /protein_id="ABG06309.1"
FT                   /translation="MKLTGYTALVTGASGGIGEEFATRLAADRVNLILVARRTERLEEL
FT                   RSRLLDRHPGIDIDVLSADLGVPGAAAALAQQVDALGRRVDVLINNAGIGLHGSFAEQD
FT                   PAANAAQIQLNCVTLVELTGCFLPAMIAAKRGVVLNVGSTAGFQPVPSMAVYGATKAFV
FT                   LSFSEALWQETRGSGVKVLTLCPGATETEFFDRTGKSFMTRGRQSSAQVVDTALKALDR
FT                   PFPTVVSGLHNRILALGYRIAPRPVLAMVSEQLMKARGQG"
FT   gene            complement(210311..211093)
FT                   /locus_tag="Mmcs_0189"
FT   CDS_pept        complement(210311..211093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0189"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH protein of
FT                   unknown function UPF0074 UbiC transcription
FT                   regulator-associated; KEGG: gka:GK2275 transcriptional
FT                   regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06310"
FT                   /protein_id="ABG06310.1"
FT                   /translation="MPTHSEELRRRIVADINAGIPGAKLGSERDLAERYGTSRSSLRQV
FT                   LAALEEAGMVHRVIGRAGGIFISHGQVERNLADVVGVPAFLANQGYVAGTRVLSTKIAP
FT                   VDDATQAALRLQPTDFVVEIQRLRLADGSPISLELAQFPADAFPGLLEQQLGGSIYEVL
FT                   ENRYGLVPGRADERIEAVNATTTEASLLGVKPKSALLLITRVTYDSDGTPCEFSRDLFR
FT                   GDRIYLAVTAQGRGIGKGLGSGPDTNTASVKLQSQLAV"
FT   gene            complement(211174..211953)
FT                   /locus_tag="Mmcs_0190"
FT   CDS_pept        complement(211174..211953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0190"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rru:Rru_A3017 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06311"
FT                   /protein_id="ABG06311.1"
FT                   /translation="MFTSLQGRSAIVTGGSKGIGRGIAAVFADAGVDVVVTGRNRADID
FT                   ATVADLGGKAGKVSGLAADVADPADCRRVVDTAVERHGGLDIVCANAGIFPSGRLEELT
FT                   PEDIEQVLSVNFKGTVYIVQAALSALAASGHGRVIVTSSITGPVTGYPGWSHYGASKSA
FT                   QLGFIRTAAMELAPKRITINAVLPGNIITEGLVDMGEDYMNQMAAAIPAGRLGSVADIG
FT                   NAALFFATEEAGYITGQSLIVDGGQILPESHQAIAEL"
FT   gene            complement(211989..212981)
FT                   /locus_tag="Mmcs_0191"
FT   CDS_pept        complement(211989..212981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0191"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mlo:mlr6716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06312"
FT                   /protein_id="ABG06312.1"
FT                   /translation="MGEVIADDVEVAERALADYDLPANSTLRLLNLSENATYLVECEDD
FT                   QSCSILRVHRQNYHRPHEIESELDWLEALRRDSDVTVPTVLPTRDGRRVVTVDHNGTAR
FT                   HVVHFGMVGGAEPDEGSVTLDDFRTLGAITASLHDHSRSWTRPAGFERFAWDWEHCLGS
FT                   EPRWGRWYDAEGVGPEERHLLDRAQDLLRQRLADYGSGPDRYGLIHADLRLANLLVDPP
FT                   TITVIDFDDCGFGWFFYDFGTAVSFIEDDPALPEWQASWVEGYRSRRPMTTADEDMLAS
FT                   FVFLRRLLLLAWMGTHSHSKESKTKAISYAAGSCALAERYLSTNGRRLA"
FT   gene            complement(212981..213634)
FT                   /locus_tag="Mmcs_0192"
FT   CDS_pept        complement(212981..213634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tel:tlr0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06313"
FT                   /protein_id="ABG06313.1"
FT                   /translation="MPATASGTRTDIRVYLLVEDLQRQFAAYLGTPTRARGYPPYEGEH
FT                   ALIVEVSPALAIERVIDLALREVPGIQPGILYVERQFGVLEIHSASLSDVRRAGEAILT
FT                   GTGNKASDQLRPRVLYHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAAV
FT                   AANEAERAAPGLTVVDVQMIGAAGRLYIGGSVADVTTARDRITSVLAAIEGRDH"
FT   gene            complement(213679..213960)
FT                   /locus_tag="Mmcs_0193"
FT   CDS_pept        complement(213679..213960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0193"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: lin:lin1144
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06314"
FT                   /protein_id="ABG06314.1"
FT                   /translation="MPSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAV
FT                   IVTGEVGAVKAATEAGAEAASQVGELVSVHVIPRPHSELGAHFAVNAQ"
FT   gene            complement(213984..214238)
FT                   /locus_tag="Mmcs_0194"
FT   CDS_pept        complement(213984..214238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0194"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG: fnu:FN0087
FT                   ethanolamine utilization protein eutN"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06315"
FT                   /protein_id="ABG06315.1"
FT                   /translation="MIAATVTGNVWSTRRIEGIPAGAFLEVEVDGSGSRMIAFDVLGTG
FT                   LGERVLIAQGSVAANWFTGTPPPVDALIIGSIDDPSSTS"
FT   gene            complement(214235..214759)
FT                   /locus_tag="Mmcs_0195"
FT   CDS_pept        complement(214235..214759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06316"
FT                   /protein_id="ABG06316.1"
FT                   /translation="MSTIDRAELRALVREVVREAAKDFAGANGGAAPKAAPAPAAPPPP
FT                   PPVQTVADQFGVTPSGPLAADGKHRAEAVRLTNDRELDAFVRALLKLFENPKSRADLKA
FT                   GRLTFRLAGVPTGGRGQTQRIDSGAVTERHIADVAAAGAALVLGPRAVLTPLAREKARA
FT                   LGVSIEKEKRR"
FT   gene            complement(214756..215361)
FT                   /locus_tag="Mmcs_0196"
FT   CDS_pept        complement(214756..215361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0196"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: ana:all3257
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06317"
FT                   /protein_id="ABG06317.1"
FT                   /translation="MAELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGL
FT                   DIEGITDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALESLHQEADSAVRP
FT                   TILASRIISSIDHQHAFLINRNKIGSMVLAGESLFVLEVAPASYAILATNEAEKAADIK
FT                   VVDFRMIGATGRVYLSGTEADIRQAAEAAQDALARSTV"
FT   gene            complement(215365..216942)
FT                   /locus_tag="Mmcs_0197"
FT   CDS_pept        complement(215365..216942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0197"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: tel:tlr0227
FT                   alcohol dehydrogenase / acetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06318"
FT                   /protein_id="ABG06318.1"
FT                   /translation="MSDIPAGRAERREIAAAGHMLERARWAARAYADYDQAAVSAITTA
FT                   VADAAYGAADRFAAEAVAETGMGVVADKVLKNQACSRGILDYYREQDFVSPRVDPDSKI
FT                   VEIPRPAGVVLALTPTTNPVSTVYFKVLLALMTRNAVVVAPHPRAKRCSADAARLLADA
FT                   AIAAGAPDGIVQVVEEPSIPLVEALMADERTDVIVATGGTGVVRAAYSSGTPALGVGPG
FT                   NVPVLVDASADITAAAKRIVDSKAFDNSVLCTNESVLIVEDSVADALRSAMTRAGAHIL
FT                   DADATERLRAYMFADGHLNTDVVGRDAAWIAGQAGIRVTPKTRVLVAPFDHVISEEMLA
FT                   HEKLSPVIGMTTVPDAARGIRAARAVVRIGGAGHSAAIHSENASVITEFATQVPVLRVS
FT                   VNVGNSTGSSGLETNLAPSMTIGTGFVGRSSIGENLRPDNLMNWARIAYNSAPGVAMPS
FT                   FAGIDPWRSPAGPVPEYPRASNDRGAPPVSPSRSAPAARRAADPSIEALRAELRALVVE
FT                   ELAQLIKR"
FT   gene            complement(216939..218216)
FT                   /locus_tag="Mmcs_0198"
FT   CDS_pept        complement(216939..218216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0198"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG: mlo:mlr6714
FT                   ornithine-oxo-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06319"
FT                   /protein_id="ABG06319.1"
FT                   /translation="MYDYGTFSFESKTQVLDRAKAFWNPDKTQFWTDAGVDLVIDRRED
FT                   YFLWDMGGRRLIDMHLNGGTYNLGHRNPEVMQAVSQGMEIFDVGNHHFPSVARTALAQR
FT                   LVETAPDSISKVAFGSGGGEAIDIALKSARHATGRRKIVSIIKAYHGHTGLAVATGDER
FT                   FAKLFLSDRPDEFIQVPFGDVAAMEQALKGNDVAAVIMETIPATYGFPLPPPGYLEAVY
FT                   ALTQKYGSLYIADEVQTGLMRTGELWAITKHGIEPDILVTGKGLSGGVYPITAALLGDR
FT                   AAQWLDQDGFAHISTFGGAELGCVAAIKTLEITTRPEVRSMVHYIADIFDNGLRRIQDD
FT                   YPDWFIGIRQNGVVIGLEFDHPEGAKFVMRELYENGVWAIFSTLDPRVLQFKPGLLLGR
FT                   DLCEDVLDRLEVAVGRAKTAARKGRA"
FT   gene            218367..219899
FT                   /locus_tag="Mmcs_0199"
FT   CDS_pept        218367..219899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0199"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   sma:SAV4543 putative amino acid permease; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06320"
FT                   /protein_id="ABG06320.1"
FT                   /translation="MADQAVTPQKTPAQGVQRLKRNAVGTLGVIFMAVATAAPITAMVG
FT                   NVPIAVGFGNGSHAPAGYLVATIVLGLFAIGYATMAKHITATGAFYGYISHGLGRIVGM
FT                   ASGLLITMAYIVFEASLIGIFAFFFKNFLSSQFGVDVHWIIPALLMLALNAILTYFDVN
FT                   LTAKVLGVFLVTEIVMLALGALAVLFQGGGPEGFVVAETLNPIGAFTPAAIAGASAGLG
FT                   LFFAFWSWVGFESTAMYGEESKDPKRIIPRATMIAVLGVGLFYVFVSWMAIAGTGPSKA
FT                   LELAQDADTSSEIFFGPVRSTYGEWAITLFNILLVTGSFACGMAFHNCASRYLYALGRE
FT                   GLSSGLQKTLGATHHKHGSPYIASFVQSGIALILVLGFFAAGMDPYVHMYTLLAILGTM
FT                   AILIVQSLCAFAVIAYFHFHKEHPSSAHWFKTFLAPLMGGIGMLYVVYLLWEHKESAAG
FT                   TASGTLLFKLTPWIVVAIFVFGAAMATYFKYRDARRYDLIGRIVYDDSEIRD"
FT   gene            complement(219896..220801)
FT                   /locus_tag="Mmcs_0200"
FT   CDS_pept        complement(219896..220801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0200"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG:
FT                   mpa:MAP3655c carboxylic ester hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06321"
FT                   /protein_id="ABG06321.1"
FT                   /translation="MPTPHIHAFHPDLRSVARYIPRQVITPVTLPVVRMVTRLQGKRTP
FT                   KDIEELTLPSGVRVRLFRPTGVPVPAPALLWIHGGGYVIGTAAQDDELCRRFCRKLGIT
FT                   VASVDYRLAPEHPYPTPVEDCYEALTWMARLPAVDPKRVAIGGASAGGGLAASLALLTR
FT                   DRGEIEPVAQLLVYPMIDDRTVERHGLDHPGHRLWNQASNKFGWSAYLGDADPDVAVPA
FT                   RREDLAGLPPAWVGVGTLDLFHDEDLAYAERLRAAGVPCQVEVVQGAFHGFDGVLPKAD
FT                   VSRAFFRSQCDTLRQAFASG"
FT   gene            complement(220908..223076)
FT                   /locus_tag="Mmcs_0201"
FT   CDS_pept        complement(220908..223076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0201"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   mpa:MAP3115c FadE22"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06322"
FT                   /protein_id="ABG06322.1"
FT                   /translation="MRKSALAITDDHIALAESAQGRLDRSGSRAAARATLEGGAAHPAD
FT                   LWRAAADLGWHGLAVAEQFGGAGFGLSELAVVLEMQGRDLTPGPFLPSVAASVVLDRCA
FT                   GDDVRAELLPGLSSGATVAALGLTGTLTVGAAGSVAGKCPAVLGAPDADLLVLVADEDV
FT                   VVLDAKDAGVTVTALDGIDTTRSIGTVAVRDVHVPAGRVLTGAARRAQTVFRILGAAEA
FT                   AGVGWACLDMAVEYAKVREQFGRTIGTFQAVKHHAANMLVDAEQTTAAVWDATRADDLD
FT                   SAWFPAAVAASHAIRASVLLAQNNIQLHGGIAFTWEHDAHLYLRRARSLAALLADGTDP
FT                   LVDIVEAQRSGRARGASFALPAEADEYRAAARAAAAEWAALPPDRRRDFLVDSGYLVPH
FT                   WPKPWGRAAGTLEQLVIEEEFRDVDIPDMGITGWVTLTIAQAGTDDQRERWVEPVLRGE
FT                   VMWCQLFSEPGAGSDAAAVRTAAKRVDGGWRVTGQKVWTSLAHLCQWGLATVRTDPDAP
FT                   KHAGVTMMAIDMSADGVTVNPLRGLTGDSHFNEVFFDDVFVPDADVVGDVNRGWLVARA
FT                   TLGNERISIGGGSGAPTGFSADDLVALLDSAPADVAAAHVRRAGAVIAEAHTLRLLNLR
FT                   RASRAIAGAEPGPEGNVTKLLVAEQCQRQTELGMDLAGTAAVVGGAPTLTRAYLGNRAM
FT                   TIAGGTSEITRNTIAERILGLPRDPLLR"
FT   gene            223239..224462
FT                   /locus_tag="Mmcs_0202"
FT   CDS_pept        223239..224462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0202"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG: mbo:Mb0226
FT                   probable esterase LipC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06323"
FT                   /protein_id="ABG06323.1"
FT                   /translation="MTVRPDTRYPGPTMWSRARWLLNAKPADHMLAMSVASASLPVIGK
FT                   HLEPLGALAAMGVWGYRQMPELLSASAKSWFDPGNAEVRQRERDMTHEVSHQALRGVVP
FT                   ASDLAIDWPAPEKVPPLWKTFEHRRNVHKSSVRYGPLPSQLLDVWRPKELPTEPAPVLV
FT                   FVPGGAWVHGSRLLQGYAMMSHLAEMGWVCLSIDYRVAPHNPWPAHLHDVKTAIAWARA
FT                   NVDKFGGDRNFVAIAGASAGGHLAALAGLTINDPEMQCELPEGSDTSVDAVVGIYGRYD
FT                   WEDRSTAERARFVDFLERVVVRRKISRHPELFRKASPMAQVHSEAPPFLVIHGSGDSVI
FT                   PVWQARSFVEKLKAKSRSVVSYMELPGAGHGFDMIDGARTGSMATAIGLFLNQIHKNRT
FT                   LVGAREVI"
FT   gene            224489..225907
FT                   /locus_tag="Mmcs_0203"
FT   CDS_pept        224489..225907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0203"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mpa:MAP3657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06324"
FT                   /protein_id="ABG06324.1"
FT                   /translation="MKRLSGWDAFLLYSETPTVHMHTLKLAVIQLDDLGGRSFGVEEFR
FT                   QVIHSRLYKLDPFRYELVDIPFKFHHPMWRENCEVDLEYHIRPYRVESPGGRRQLDEAV
FT                   GRIASTPLDRSRPLWEMYFIEGLADGRIAVLGKIHHALADGIASANLMARGMDLQSGPQ
FT                   RDRDSYATDPPPGRGELVRSAFRDHLRQIGKLPATWRYTAEGLQRVRRSNRKLSPELTR
FT                   PFTPPPSFMNHKVDGVRKFATATLALADIKLTAKHLGVTLNDLVLALSAGALRQLSLRY
FT                   DGHADHPLLASVPVSFDFNPDRISGNYFTGVLVCIPVQVEDPLQRVQECHKAAASAKEG
FT                   HHLIGPELVSRWSSYFPPAPAEALFRWLANKDGQNKVLNLPISNVPGPRERGRVGGALV
FT                   TEIYSVGPLTTGSGLNITVWSYVDQLNISVLSDGATLEDPHELTDAMVEAFVEIRTAAG
FT                   LSDELTVVETAMAP"
FT   gene            complement(225912..227156)
FT                   /locus_tag="Mmcs_0204"
FT   CDS_pept        complement(225912..227156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0204"
FT                   /product="LipO"
FT                   /note="KEGG: mpa:MAP1158c LipO"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06325"
FT                   /protein_id="ABG06325.1"
FT                   /translation="MARRRFPLLRAVAELVNAANGVRPLGRDGYITLPVFAFGWPTTEA
FT                   APLYLAGSMLDAGRRGLRGDFRGGRGRIALLVTAVAWALLGVIIRRNVTSKRYFDEPLR
FT                   ETLGDDYEMVAARAQPARPRNLIGVPPNELTRRRYVEKAGTVQYGPHPKVNFADIWRRS
FT                   DLPRDGRAPVLLQVPGGAWAIGMRRPQAYPMLSHMAEQGWIGVSIDYRVSPRHTWPDHI
FT                   VDVKRALAWIKEHIAEYGGDPDFVAITGGSAGGHLASLVALTPNDPQYQPGFEDADTSV
FT                   VAAVPIYGRYDWFSVEGPGRREFIAFLQKFVVKKRILEHRQEYLDASPITRVRPDAPPF
FT                   FVLHGQDDSIIPVGEGREFVDALRAVSRSVVAYAEIPHAQHAFDFFGSPRAHYTANAVD
FT                   QFLSWVNATRARAVA"
FT   gene            complement(227329..228123)
FT                   /locus_tag="Mmcs_0205"
FT   CDS_pept        complement(227329..228123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0205"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mpa:MAP1160c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06326"
FT                   /protein_id="ABG06326.1"
FT                   /translation="MPSSDIAKWDPGFTERVMSVLRPLLKTYHRAEMRGLESFPSAGGA
FT                   LVVSNHSGGLFAMDVPVFAAGFYEEFGYDRPVFTLSHDLLMTGPTAEFFTKTGFIRANH
FT                   ENADEALRAGGVVIVFPGGDYDVYRPTLAESKIDFGGRTGYVRAALNAGVPLVPTVSIG
FT                   GQESQFYLTRGEWLAKTIRLDKLLRAKILPISFGFPFGLSAVLPVNLPLPTKIVTRVLP
FT                   PIDIVAEFGEDPDVDEVDAHVRHVMQRALDELAAERRFPVLG"
FT   gene            complement(228205..228534)
FT                   /locus_tag="Mmcs_0206"
FT   CDS_pept        complement(228205..228534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06327"
FT                   /protein_id="ABG06327.1"
FT                   /translation="MSQRGVRLGGSGFLDPRTTGGPTHAGRVGLVTARRLGPAVQFLEP
FT                   GVEHLEHRDAVAVLGLVVEQQPQMGFVERPDAMPQIGQRQLVVVLQRKFVTGSHAVGVP
FT                   VPAAR"
FT   gene            228680..229630
FT                   /locus_tag="Mmcs_0207"
FT   CDS_pept        228680..229630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0207"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: mbo:Mb1575c PPE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06328"
FT                   /protein_id="ABG06328.1"
FT                   /translation="MKVSARSYLIAGVSLASAGLIVGGSNTPVLDTTRDDITVAPMAAT
FT                   TTAPQLDGPRVGGAASASGSVGAAFVGPAPAPDVTARIALPEVDGLDPEAGRPGVQLSL
FT                   LTGTPNLGYGNKGLFNAGVNNDGDFNIGGDNDGDFNIGTGNVGDFNIGYDNDGDFNIGG
FT                   DNEGGFNVGFDNRGGERNFGAGNTGSYNVGFFNTGEFNFGVGNTGVGNVGFFNTGDYTV
FT                   GAFNVGIRYAGNPGISTGRTVADTDDEDPGTSALRTRAAQSEDDNDEAAVTRSEKNDDA
FT                   SNSDSGHKASDKAGDTRAAKASDDKGDGNEGGDDE"
FT   sig_peptide     228680..228751
FT                   /locus_tag="Mmcs_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.810) with cleavage site probability 0.348 at
FT                   residue 24"
FT   gene            229661..230263
FT                   /locus_tag="Mmcs_0208"
FT   CDS_pept        229661..230263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06329"
FT                   /protein_id="ABG06329.1"
FT                   /translation="MRHAFTGHIAGFGTDAGVRVVVGCWQTSPFGAFTDVMVQQPDEQR
FT                   VLLAPDRAVADFVAATYHFDRVEVGPVAATLEPDRLTVHSAVLDVKVSIGGPAPLDRLL
FT                   RLVPARLATAPWWLRAVDPVASRLVRGVHTAGTAGHGRREFYGVRRSRRITALAGRYRD
FT                   VDLGGLQPLRPPVSFGFASAPAAPQLVAVTTTIIDAG"
FT   gene            230302..230547
FT                   /locus_tag="Mmcs_0209"
FT   CDS_pept        230302..230547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06330"
FT                   /protein_id="ABG06330.1"
FT                   /translation="MDTVTRLRHAQQRLLKAQRRLWLAQLAMWPTLIVTGVAVAAGAVW
FT                   LLRRRSAGGRHELPESPGAHRVETVAEHDGQGVIPN"
FT   sig_peptide     230302..230424
FT                   /locus_tag="Mmcs_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.824 at
FT                   residue 41"
FT   gene            complement(230551..231381)
FT                   /locus_tag="Mmcs_0210"
FT   CDS_pept        complement(230551..231381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0210"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   nfa:nfa21460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06331"
FT                   /protein_id="ABG06331.1"
FT                   /translation="MTDETGAAGAVRTATNHRGAQVAARVGYLINGILHLLIAYIIFRI
FT                   AIGSGHGDADQSGALAALAQTKGGFLALWGVAIALVPLTLWRLAETILGLHPSEHHDPD
FT                   PDPDDFLMVNRLKALGLAVVYAAVAAMAVQFALGSRHSSAERSVGLSIWLMRTPEGKAV
FT                   LAVIGLGVTAVGCYFAFKGASRRFRDDLNISGGRVLTVLGASGHVAEGLVLAVAGVLVV
FT                   VASVRADPSKATGLDGAVKALGQMPFGSVLIGAAAAGFAAYGLYSFALTRYARM"
FT   gene            231717..232562
FT                   /locus_tag="Mmcs_0211"
FT   CDS_pept        231717..232562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0211"
FT                   /product="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="PFAM: N-acetyltransferase; KEGG: mpa:MAP0501
FT                   arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06332"
FT                   /protein_id="ABG06332.1"
FT                   /translation="MGHMTETAVDTPAYFTRIGYRGAGDPTLATLRALIAAHNRSIPFE
FT                   NLDPLLGTPVADLSAAALTDKLVYRRRGGYCYEHNGLMGYVLEDLGFGVERIAGRVVWM
FT                   RRDDTLPAQTHQLLTVTVPEVAGRYLVDVGFGGQTLSSPIRFETGVEQPTRHEPYRIRD
FT                   HGEGHVLESLIRGEWRPLYLFADRPQPLIDLEVGSWYVSTHPASVFAVGLTAALVTDEA
FT                   RVNMRGRHLTVHRAEGSEQIRFDTAAQVLDALDERFGIDLTDLGDRAAVEQRIHEVLDN
FT                   "
FT   gene            complement(232581..233591)
FT                   /locus_tag="Mmcs_0212"
FT   CDS_pept        complement(232581..233591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0212"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like Acyl-CoA
FT                   dehydrogenase, type 2-like; KEGG: bja:blr0138 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06333"
FT                   /protein_id="ABG06333.1"
FT                   /translation="MNDELRQLVDDLARRSYDARMGRHTRPESFDSELWQHLEETGLSR
FT                   LTTAEDAGPAEEAIVLAGLARRSAAVPVAETDLLAAWLAGRAGLEVPDSGPLTVAVCTG
FT                   ARRGGRITGTARQVPWPRDATIVAAVRTEDGLHATVLDAPEIADGVDLAGEPRGVVTID
FT                   VPESVCARTEPELTEELLRRGAWARCVQTIGAFDAAAELTAAHTRERVQFGRALSRFQA
FT                   VQHALAGMAGEIERARATVDLAVAAAAQYGFHSVATHYAVTVAKVTVGRAVEPVTTIAH
FT                   QLHGAIGVTVEHPLWLSTMRARSCVDEFGTTAQHAGVLGRLALSAADPWDVLVGP"
FT   gene            complement(233652..234809)
FT                   /locus_tag="Mmcs_0213"
FT   CDS_pept        complement(233652..234809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0213"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   nfa:nfa33810 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06334"
FT                   /protein_id="ABG06334.1"
FT                   /translation="MGELEALCANDDDLAALRTSIREFLAADRAAHGWQPAVDCWLAAW
FT                   DPEFSVRLAAAGFLGLTIPTEYGGHGLGHLHRYVVTEELLAHGAPVAAHWIADRQVAPG
FT                   LLTYGTEEQRRRLLPRIAAGRLSSAIGMSEHGAGSDLAAVATRATEVDGGWRLDGTKVW
FT                   TSGAHVADQVVVLARSAPVDPDHRHAGFSQFIVPTDAPGVTISPIVLMNGEHHFNEVLF
FT                   DGVFVPHADVLGEIGNGWHQVTAELGFERSGPERILSTATLVFEAVAALGRAGVDDRTA
FT                   AEVGDLMARMVSLRQLSISVARELTAGRDANTRAALVKDLGTRFEQKSVEIVAGLLTSL
FT                   DEDAPEAERLRGLLATGRLHAPLFTLRGGTNEVLRGVVARGLGVR"
FT   gene            234889..235803
FT                   /locus_tag="Mmcs_0214"
FT   CDS_pept        234889..235803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0214"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: Helix-turn-helix, AraC type; KEGG:
FT                   bur:Bcep18194_A4210 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06335"
FT                   /protein_id="ABG06335.1"
FT                   /translation="MSEHATNPARRDRLRELLDAVVDVSNAEVGDMARSSYASEFHFSR
FT                   EVRRLTGEPPAALRRRIMLERAAWRLRRGEPVAAVAADEGWSSPEVFSRAFRRTFGVPP
FT                   SRAADVGFRVPAPNGLHFHPPQSLWLDGDGTTKEPDPSRLMVAHDVADTAYLIDRAREL
FT                   SEDQWWREVAPGQVVLHWDGPEPSVGAVLGALVWTKEVWLATIEGRDFPDRSRSTVDQL
FT                   AVRHADIGKRWSAMVSEYSAAGRMGDTVIDALCDPPESFQLYGIVAHVLTFSAHRRGLA
FT                   RTMLAALGVPTEQGDPLDWMRRH"
FT   gene            235805..236338
FT                   /locus_tag="Mmcs_0215"
FT   CDS_pept        235805..236338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0215"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /note="PFAM: bifunctional deaminase-reductase-like; KEGG:
FT                   nfa:nfa6270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06336"
FT                   /protein_id="ABG06336.1"
FT                   /translation="MATVYYTASSLDGYIVDADDSLDWLISRDIDPDGPFHYDAFVDQV
FT                   GALVMGAATYEWIVKNQPGEWMYSQPTWVVTHRPDIVAAGHPVQTFAGDVTELHPELVA
FT                   AAGGKDVWVVGGGELAAQFVAAGLVDEMIVSYAPCTLGAGSPVLPIRSEWELVESAVNR
FT                   EFVCARWRVAALTG"
FT   gene            complement(236378..236905)
FT                   /locus_tag="Mmcs_0216"
FT   CDS_pept        complement(236378..236905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0216"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3661c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06337"
FT                   /protein_id="ABG06337.1"
FT                   /translation="MLIGAAEVLRERGAAGVTIDEVLQRSGAPRGSVYYHFPEGRSQIV
FT                   AEALEYAGESITSLIDEAAANGGRYLVQHFVDFWDRVLAESDFTAGCPVVAAAIGSAEP
FT                   MDPNSPRWPGRSSGTGVRRSRAPSRSTGASRARPPRWPSRPSPHWRAPWCCAGPPGTST
FT                   RCGRCTPNSNSC"
FT   gene            complement(237303..238778)
FT                   /locus_tag="Mmcs_0217"
FT   CDS_pept        complement(237303..238778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0217"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mtc:MT0233
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06338"
FT                   /protein_id="ABG06338.1"
FT                   /translation="MTQTVQEHKTTWDKLFIGGQWVAPSTSDVIEVFSPATGQKVGQVP
FT                   LAAEADVNAACAAARKAFDEGPWPRMSPDERAAVLGAAVKLMEERGAELKYLLAAETGQ
FT                   PQTIVDMMQYGAAMSSFTYFAGAADKFQWSEIRDGIYGQTLVTREPIGVVGAITAWNVP
FT                   FFLAANKLGPALLAGCTVVLKPAAETPLSVFAMAQMFAEAGLPEGVLSVVPGGAETGRA
FT                   LTANPEIDKYTFTGSSAVGKEIGKLAAEKLKPCTLELGGKSAAIVLEDADLDSTLPMLA
FT                   FSGVMNSGQACVAQTRILAPRSRYDEVVEKLANFVSAMPVGLPDDPNAAIGPLISEKQR
FT                   ERVESYIKKGTEEGARIVTGGSRPEGLDSGWFVQPTVFADVDNSMTIAQEEIFGPVLAV
FT                   IPYDTEDDAIRIANDSVYGLAGSVWTTDNKKALEVASKIRTGTYAVNMYAFDPGAPFGG
FT                   YKNSGIGRENGPEGIEQYCQAKSTLLPFGYTPE"
FT   gene            complement(238825..239583)
FT                   /locus_tag="Mmcs_0218"
FT   CDS_pept        complement(238825..239583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0218"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: mpa:MAP3663c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06339"
FT                   /db_xref="GOA:Q1BFJ5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BFJ5"
FT                   /protein_id="ABG06339.1"
FT                   /translation="MSATELFARRATLARSVRLLSEFRFEQSDPARFYGALADDTAAMV
FT                   ADLWQAATETTPGGRTVLDVGGGPGFFAAAFTRRGMEYVGVEPDPREMHAGPAAQVGGR
FT                   YVRASGTSLPFADGSVDVCLSSNVAEHVPDPWRLGNEMLRVTRPGGLAVLSYTVWLGPF
FT                   GGHETGLTHYLGGARAADRYTRKHGHRPKNDYGSSLFAVSAHDGLEWAASTGALIAAFP
FT                   RYHPRWAWWTNAVPGLREFVVSNQVLVLQP"
FT   gene            239698..240780
FT                   /locus_tag="Mmcs_0219"
FT   CDS_pept        239698..240780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0219"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mbo:Mb0230 possible conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06340"
FT                   /protein_id="ABG06340.1"
FT                   /translation="MYLQRIGEQLAAPGVRVTLRTASYPGAARREVVDGVHVSRGGGRY
FT                   SVYPWALLVMALARIGLGPLRGARPDVVVDTQNGVPFLARLVYGRRTAVLVHHCHREQW
FT                   PVAGPVLGRLGWFVESVVSPRVHRRAQYLTVSLPSSRDLTDLGVDGSRIAVVRNGLDEA
FT                   PASTLTLPRSVTPRIAVLSRLVPHKQIEDALDAVAALRPHIPDLHLDVLGGGWWQQKLV
FT                   DHARLSGISDAVTFHGHVDDITKHEVLQHSWVHVLPSRKEGWGLAVTEAGQHAVPTIGY
FT                   RSSGGLTDSIVDGVTGLLVDDRDELVEALRQLLGDHVLREQLGAKAQARSVEFSWRQSA
FT                   SAMREVFDAMLSGRYVSGVV"
FT   gene            complement(240829..242424)
FT                   /locus_tag="Mmcs_0220"
FT   CDS_pept        complement(240829..242424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3665c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06341"
FT                   /protein_id="ABG06341.1"
FT                   /translation="MTAPLLPPGYLLLRDAVSTPRSYLTDAALGLSEAAPRALPQDFAI
FT                   ALASQVLDGGVVVKVLLVAGLWAAGWGAARLASTVVPDAGAAGQCVAVTVAVWNPYVAE
FT                   RLLQGHWSLLVGYGCLPWVATAVLRLRDGSGPWWPLPFWIALAGLTPTGLLLAAVVAVV
FT                   SVCAPGAGRRRIAVLGAALGAAVVSAMPWLVAAAVSGSLAVSPAAGLPAFAARAEPGLG
FT                   TLGSLAGLGGIWNADAVPGSRTTLFAVVATAMLLAVVLAGVWVVRRRPAARPLLILAAA
FT                   AVLFPAVMATGPGLAVLEHTVRALPGLGVLRDGQKWVALAVPGYAVAGAGAVLAVRRVS
FT                   PAALGAVCCAALIAVLPDLAFGVGGQMRAVQYPPGWAAAAAVINADPRPVAVLPPDSMR
FT                   QFAWAGEAPVLDPLPRWVRAEVLSTGDLVIGGTTVPGEGVRARAVQDLVMRGAPVSELA
FT                   DAGVGWVVVESGSAALDLPVAYRDDDLAVYRVGGDRPGSADRWLLIGAHVAWLAVLVGS
FT                   LVAGVVGLRRWPVA"
FT   gene            complement(242472..243674)
FT                   /locus_tag="Mmcs_0221"
FT   CDS_pept        complement(242472..243674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3666c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06342"
FT                   /protein_id="ABG06342.1"
FT                   /translation="MNRAVALRIAACGLMGLGAALLIAALLLSTYTKGKISKVPLDIDT
FT                   TLISDGTGTAFDPASLLGERFVVDRDIPMAFQQQITVESPSNADVVTLQVGSTLRRTDK
FT                   QQDNGLLLAMVDTVTMDRSSAMAVTSESNPGGAVQKPRAIEDDQPPTNIALPHDGLTYR
FT                   FPFDTEKKTYPLFDPIAQKAYDANYDGEEDVNGLTTYKFTQNVGYDAEGKLVEPVKYAS
FT                   LYEDDADAQVTARAALWGVEGDPEEPITMSRFYAAERTLWVDPVSGTIVKSDEHGYHYY
FT                   ARDALRPEVTFADYTVTTNEESVESQVASARSERDRVALWGRILPITFTAVGLVLLVGG
FT                   ALLGSFSLRAESALIDPGLDEADHGFFQRDDAGEPVPGAEAKTEKLPAQRPTDLPPDRP
FT                   V"
FT   sig_peptide     complement(243600..243674)
FT                   /locus_tag="Mmcs_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.451 at
FT                   residue 25"
FT   gene            243802..244980
FT                   /locus_tag="Mmcs_0222"
FT   CDS_pept        243802..244980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0222"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mbo:Mb0233 probable
FT                   integral membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06343"
FT                   /protein_id="ABG06343.1"
FT                   /translation="MTSSEEIGGTRSFLPAVEGMRACAAIGVVVTHVAFQTGHTSGADG
FT                   RFFGRFDLAVAVFFALSGFLLWRGHAAAARGLRTAPPTAHYLRSRIVRIMPGYLVAVVI
FT                   ILSLFPDTKPDLTVWLANLSLTQIYVPLTLTAGLTQMWSLSVEVSFYLVLPLLALSVRR
FT                   VPVRARIPVIVGAAVASLFWVYIPSDPDSGHNLWNWPPAFFSWFAAGMVLAELTVTQVG
FT                   WAHRLARRRILMAAIVVAAFAVAASPLAGREGLQPGTIGQVILKTAMGAVVAGALLAPL
FT                   VLDRPDTPHRILGSRVMVTLGRWSYGLFIWHLAALAMVFPMVGEFAFNGHMPSVLALTL
FT                   LFGFALAAVSYACVESPAREALRRWEFRRATPTHRAPPLDSSVTDVPEPISR"
FT   gene            complement(244949..246424)
FT                   /locus_tag="Mmcs_0223"
FT   CDS_pept        complement(244949..246424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0223"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bja:bll0131 probable acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06344"
FT                   /protein_id="ABG06344.1"
FT                   /translation="MVDGVPPIGTQFSALAARDPDAPALTCAGRTVTRGELDVTTNRLA
FT                   RAYAELGVRQGDYVTILLPNSIAWVEAVLATWKLGAVPQPLSARLPDAELSALLALRPP
FT                   ALLVGRADPNDVSPSVPANFTPDPALPADPLPEAVSPAWKSMASGGSTGRPKLIEAGGD
FT                   SRVPSAIGLPLGAEEGDVNLVSVPLSHNTGFTTLAIGLLMGHHLVLMPRFEPHEFLRLV
FT                   SEHRVTFLTTVPTIMQRLLPVYRADPGAYDLSSIRRFWHVGAPCPPAVKEAWIGLLGPQ
FT                   VLWELYGGTELQALTFISGEQWLTHRGSVGTVVAGAMTVLDDDGNTCPPGVVGEIYMRR
FT                   SPGAAPTYRYIGSTAKSRDGWDSLGDLGYFDEDGFLYLNDRRVDMFTVGGRNVYPAEIE
FT                   SALSAHPDVLSCLVVGVPDDDLGQVPHALVQRAPGSALDEAAVTAFVAERLAGYKVPRT
FT                   VEFSEHPLRDDAGKARRSAVRAEVIARSARARP"
FT   gene            complement(246426..247403)
FT                   /locus_tag="Mmcs_0224"
FT   CDS_pept        complement(246426..247403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0224"
FT                   /product="Aryldialkylphosphatase"
FT                   /EC_number="3.1.8.1"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: mtc:MT0240
FT                   parathion hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06345"
FT                   /protein_id="ABG06345.1"
FT                   /translation="MPQLNTAAGTIDTADLGVTLMHEHVFIMTTEILLNYPDAWGDEAK
FT                   READAIARLDELKARGVDTIVDLTVVGLGRYIPRIARIAAATDLNIVVATGLYTYNDVP
FT                   FFFHFTGPGTALGGPEVMVDMFVRDIEHGIADTGVKAAILKCATDEPGLTPGVERVLRA
FT                   VAQAHRRTGVPISTHTHAATRRGLDQQRIFAEEGVDLSRVVIGHSGDTTDLDYLEALMA
FT                   AGSYIGMDRFGVDAFLGFEDRVATVAALCERGHADQMVLSHDASCYFDALPEETVAHTM
FT                   PNWHYLHIHNDVLPALRARGVTDEQLTTMLVDNPRRIFEHSGGY"
FT   gene            247502..249103
FT                   /locus_tag="Mmcs_0225"
FT   CDS_pept        247502..249103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0225"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /note="PFAM: protein of unknown function DUF894, DitE major
FT                   facilitator superfamily MFS_1; KEGG: nfa:nfa35850 putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06346"
FT                   /protein_id="ABG06346.1"
FT                   /translation="MATPQTRPVVSSWAPFSSPVYRALWIAQFVSNLGTWMQTVGAQWM
FT                   LVGDPGAAVLVPLVQTATTLPIMLLALPSGVLADLIDRRRLLIATQAAMASGVAALAML
FT                   TGFGLATPTVLLLLLFLIGCGQALTTPAWQAIQPELVPREQIPAAAALASMSVNGARAI
FT                   GPAVAGVLVSLSGPTTVFALNAFSFIGIVMVLLWWRRPVEEATMPLERPISALSAGRRY
FT                   IRSSPVIRRILLRTVLFTAPASALWGLLAVIAANQLNLSSSGYGLLLGALGVGAVLGAV
FT                   VLSRLHARFGQNQLMVMGAVGFAGATVVLATVHVLAAVLAALVVGGVSWLLTMSTLNAS
FT                   MQLSLPAWVRARGLSVYQLVFTGSQAIGSLVWGVVAGATSGVTALLISAALLIVCGVSV
FT                   AWWPLHPATGTLDVTPSAHWGEPALVFEPDPQDGPVVVLQSYVVAPKDEAGFLALMQRV
FT                   RRSRQRTGAMEWGIFRSGESADTFVELFLVRSWDEHLRQHLVRQTALDLALEREIEGYV
FT                   HGESTLRHFIAVRNGR"
FT   gene            complement(249078..253232)
FT                   /locus_tag="Mmcs_0226"
FT   CDS_pept        complement(249078..253232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0226"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mbo:Mb0241c probable conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06347"
FT                   /protein_id="ABG06347.1"
FT                   /translation="MAALVLTFAQSPGQISPDTKLDLTANPLRFLARAANLWNSELPFG
FT                   QAQNQAYGYLFPHGTFFLAGDLLGLPGWVTQRLWWALLLTVGFWGVVRVAEALGLGSPT
FT                   SRVIGAVAYALSPRVLTTLGALSSETLPMMLAPWVLLPVILALRGEGSARRLAARSAGA
FT                   IALMGAVNAVATLTGCLAAVLWWACHRPNRLWWRFTAWWFGCAALAVLWWVVPLLLLGR
FT                   ISPPFLDFIESSGVTTQWMSLTEMLRGTGSWTPFVAPTATAGSTLVTGSLAVLATTLVA
FT                   AAGMAGLALRSMPARGRLITMLLVGVALLAAGYAGGLGSPVAGAVQAFLDGDGTPLRNL
FT                   QKLDPVLRLPLALGVIHLLARIPLPGSAPRPVWLHAFAHPEKDRRVAVGIVVLAALTAA
FT                   TSLAWTGRLTPPGAFTAIPGHWHETAAWLDAHNTGDPTAGRVLVAPGAPFATQVWGSSH
FT                   DEPLQVLGESPWGVRDSIPLTPPETIRALDSVQRLFAAGRPSAGLADTLARQGISYVVV
FT                   RNDLDPESSRSARPVLVHRAIDGSPGLTRVAQFGDPVGPGTLEGFVSDSGLRPRYPAVE
FT                   IYRVDAQHNPSTPYLVDADAMARVDGAPEALLRLDERRRLLDRPPLGPMLLTADAERAG
FT                   LPAPLVTVTDTPTARETDYGRVDDHSSAIRTPDDPRNTFNRVPDYPSAGADVVYGRWTG
FT                   GRLSVSSSAADSTALPNVAPATGPTAAIDADTSTSWVSNALQAALGQWLQVDFDKPVTN
FT                   ATITVTPSATAVGAQVRRMEVATVNGTSTLRFEEAGKPLTVALPYGETPWVRITATGTD
FT                   DGSAGVQFGITDLSVTQYDANGFATPIHLRHTVEVPGPPAGSAVGLWDLGSELLGRQGC
FT                   VDSPDGVKCAAAMALSPEEPVNLSRTLAVPAPTSVQPTVWVRARQGPRLAELIRQPDTT
FT                   VVAGDADALDVLGSSYAAGDGDPRTAWTAPQRVVQHRTPPTLTLRLPAPTEVAALRITP
FT                   SKTEPPAHPRMVAVDLGNGPQARRLSGDGDTETIRLTPHRTDTIAVSLLDWNDIIDRTS
FT                   LGFDQLKPPGLAEVTALDRRGNPIGAADAGENRGRTVDVPCGEGPIIGVAGQFVPTRVT
FT                   ATVGALVDGEPVLAQPCRTEPIALPAGQQELLVSPGATFVVDGVQLAAPAARDITPAAT
FT                   TPADTGAWGPDRREVRVVPGQRDRVLVVPESVNPGWQARGPGGDLLTPVVVNGWQQGWV
FT                   VPADTEGAVTLSFRSNTLYRAGLIGGLALLPLLALLVWLPARRRRDDEPGRPWRVPTVA
FT                   AAVGVLGVGAVISGWAGVVVVGGVLGVRYLLRNRERLLDRFTLGVTAGGLTLAGAVLSQ
FT                   HPWRSVDGYVGFEPGVQLLALVSVAALAASAVPFNARSAPR"
FT   gene            complement(253324..253497)
FT                   /locus_tag="Mmcs_0227"
FT   CDS_pept        complement(253324..253497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0227"
FT                   /product="small secreted protein"
FT                   /note="KEGG: mbo:Mb0242c small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06348"
FT                   /protein_id="ABG06348.1"
FT                   /translation="MDRFIVPAAASIVVGLLLGAAAVFGVTLMVQEDSKPPLQAGDPAS
FT                   SVLNRVEYGDRS"
FT   sig_peptide     complement(253420..253497)
FT                   /locus_tag="Mmcs_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.858 at
FT                   residue 26"
FT   gene            complement(253523..254041)
FT                   /locus_tag="Mmcs_0228"
FT   CDS_pept        complement(253523..254041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0228"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: nfa:nfa54660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06349"
FT                   /protein_id="ABG06349.1"
FT                   /translation="MTAHADVSARESVSEVHRQVGQEIMVIAYDGTANARRAVHYAGRF
FT                   LSANRAVVLTVWSPTLRGSEPPAVDLDGPPDPAPDDDEDIAYADAQRTNAEGIELARAA
FT                   GLSAEAMCVAATSTVWNTIIETADTLDADLIVTGTRGTTGLRSLLQSSVADRVLRHGHR
FT                   PVLIVPPGR"
FT   gene            254102..255307
FT                   /locus_tag="Mmcs_0229"
FT   CDS_pept        254102..255307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0229"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3-like; KEGG:
FT                   mle:ML2569 putative secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06350"
FT                   /protein_id="ABG06350.1"
FT                   /translation="MSEPMAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPV
FT                   SAAPAVPLKAPVPLAPGAAACGQGAALLSEMTTRDKLAQLLMVGVSGAADARAVVDNHR
FT                   IGGIMIGSWTDLSMMGAPLAEIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALA
FT                   QSSTPDQVYGIALERGRAMRGLGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGA
FT                   YARGLRDAGVLPVLKHFPGHGNASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGV
FT                   MVGHMQVPGLTGSDPASLSPAAYQLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVAD
FT                   AALRALQAGADTALWVTTAEVPAVLDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRC
FT                   GG"
FT   sig_peptide     254102..254173
FT                   /locus_tag="Mmcs_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.860 at
FT                   residue 24"
FT   gene            complement(255315..256769)
FT                   /locus_tag="Mmcs_0230"
FT   CDS_pept        complement(255315..256769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0230"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase Orn/Lys/Arg decarboxylase-like; KEGG: cya:CYA_1002
FT                   Orn/Lys/Arg decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06351"
FT                   /protein_id="ABG06351.1"
FT                   /translation="MDSDRHTRAPLFEALRRFVERDQAPFYSPGHKGGRTLDPWFREHI
FT                   AAVDLNNLADLDTLHCPSGPILEAEELIADAWGAKASFILVQGSTGGNIAVALSALRPG
FT                   DPVLVQRNAHKSVLAGLVQSGARPIWLTPQWDADFGVAHGLPVDRVEAALTAETAAALW
FT                   ILHPTYFGTTADIAALTAVCRRHGIPLLADGAHSPHFAFHPDLPAAAETAGAAATVQSV
FT                   HKILSGLSQAAVLHVDTDQLDVPTVRRALQLVQTTSPHFAIMASIDLARRQMVEDGRRL
FT                   LDETLRRARDTAARLAQIPGLRVLSDHDLTGPGSGLHQRDETKLLIGTHGLAADASDIL
FT                   ARLTREHGVQPELAGAGHILCITTIGNTDADMDRLVDGLTDVALAVGRRDGGCPPDVGG
FT                   ALDLAPEIVLTPREAFFADVDTVSLRAAVGRIAAEPITPYPPGIPLVMPGERLSAEVVD
FT                   VLDGLRGAGNPISAADPTLERVTVVR"
FT   gene            complement(256759..257934)
FT                   /locus_tag="Mmcs_0231"
FT   CDS_pept        complement(256759..257934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0231"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mpa:MAP1600
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06352"
FT                   /protein_id="ABG06352.1"
FT                   /translation="MPVGDRTDVFAGVAADVPDALAEHLRAVDLVDHHVHGTFNEAVDR
FT                   AGFEAAINEGSTDPVPSFMTQFDSPLGLAIRRWCAPVLDLEPLAGADEYWSRRAEFGPD
FT                   ELSERFLRAAGVSRWVVDTGFKGDLITTPGQMTALSGVPSSEILRLERLTEDLLEAGTS
FT                   PRDYPEAFRSALDEAVADQGTVGVKTIAAYRVGFDVDWSRPSEATAVDSAERLVARGAP
FT                   LRVDDPALIAFGVHEAAERGLPIQVHVGFGDRDLDLHRTDPLLLLPLLRAMTPVPVLLL
FT                   HCYPFQRQAGYLAQAFDHVNFDVGLAINYLGPRSTSVVAEALDTAPFAKQLYSSDAFGP
FT                   PELHLLGSILWRRAMGLVLGDWVRTGDCTEADAIRIVDMIGVHNAERVYGL"
FT   gene            complement(258005..259540)
FT                   /locus_tag="Mmcs_0232"
FT   CDS_pept        complement(258005..259540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0232"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   cac:CAC0852 amino acid permease; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06353"
FT                   /protein_id="ABG06353.1"
FT                   /translation="MTTAERKPPMTQTPPETNLAPETDQLPHRRLPFWVALAMSVALVG
FT                   PTLAMSGNGQGLIGTVGKAIPLVFLIGLIGVSLVGYSFVRLTRHLNHAGSAYGLVGGTI
FT                   GPRAGFFSGFAMLGAYVGFSIGTLALTAAFTNAFIAQLQPDAEDPYQVPWLLVVLVGAG
FT                   ISFLLAGRDIRLLAKILLGIEGIGILAMVILVAVIFAKGGAPTTGVDFSVFTFDGVSAS
FT                   AVLSGVVAAFLSWAGFEACASMGEETDDPRRNIPRALGGTLLLTGVLFVVVMFAQVIGF
FT                   GTDEAGLAAFQGSGNTLGDLGSTYVGQWFSLLIIFTATVAAFGCHLATSATSGRMLYAF
FT                   GRDGFGPKALAHIHAETGGPRRATWLVVGVALVVDLICGALDWPDMGTGNDAIDTYFLF
FT                   AVAGSVCLMVCYLLVEIAAAWFVGAPKFVGVHGGTGKVLGLLLPLLGAVVIAVVLWFNV
FT                   KDAETWSAAPLLGLYWCAIGLIIALAASGIAKRVGESLSRELELSPPDGRPVS"
FT   gene            complement(259537..260850)
FT                   /locus_tag="Mmcs_0233"
FT   CDS_pept        complement(259537..260850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0233"
FT                   /product="glutamine synthetase, catalytic region"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mpa:MAP1599 GlnA3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06354"
FT                   /protein_id="ABG06354.1"
FT                   /translation="MPQQDEELRAQGVALIAGSVTDLAGVTRAKYVPVRRLRAFEQSGM
FT                   GVSPSWSVFCVDSGIAFTPDIGVAGDLRIRIDGEHLRIIEDGIAWAPGDLHDQYGRPAP
FT                   LCPRSLLARVEQRAAERGLEVRVGGELECTMLAADSGPASAEPWSPYGIRTSLDRSAFL
FT                   VDLIGAAERAGLAVEQLHTEYGHDQLEMSLAPAGPVETADAIILARIVIGRAAARHGMK
FT                   ISFSPVPFADAAGNGAHLHLSLTDSAGPLLSGGDGPYGIRPEGSAAIAGVLDTLPDLLG
FT                   VYAGSALSALRLKPGNWAGASACWGLENREAAVRFIAATPGNPHGANAELKLVDPSANP
FT                   YLAAAAFLGSALHGIDRRLPLPPEVPEDPRRSGATPPALPTGQQAALEALENSATAAEL
FT                   LTTPIIEALIAVRRHELTTYGDRPPAETTQALRLAWSC"
FT   gene            260966..261760
FT                   /locus_tag="Mmcs_0234"
FT   CDS_pept        260966..261760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0234"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   blo:BL0195 hypothetical protein with possible glutamine
FT                   amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06355"
FT                   /protein_id="ABG06355.1"
FT                   /translation="MCRLLGVVSAVPVSVSDAVGAPTLKDFVALTKIHGDGWGVAAVEE
FT                   AGRSPRVEVSAGSALDDPAFDAATAERRAVASMVHLRWATNGLAVRPENSHPFLADGIA
FT                   MAHNGSIKPMAPLDALLEPGIAATLRGTTDSERYFALIRQHRRTAPTLAEAVRRAVSEL
FT                   RDRYPEASLNALLLGEGQLVAVHAHARSRLPAEDIEEITAADLPTEHLEDYFALRWARP
FT                   DDGTLVIGSTGFGDLDWQPLPPECVTAVSIDDRSMTLHPLGP"
FT   sig_peptide     260966..261028
FT                   /locus_tag="Mmcs_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.661) with cleavage site probability 0.371 at
FT                   residue 21"
FT   gene            261773..262636
FT                   /locus_tag="Mmcs_0235"
FT   CDS_pept        261773..262636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0235"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR sugar isomerase
FT                   (SIS); KEGG: mlo:mlr3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06356"
FT                   /protein_id="ABG06356.1"
FT                   /translation="MPSPTGETVAALAAAALPALSRAERRVGRALLADYPSAGLASAAR
FT                   LAERADVSPPTVLRFAHSLGFEGFADLQVSLRAEISAMSSGPITRLPDAPAAGSPLDRL
FT                   LNQARAQNDRALETLAHLPGSSLEAAVALLADQTRPLFLHGGRFSVLLAHHLGAHLEQL
FT                   RPGVRLLADPSGRDLGAMMELTRRDVLVLFDYHRYQASAVDVAARFHRAGAAVVLITDD
FT                   LACPVAPDAEVVLAASSTVGTVYQSMAAGFLLTELLLPLVMEAIGEPARTRMALWEEQR
FT                   RGELLP"
FT   sig_peptide     261773..261844
FT                   /locus_tag="Mmcs_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.723 at
FT                   residue 24"
FT   gene            262680..263336
FT                   /locus_tag="Mmcs_0236"
FT   CDS_pept        262680..263336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0236"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mbo:Mb0244
FT                   possible transcriptional regulatory protein (probably
FT                   TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06357"
FT                   /protein_id="ABG06357.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLDRELGRFVDEVRSKIDFSQGARDLLRNAVLSFLTYIDTNR
FT                   ASWMVLYTQATSSQAFAHTVREGRERIIELVSRLLREGTRHPEPDTDFEMMAVALVGAG
FT                   EAIATRVSTGDADVDEAAELMINLFWRGLKGTPSDAAGQERSDSGMSKGAAVASN"
FT   gene            complement(263340..264428)
FT                   /locus_tag="Mmcs_0237"
FT   CDS_pept        complement(263340..264428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0237"
FT                   /product="hydroxyneurosporene-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: O-methyltransferase, family 2
FT                   Methyltransferase type 12; KEGG: syc:syc1021_d hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06358"
FT                   /protein_id="ABG06358.1"
FT                   /translation="MATPKVPPVRLARAVERLRHVLDRAHQRSAPPSAVMLEKILGAWI
FT                   SQGITVAADLRVADALADGPLPIGELARRVGANPDALARLMRALIGEGVFTQRRDGRYA
FT                   LNALGRTLCTDATMSVAGMARMIGHPAHREHWSQLLDAIRTGEATVPKLRGMPGFEYLS
FT                   ENRELGEIFNDAMTNLSETAVAPLTAAYDFRGFGTIVDVGGGHGRFLSAILAATPSARG
FT                   VLYDLPQVVEGATELLGSHGVADRVEIVGGSFFDSIPAGADAYVAKNVIHDWPDADALT
FT                   ILRNIRSAAGTGATLLLAEFVIPDHHRAFIGNWTDMEMLMATAARERTEAEYRKLYQQA
FT                   GFRLTRVVPTVAPISLIEGKAV"
FT   gene            complement(264434..264832)
FT                   /locus_tag="Mmcs_0238"
FT   CDS_pept        complement(264434..264832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06359"
FT                   /protein_id="ABG06359.1"
FT                   /translation="MIRACLVLSMAAALTVAGTAAAHAQPVPPCTFTLSAPSVVQNADG
FT                   AVVAATVTPLECGWGAEPNYSVACLQLSGNSGPTTCTQSRGRDAARILYAPHIPGAGYT
FT                   ATGRGCGRWVGQPPAHLCQHLGPQNATL"
FT   sig_peptide     complement(264758..264832)
FT                   /locus_tag="Mmcs_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.873 at
FT                   residue 25"
FT   gene            complement(264948..265793)
FT                   /locus_tag="Mmcs_0239"
FT   CDS_pept        complement(264948..265793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0239"
FT                   /product="MaoC-like dehydratase"
FT                   /note="PFAM: MaoC-like dehydratase; KEGG: mbo:Mb0247c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06360"
FT                   /protein_id="ABG06360.1"
FT                   /translation="MGGQPSGTRNLLRAAAGALPFVPRGESLPERTLTVDELAIDPANV
FT                   AAYADVTGLQFGDTVPLTYPFALTFPTVMALVTGFDFPFAAMGSVHIENHITQHRPIAV
FT                   SDTVSAAVHAENLREHRRGLLVDVVTDVKVGNELAWHQVTTFLHQQRTSLSDQPKPPPQ
FT                   KPPKLGPPNALLNITAGQIRQYASVGGDHNPIHTNPIAAKLFGFPTVIAHGMFSAAAVL
FT                   ANIEGQLPGAVEYSVRFAKPVVLPAKAGLYVERTADGGWDLTLRNSKGEPHLTGTVRGL
FT                   "
FT   gene            complement(265795..267156)
FT                   /locus_tag="Mmcs_0240"
FT   CDS_pept        complement(265795..267156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0240"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP3692c FabG4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06361"
FT                   /protein_id="ABG06361.1"
FT                   /translation="MASDIYTQIVHSGPGSFLAKQLGIPQPETLRRYKPGEPPLPGALL
FT                   IAGEGRVVEPLRTALADDYDVVANNIGGRWADKFGGLVYDATGITEPEGLKGLFEFFTP
FT                   LLRNVTPNARLVVIGSDPDVAGTPHEQIVQRALEGFTRSLAKELRRGATASLVYLSPEA
FT                   KTAATGLESTMRFILSGKSAYVDGQVYRVGADDATPPADWDKPLQGKVAVVTGAARGIG
FT                   ATIAEVFARDGAAVVAVDMKAPEGATDELAKVAEKVGGTALTLDVTAPDAVDKIAAHVR
FT                   DHHGGKLDILVNNAGITRDKLLANMDEGRWDSVIAVNLLAPLRLTEGLVDSGVLGEGGR
FT                   VIGLSSMAGIAGNRGQTNYATTKAGMIGLTDALAEKLHDKGITINAVAPGFIETKMTEA
FT                   IPFATREVGRRLNSLYQGGQPVDVAETIAYFANPASNAVTGNTIRVCGQAMLGA"
FT   gene            267267..268568
FT                   /locus_tag="Mmcs_0241"
FT   CDS_pept        267267..268568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0241"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="PFAM: Thiolase; KEGG: mbo:Mb0249 acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06362"
FT                   /protein_id="ABG06362.1"
FT                   /translation="MADSRSMRRVAVLGGNRIPFARSDGAYANASNQDMFTAALGGLVD
FT                   RYHLQGEKLGAVIGGAVLKHSRDFNLMRECVLGSALSSYTPAFDIQQACGTGLQAAIAA
FT                   ADGIAAGRYESAAAGGVDTASDAPIALGDDLRKTLLGLRRAKSNVDRLKLVGKLPAAVG
FT                   IQIPVNSEPRTGMSMGEHAAVTAKEMGIKRVDQDELAAASHRNMAAAYDRGFFDDLVTP
FT                   FLGVYRDNNLRADSSAEKLAKLKPVFGVRHGDATMTAGNSTPLTDGASVALLASEEWAQ
FT                   QHSIEPLAYYVDGETAAVDYVNGRDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFA
FT                   SVVLAHLQAWESEEYCKERLGLDSALGSIDRSKLNVNGSSLAAGHPFAATGGRIVAQLA
FT                   KQLAEKKKQTGQPVRGLISICAAGGQGVAAILEA"
FT   gene            complement(268985..270820)
FT                   /locus_tag="Mmcs_0242"
FT   CDS_pept        complement(268985..270820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0242"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   mpa:MAP3694c FadE5"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06363"
FT                   /protein_id="ABG06363.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVLGVDKAMGQGDFSELDADTAREMLDEM
FT                   ARLAEGPIAESFFEGDRNPPVFDPKTHSVKLPEPFKKSMRALFDAGWDKAGMPEELGGM
FT                   PMPRALQWALIEHVLGANPAAYMYAMGGGMAHILHNLGTEEQKKWAVLAAERGWGATMV
FT                   LTEPDAGSDVGAGRTKAVKQDDGSWHIEGVKRFITSADSDDLFENIFHLVLARPEGAGP
FT                   GTKGLSLFFVPKFLVDFETGELGERNGAFVTNVEHKMGLKVSATCELSLGQHGVPAKGW
FT                   LVGEVHNGIAQMFDVIEQARMMVGTKAIATLSTGYLNALEYAKSRVQGADMTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDTAVAKAVHDVDSELAVRVNDLM
FT                   LPIVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGQALAYVAGQIEQFVKSESGNGRLKAERALLATALEDVQAMAASLTGYLMA
FT                   AQENPAELYKVGLGSVRFLMSVGDLVIGWLLQQQAAVAIGALDGGATGEDKAFYEGKVA
FT                   VASFFAKNFLPLLTSTRQVVEHLDNEIMELDEAAF"
FT   gene            271229..271969
FT                   /locus_tag="Mmcs_0243"
FT   CDS_pept        271229..271969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0243"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: GAF ANTAR; KEGG: sco:SCO7423 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06364"
FT                   /protein_id="ABG06364.1"
FT                   /translation="MTLARITMAADAVASLAAIPAVGESLDEALTRVADGAVAAVANAD
FT                   AVSITVLEPPAGRTVAYTDRRLLPLDKKQYTSRRGPCLEAADTGRAVRVAMASHEQRWP
FT                   EFVAAARTEGVRATLSIPLILASPTDRQDSELVGSLNAYSTTTDDFDLVDETLLGLYTD
FT                   AATQAIAHARGRQHLQDTVAQLERALTSRAEIEQAKGALRVVHACTADEAFALLIERSQ
FT                   RENVKLRDVARRVLKDLSRPTPGE"
FT   sig_peptide     271229..271300
FT                   /locus_tag="Mmcs_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.640) with cleavage site probability 0.604 at
FT                   residue 24"
FT   gene            complement(271988..283069)
FT                   /locus_tag="Mmcs_0244"
FT   CDS_pept        complement(271988..283069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0244"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase acyl transferase region
FT                   NAD-dependent epimerase/dehydratase short-chain
FT                   dehydrogenase/reductase SDR phosphopantetheine-binding
FT                   Alcohol dehydrogenase, zinc-binding Alcohol dehydrogenase
FT                   GroES-like; KEGG: mpa:MAP2230c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06365"
FT                   /protein_id="ABG06365.1"
FT                   /translation="MSHRGRALTADAREDTNGMESAAYPHVPANRFAIVGYAARFPGAQ
FT                   DADEFWDLLRDGREAISEVPQDRWNVDEFFDPEPGAPGKVVTRRAGFVDDVTGFDAPFF
FT                   GMSTREVRLMDPQHRLLLETAWRAVEHSGTAPTDLANSNTGVFVGLATHDYLGMASDEL
FT                   SYPEIEAYMAIGTSNAAAAGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALQLGECD
FT                   LALAGGANVLLTPATMITFSNAHMLAPDGRCKTFDAAADGYVRGEGCGVIVIKRLEDAL
FT                   RDGDRIRAVIRGSAINQDGASGGLTVPNGVAQQRVITDALKRAGVRAGDVGYLEAHGTG
FT                   TSLGDPIEAQAAGEVLGAGREPSRPLLIGSAKTNIGHLEAAAGIAGVIKVILSLEHETL
FT                   PKHLNFTTPSPHIPWDRLAVKVVTESTPWERNGRPRIAGVSSFGFAGTNAHVILEEAPE
FT                   STVTPAATPEPGERFSLLPLSARTPAALVRIADRYRSWMTTHPEATLADVCFTASTARA
FT                   HLEQRAALVVDSRESAVELLGALADDRPAPGLVRGESHDTPKTAWLFTGQGSQYPGMAR
FT                   ELFDTEPVFAETMKQCAAAVADVLEKPLLDVIFDAHGPEAAETLRQTSYAQPALFAVEM
FT                   GLARLWQSWGFEPDVVLGHSVGQYAAACVAGVLGLEDGARLMAERGRLFGSLPAGGRMV
FT                   AVFTAAERVENITDEYPRLSVAAYNGANTVLSGPAGDLEKAVATLAADGIRCDWLDTSH
FT                   AFHSALLDPILDEFESYAQQIEYAAPQRVLIDNRTGAALGWSAKLDGTYWRRHARQPVE
FT                   FAKSVRTLAELNCKVLLEIGPRPVLTAAALSAWPDPATAPRAIASLRRNTADHRQITEA
FT                   LADAYVLGHRPDFAAIQRPDAHKLDLPTYPFEHRQYSFRDNQAERPEQAGPPIHQAART
FT                   EAVGLLEDGRIEELAALLGDTDGDRQTFDVLSKLAAQHNQQRTSQSITDDRYEIRWEEL
FT                   TTASPAATGEPSTWIIVGDDTDAARPLIDAVTARGDRHRLVGSPVSDADEASLADALRA
FT                   SVDDASAPGGAVRILHIAALDATTAPSMRTLLSMQHRILGRTRRLFHAVTTTGLRTPIW
FT                   LITRGAQRVTATDTVAPDQSALWGFGRAASLELPHLWGGLADLPTGPGASEDEWSRLLD
FT                   RIAAPRHSDVTEDQVALRDGAVHVPRLVRRTGQPSGAPLRLRSDATYLVTGGLGAIGLE
FT                   IAGYLAAHGAGNIVLTSRRAPGDAAQQRIDALRDKFGCAIRVATADVADAHDVARLLAG
FT                   VQAELPPLAGIVHAAGEIGTTALSAMDDESQQAEVDRVFAGKVWGAWHLSEAAVDLQLD
FT                   FFISTSSIASVWGGFGQTAYGAANAFLDGLAWRLREQGIAATSVNFGPWSAGMADAESR
FT                   ARLEQRGVRTLDPADALAGLADVVAGPATQGVIARIDWARFLPLYQQAGRRAFLTELER
FT                   EAPVASTDAAPAVTASGKTPLVERLSGAPVQQRKKLLTDYLRDAVAEVTRVDSAEIRED
FT                   AGFFDLGMDSLMAVELRRRLEQGVGKEIPVTLVMDHPRLSDAADYLLGEVLGLAEQAPA
FT                   ESRPALASLASERTDDPIAIVAVSCRFPGAPDPEAFWDLLSGGVDAIREVPEDRFDIDE
FT                   FYDPDPDAAGKTYTRFGGFLDGIDGFDPEFFGISPREAVWIEPQQRLMLETVWEGIERA
FT                   GLSPADLRGSRTGVFVGVAANEYAHLLSSESIEKIEPHFITGNALNAISGRVAFALGLE
FT                   GPAVAVDTACSSALVAVHQAVQALHSGDCDLAVAGGVNVLLSPVTVVAASRARMLSPVG
FT                   RCKTFDASADGYVRSEGCGILVLKRLSDAVRDGDRVCAVIPGTAVNQDGASSGLTVPNG
FT                   GAQQRLIKTALTRAGLTGGDVDYLEAHGTGTPLGDPIEVQAAAAAYGASRDADRPLLMG
FT                   SVKSNIGHLESASGAAGLIKVVLSLQHGVLPQSLHFDNPSPHIPWDSLPVRVVDEAVPW
FT                   QPNGRPRRAGVSSFGFTGTNAHVLVEEAPQAPVSEDQESDTDDQPVHVLPLSARSPEAL
FT                   VALARRYDSWLGAHPDADLAGVCFTAGTGRSHFEHRAAMVVDSVASARQGLADLADNRT
FT                   RPGVVRGEHTNRPTTAWLFTGQGSQYPRMARELFDAEPVFAETVTRCADAVDGMLPLPL
FT                   LEVLFAADRETAERLRHTSYAQPALFAVEMGLARLWQSWGVTPDVVLGHSVGQYAAACV
FT                   AGVFSLEDGARLMAERGRMFGSLPEGGRMVAIFADAKQVEQIAGEFARVSVGAYNGPNT
FT                   VLSGPGEDLEQIVARFADEGIRCTWLETSHAFHSELLDPVLDEFESYAAQFEFAAPTMP
FT                   VVCNRTGAVLTGQTPLDAQYWRRHSRQPVQFAESVRTVATLGCSVLMEIGPQPVLTGAA
FT                   VQIWPEHLAAPRAIASLRKGVGDRRQIADALAAAYVGGLRPDFAALQGQPHHRLELPTY
FT                   PFQRRRFWPKTSSITVDGPATSGILGSAKDLASGDTVYTSRLSVKSQPWLSDHVIYGTV
FT                   VVPGATYAAMALAAVGTPARVKDVFFYEPIILPEKSSREVQLTLHILGDGEQKFQVHSR
FT                   SYGVRDAEWSLNAEGTVVRGVDDAPVSQDDPVDEAIERCNRMRPQELFETFADMELAWG
FT                   PTWSGSLKSLWLGDGEAIGDVLVGAELAEQLGSEPIHPVLMDLCTGVAFPAFPALLAAE
FT                   QGVSDLFLPLRYGQVTVQEKMPRRFYCRAKWHHSELDSETQVFDLDFISRDGRPLGGIR
FT                   EFTVKRAPREALLRGLGGDATRLLYTLGWHEVPLPAVDPAAPNGNWLIAGFDELAASVP
FT                   GCIPFDRTTDPEPLGQLLTQAHERGMAFSGVVWRAAAPKPDESSADVAARIETEIANLL
FT                   SAVHAVQRGEVKLPGGLWIVTERAVACESGEPVDPVQAALWGFGRTTINEEPALRCKLV
FT                   DCDGSPEAVEALSALLTTPVDEPELALRQGKLLASRLLHWARSGHLTVPRSTDYVLAPT
FT                   ERGAIDNLRLTETEVPPPAEGYVQVEVEAAGLNFRDVLNVLGLYPGDPGPIGGDFAGVV
FT                   TQLGDGVGSGRAERRDGIKLEVGQRVYGFMQGAFSSRFNVPAQLLAPIPDGVGAVEAAT
FT                   IPAAALTARLAFDWAQLEPGDRVLIHAASGGVGLAAIQLAQQHGAVVFATASTYKRATL
FT                   RKMGVEYVYDSRSTDFADQILADTDGAGVDVVLNSLTNEGFVEATVRATAQNGRFAEIA
FT                   KRDIWTHEQMAAARPDISYEIVALDTVTIQEPERIRGLLGEVSDGLGKGEWAPLPAEIY
FT                   PLTEARAAFRRMQQARHIGKIVVQMPSPLQPRPDRSYLITGGLGAIGLHTASYLAQLGA
FT                   GDIVLTSRREPDADTQQVIDEITDRHRCRIHTFAADVGDESQVEELLERIRAELPPLAG
FT                   VAHLAGVLDDALLSQQSVERFRTTLAPKAFGAYHLDHLTRDDDLDFFIVSSSVSSLFGS
FT                   PGQANYATANALLDGLVARRRAHGLPATGVNFGPWAQGGMASSEAATANISAQGLVPLE
FT                   PSAALSALAEVVANGTAQATVIKANWQRAAKVLGASRPPLLDLVLPSAAGEVTGDSELL
FT                   RQLQEIPVAQRAGFVTEFLQREVQNFLRLAQPPAASSRFLDLGTDSLMAIELRNRLHSQ
FT                   FGGAFTINATAVFDYPTIGGLAEYLVGQLPDAESPAAETAPAAEVPAAD"
FT   gene            283263..284684
FT                   /locus_tag="Mmcs_0245"
FT   CDS_pept        283263..284684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0245"
FT                   /product="PapA3_1"
FT                   /note="KEGG: mpa:MAP2231 PapA3_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06366"
FT                   /protein_id="ABG06366.1"
FT                   /translation="MRIGKITIGGLDEWALKPGTVTSWHPTPAAAEKARRAPVSSVPIS
FT                   YMQRQHLRNYRERTGAGLNFSRQIIASCEVSGECEIAAMDHAVNNYLRRHDTFRSWFED
FT                   IGDGEFVRHALEDPADIEFVPVHHGSMTVDEIQAHVVGIPSPLEWACFTFGIIQNDGHF
FT                   TFFAAMDHVHGDATLIGTTMLEANGMYSALSGGGEALTLPEAGSFDEFCVRERERTADL
FT                   TVDSKDVQAWIDFADSNGGGFPEFPLPLGNPQEATRSSMTTEVLMDVAQTERFDAACAA
FT                   AGARFVGGLFACLAQVEHELTGALTYYGLTPRDSRNATDNFMTQGWFTGLIPITVPIGA
FT                   GSFADAAWAAQASFDSNLNMAKVPYYRVLELAPWLNWPQPNFPVSNFFHAGAAPLNAVL
FT                   AAADMGLADNIGIYPDGRFSYQLTIYIFRYGEGTVMAIMHPDNPVAEKSVTRYMQAMRT
FT                   VSALVADSGHWGRVA"
FT   gene            284711..287707
FT                   /locus_tag="Mmcs_0246"
FT   CDS_pept        284711..287707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0246"
FT                   /product="Transport protein"
FT                   /note="TIGRFAM: Transport protein; PFAM: MMPL; KEGG:
FT                   mbo:Mb1215 probable conserved transmembrane transport
FT                   protein MmpL10"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06367"
FT                   /protein_id="ABG06367.1"
FT                   /translation="MRRLADLVVRWPWVVIGVWVAMAVALPLSFPSLGEMAQKHPLAIL
FT                   PSDAPSSVAAQKMAEAFQQSESDNLLVVAFINETGLEPADEVTYREVVDALRDDPADVV
FT                   SVQDFVSTPQLRQFLTSEDKTTWVLPVSLQGELGTPRAFDSFNRVSDVVEHKLPDGDTL
FT                   DVYLTGPAATVADLTVAGERDRLPIEIAIAVLVLGVLLLVYRSVVTMLLPLVTIGSSLM
FT                   IAQGVVAAYSHLTGSGVSNQSIVFLSAIMAGAGTDYAVFLISRYHDYLRSGSGFDEAVR
FT                   SAMISIGKVITASAVTVGLTFLVMNFAQMGVFKTIGVSAAIGIGVAYLAGMTLLPAILV
FT                   LAGPRGWVKPRRELTSRFWRRSGIRIVRRPVPHLIASVLVLLLLGGAAGFARFNYDDRE
FT                   VVADSAPSSIGYAALERHFPISQSIPQYILVQSPRDLRTPQALADLEQMASRIAQLPDV
FT                   SLVSGVTRPLGEVPPEFRATFQAGIVGDRLAAGSAQIDQRTGDLDELAAGATTLADTLG
FT                   DVRAQVNEVAPSLQTLLDAVTQVRVEYGGDRLVRDVDTAAKLVKSVNELGLSMGVNFAA
FT                   VRDMFGWIGPVLMALNGNAVCDANPSCVNTRMQFEKLMDAREDGRLERINTLAGELEGL
FT                   DDRQSLNSTVKTLNAAMTNIVKAVDDLGLDSPAEAQKGLRDVRQGADRLASGSRQVAGG
FT                   VDELVEQIKVMADGLDQASTFLLTMRKDAAGSSMAGFNIPAEVLRAVEFQKAAETFISP
FT                   DGHSARYLVQTSLNPFSPEAMDQVNTINDVARGAQPNTTLADASISMGGFPASLRDTRD
FT                   YYERDIRFIIIVTLIVVLLTLAVLLRSLIAPLYLVGSVVLSYFAAIGIGVLTFQVLLGQ
FT                   ELHWSVPPLAFVVLVAVGADYNMLFVSRLRDESPHSVRYGVIRTLGSTGGVITAAGLIF
FT                   AASMAGLLFASIGIVVQGGFVIGVGILLDTFVVRTITVPAIAALVGRANWWPSRVTASP
FT                   GAERIGAHP"
FT   gene            287707..289479
FT                   /locus_tag="Mmcs_0247"
FT   CDS_pept        287707..289479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0247"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpa:MAP2235 FadD21_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06368"
FT                   /protein_id="ABG06368.1"
FT                   /translation="MTPTSESSMLSMLHGRASLRPDDIAFTFTHYDRDPAGAPETLTWA
FT                   QLARRTMSVAREIRQYGSFGDRAVILAPQGLEYVLAFLGAMQAGLVAVPLPLPHRGSGH
FT                   DRVSAVLTDTKPAVVFTTSSTAGDVGDFVDASPLDTVPKIVEIDALNLDAEGEIRLDPA
FT                   GLPATAYLQYSSGSTRLPTGAMISHRNLQANYEQVMRTFFAGDGPSSTTTFVSWLPFYH
FT                   DMGLVLGICVPILSGHPAALTSPVAFLERPARWIRALAENPHAFSAAPNFAFDLAARKT
FT                   SDSDLAGLDLGGVRGIINGAERVEPATLERFADRFAHFDFHDHMLRPSYGLAEATVFVA
FT                   SGTWSETSPAAHFDADELGVGRVVPCAPGKGTALVKYDVPQSPVVRIVDTDTHRQCPDD
FT                   VVGEIWVHGDNVAAGYWSRPPEDQRCFGATLVDPSPGTPGGTWLRTGDLGFIHEGELFI
FT                   VGRIKDLLIIRGRNHHPEDIEATVQEITRGRVAAVSVPVNSTESLVTVIELKEPPVLDE
FT                   DALRRFGELKSDVTAAISNAHGISVGDVVLVASGSIPTTTSGKIRRTASAELYRKDGFA
FT                   RLDGGKGQHGHLAG"
FT   gene            289529..290662
FT                   /locus_tag="Mmcs_0248"
FT   CDS_pept        289529..290662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0248"
FT                   /product="PE-PPE-like protein"
FT                   /note="PFAM: PE-PPE-like; KEGG: mpa:MAP2234 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06369"
FT                   /protein_id="ABG06369.1"
FT                   /translation="MRRLLAFGSALTIIGAAGGFGFGSASADEPPVPPPPAPADGPPPL
FT                   GTPGRAYALGGAHVLGIPYDEYIMRTGSDWFPGLDRQIVDYPAGQVQGHTLERLFPGIG
FT                   RLDDSFPGLGIDGPSVGESVDVGTPNVINAVREGGRGTAIGLSEGAMVLNDVQAKLAYD
FT                   PAAPPPDELSFAMYGDPVARHAFGESFLTQNFPVGSVVPSLDYRIPAPVESQYDTYHFV
FT                   SAYDSIADWPDRPDNWISVANAIVGLATGHTAVAFTEPSMVPERNIRTTVNSRGAKTTT
FT                   FMIPEEHLPLVLPFKYLGVPKDTLMELDSVLKPYVDAGYSRNDDPLTAPITVDPVNGYD
FT                   PAEVTAPATQAAFGGAADPVSQLLSGLQYVLNNQPTG"
FT   sig_peptide     289529..289612
FT                   /locus_tag="Mmcs_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(290711..291379)
FT                   /locus_tag="Mmcs_0249"
FT   CDS_pept        complement(290711..291379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06370"
FT                   /protein_id="ABG06370.1"
FT                   /translation="MWIPLLVMAVAVSLEPFRVGMTVLMINRPQPRRQLLALLAGGFAM
FT                   GLTVGVIVLFVLRPALDSAHFTLPVVQIAVGAVVLVNAALVATGVWGRGRDAVSLADTR
FT                   FGPLATRTRRLLDGRSLWTAGIAGLGIALPSVDYLAALALIVASGAATTVQLGALMVFN
FT                   VVAFALVEIPLLCYLVAPERTRAALSALYEWLRAQGRRGVGALLAVIGCVLLGVGFAGL
FT                   "
FT   gene            291481..291966
FT                   /locus_tag="Mmcs_0250"
FT   CDS_pept        291481..291966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0250"
FT                   /product="flavin reductase-like, FMN-binding protein"
FT                   /note="PFAM: flavin reductase-like, FMN-binding; KEGG:
FT                   mbo:Mb0251 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06371"
FT                   /protein_id="ABG06371.1"
FT                   /translation="MSAIDLNPATLREAFGHFPTGVIAIAAEVDGIRVGLAASTFVPVS
FT                   LDPPLVSFCVQNTSTTWPKLKDLPRLGISVLGESHDAAARTLAAKAGDRFAGLETTSTD
FT                   EGAVFIHGTSVWLDSSVHDLVEAGDHTIVILRVEDITVHPDVAPIVFHRSTFHRLGG"
FT   gene            complement(291978..292139)
FT                   /locus_tag="Mmcs_0251"
FT   CDS_pept        complement(291978..292139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06372"
FT                   /protein_id="ABG06372.1"
FT                   /translation="MTLSHTHSLNDIRTAIRELSTRADLARKQGRPSDAAEIERRIQGY
FT                   REELAQRP"
FT   gene            complement(292201..292953)
FT                   /locus_tag="Mmcs_0252"
FT   CDS_pept        complement(292201..292953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0252"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mpa:MAP3697c probable succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06373"
FT                   /protein_id="ABG06373.1"
FT                   /translation="MSYQAKMRVWRGDDEGGALQDYTVEVNEGEVVLDIIHRLQQTQTG
FT                   DLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSTFGESETVTVTPLRAFPVIRDLVTDV
FT                   SFNYEKAREIPSFTPPKDLQPGEYRMAQEDVNRSQEFRKCIECFLCQNTCHVVRDHEEN
FT                   KKEFAGPRYLMRMAELDMHPLDVHARRAEDSQEVHGLGYCNITKCCTEVCPEHIKITDN
FT                   ALIPMKERVADRKYDPVVWLGNKLFRRK"
FT   gene            complement(292950..294896)
FT                   /locus_tag="Mmcs_0253"
FT   CDS_pept        complement(292950..294896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0253"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mpa:MAP3698c probable succinate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06374"
FT                   /protein_id="ABG06374.1"
FT                   /translation="MAASDPRPGDSSGIERHQYDVVVIGAGGAGLRAVIEARERGLKVA
FT                   VVCKSLFGKAHTVMAEGGCAASMGNTNPKDNWQVHFGDTMRGGKFLNNWRMAELHAKEA
FT                   PDRVWELETYGALFDRTKDGRISQRNFGGHTYPRLAHVGDRTGLEIIRTMQQKIVSLQQ
FT                   EDKEELGDYEARIRVFAECTVTDLIKDGDRIAGAFGYWRESGSFILFDAPAVVLATGGI
FT                   GKSYKVTSNSWEYTGDGHALALRAGATLINMEFIQFHPTGMVWPPSVKGILVTEGVRGD
FT                   GGVLKNSDGKRFMFDYIPDVFKGQYAESEDEADQWLKDNDSARRTPDLLPRDEVARAIN
FT                   TEVKEGRGTPHGGVYLDIASRMSSEEIKRRLPSMYHQFMELAEVDITTDEMEVGPTCHY
FT                   VMGGIEVDPDTGAAKTPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGASDYVR
FT                   ALGNRPTVSEEAVEAALKLALAPFDGPSEGQPENPYTMQLDLQDTMNELVGIIRKADEI
FT                   IEAQGKLDELRDRFKRMKVEGNRHFNPGWHLAIDLRNMLLVSECVAKAALERTESRGGH
FT                   TRDDYPSMEAEWRRTLLVCRAQGDDVVVPSVTVTREDQVPMRDDLLELLDIEELQKYYT
FT                   DEELANHPARRGS"
FT   gene            complement(294938..295756)
FT                   /locus_tag="Mmcs_0254"
FT   CDS_pept        complement(294938..295756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0254"
FT                   /product="putative succinate dehydrogenase (membrane anchor
FT                   subunit) (succinic dehydrogenase)"
FT                   /note="KEGG: mbo:Mb0255c putative succinate dehydrogenase
FT                   [membrane anchor subunit] (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06375"
FT                   /protein_id="ABG06375.1"
FT                   /translation="MSAPTADREGTGVYSAGRAKIPQRTLRTDRWWVPSLLTNLGLAAF
FT                   VVYATIRAFWGSAYWVADYHYLTPFYSPCVSKGCIPEASHFGQILPDVWWLPYAAFSLP
FT                   FLLLFRLTCYYYRKAYYRSVWQSPPGCAVAEPHSTYTGETKLPLIMQNLHRYFFYVAVL
FT                   ISLINTWDAILAFHSPSGFGFGLGNVILVVNVVLLWTYTISCHSCRHVTGGRLKHFSKH
FT                   PVRYWMWTQISKLNTRHMQFAWITLGTLVLTDFYVMLVASGTISDLRFIG"
FT   gene            complement(295854..296210)
FT                   /locus_tag="Mmcs_0255"
FT   CDS_pept        complement(295854..296210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3700c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06376"
FT                   /protein_id="ABG06376.1"
FT                   /translation="MWLASVAYCDSRHPSAQGGHLSTTTGFAELHELIGGLRRCVTALA
FT                   SQYGDSPAMRRIVNDAERILNDIDRLDIDAEELELGRGLSRHHHVGEKIPIPDTQYDTE
FT                   FWRGVDDEGLGGTH"
FT   gene            296261..297019
FT                   /locus_tag="Mmcs_0256"
FT   CDS_pept        296261..297019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa49070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06377"
FT                   /protein_id="ABG06377.1"
FT                   /translation="MPNHDLKQLADALLALHQPGNPVVLPTVWDAWSANLAVGAGFAAL
FT                   TVGSHPVADSVGRADNEGMTFDELLTRVAQITDAVDVPVSVDIESGYGEAPTRLIEGLL
FT                   GVGAVGLNIEDTVHGEGGRLRSAGEHAELVGALRAAADDAGVHVVVNARTDLFLRKDGD
FT                   DADRVDRAVARLKEAAEAGADVLYPVGRHDPDTQRRLTSELPLPVNAIGIPDQDDPASF
FT                   GPLGVARISFGPFLQAALATRANELLARWK"
FT   gene            complement(297116..297562)
FT                   /locus_tag="Mmcs_0257"
FT   CDS_pept        complement(297116..297562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0257"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mpa:MAP3701c
FT                   Hsp"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06378"
FT                   /protein_id="ABG06378.1"
FT                   /translation="MSNVALRVRPAWDLDRWVRDFFGPAAANDGFGGTAAPGFSPAAEI
FT                   ARDGDDATVRVELPGVDVDKDVTVEVDNGQLVIHGERRDERSEEKDGRTLREMRYGSFR
FT                   RSFRLPQHVTGDAISASYDAGVLTVRVAGAYAGAQPQRIAIENK"
FT   gene            297720..300362
FT                   /locus_tag="Mmcs_0258"
FT   CDS_pept        297720..300362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0258"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: Nitrite reductase [NAD(P)H] large subunit,
FT                   NirB; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin-like nitrite and sulphite
FT                   reductase 4Fe-4S region BFD-like [2Fe-2S]-binding region;
FT                   KEGG: mpa:MAP3702 nitrite reductase (NAD(P)H) large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06379"
FT                   /protein_id="ABG06379.1"
FT                   /translation="MGPSHEATSRQYTIPSLAPMSTSISNGPARNVVVVGHGMVGHRFV
FT                   EALRARDDADAWRITVLAEETDAAYDRVGLTGYTEHWDRALLALAGNDYAGDDLVDLRL
FT                   GQRVTSIDRAARTVKTADGTAFAYDALVLATGSYAFVPPVPGRDLPACHVYRTFDDLDA
FT                   IRADAARARETSRAPVGVVIGGGLLGLEAANALRGFGLTAHVVERSPRLMSQQLDDAGG
FT                   ALLSRMIADLGIEVHLDVSTDAITPAQRNRPLRRSEEDDSLRVMLGDGSFIDAGVVVFA
FT                   AGVRPRDELARDAGLVIAERGGVLTDLGCKTSDPSIYAVGEVAAIEGRCYGLVGPGYTS
FT                   AEVVADRLLGGAAEFPEADMSTKLKLLGVDVASFGDAMGRTPDCLEVVVNDAVNQTYAK
FT                   LVLSDDAKTLLGGVLVGDASAYGVLRPMVGEQLPGDPMALIAPAGSGGADGGLGVGALP
FT                   AAAQICSCNNVTKGDVTDAIAGGCCDVPGLKACTKAGTSCGSCVPLLKQLLEAEGVEQS
FT                   KALCEHFSHSRAELFEIVSATEIRTFSGLLERFGTGKGCDICKPTVASILASTSSEHIL
FT                   DGEQAALQDSNDHFLANIQRNGSYSVVPRVPGGDITPEQLILIGEIARDFDLYTKITGG
FT                   QRIDLFGARVEQLPEIWRRLVEGGMESGHAYGKALRTVKSCVGSDWCRYGQQDSVQMAI
FT                   NLELRYRGLRAPHKIKMGVSGCARECAEARGKDVGVIATEHGWNLYVGGNGGMTPKHAQ
FT                   LLAGDLDDETLIRYVDRFLMFYIRTADRLQRTAPWVEQLGLDHLREVVCDDSLGLASEF
FT                   EAAMARHVEGYACEWKGVLEDPDKLSRFVSFVNAPDVPDPTVTFTENAGRKVPVPIGMP
FT                   SIRPLQETP"
FT   gene            300359..300730
FT                   /locus_tag="Mmcs_0259"
FT   CDS_pept        300359..300730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0259"
FT                   /product="Nitrite reductase (NAD(P)H) large subunit, NirD"
FT                   /note="TIGRFAM: Nitrite reductase [NAD(P)H] large subunit,
FT                   NirD; KEGG: mbo:Mb0259 probable nitrite reductase [NAD(P)H]
FT                   small subunit NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06380"
FT                   /protein_id="ABG06380.1"
FT                   /translation="MTLLDDRNELNGPPDTRWTVACRYDYLIPCRGVGVLLPDGAQAAL
FT                   FRLDDGSLHAIGNIDPFSGAAVMSRGITGDRGGRAIVQSPIKKQAFAFDDGSCLDDPSV
FT                   SLPVYRTRRTADGIVEIEA"
FT   gene            complement(300734..301303)
FT                   /locus_tag="Mmcs_0260"
FT   CDS_pept        complement(300734..301303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06381"
FT                   /protein_id="ABG06381.1"
FT                   /translation="MNIHRILAGVEEVKSLDAPAHASARIASQVVDGARLGHVLRGSWL
FT                   GHPVHPLLVTLPIGTWMTSVVFDVVFKDVATARRLVGVGLVATPPTVLAGWADYVLLNK
FT                   RQQRVGLVHAVSNAVGVTLFGLAYRAYRKEKVRTARVYSLLGLGAISVGGALGGHLSYA
FT                   QGAGVFRWQPVRALTHRSPVEYRRAA"
FT   gene            301376..302071
FT                   /locus_tag="Mmcs_0261"
FT   CDS_pept        301376..302071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0261"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR; KEGG: mpa:MAP3264c hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06382"
FT                   /protein_id="ABG06382.1"
FT                   /translation="MTAGVERLDEVLEHCLRHSTRRAQADLTGVLAGLTALAVSHLPGV
FT                   DHASVTLMADDDDIRCLAATDGHPLVLDNVQRGCGQGPCLDAATEHLRADDLTDESRWP
FT                   AFTAKSVDATPVRAILALPVFRDGRSSATLNLYADRPRGLDARTESSGAIVASHVAEAM
FT                   TAAYRTRSHGRSPRSTVINQAKTLLMRDFDVDVAQAYALLVKLAKQQNDSIEAVARQVV
FT                   AADGPSGRN"
FT   gene            complement(302075..302770)
FT                   /locus_tag="Mmcs_0262"
FT   CDS_pept        complement(302075..302770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0262"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mpa:MAP3705c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06383"
FT                   /protein_id="ABG06383.1"
FT                   /translation="MSAPANRILVAHGTRKSSGVALIGDIADRVAATLGSPVGVAFVDV
FT                   LGPTPSDVLSALPDRPAVLVPAFLSRGYHVRSDIPAHVAASGHPDVTVADALGPDAQLV
FT                   RVVGDRLIESGWAPGDSVILAAAGTSDPLALRDLHTTAASLSAVTGARVDLAFAATGRP
FT                   RVDEAVAAARRSGARRVVVASYLLADGLFQDRLRASGADIVTAPLGTHPGLVRLIASRF
FT                   RRARIPIAA"
FT   gene            complement(302767..303915)
FT                   /locus_tag="Mmcs_0263"
FT   CDS_pept        complement(302767..303915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0263"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: transcriptional regulatory protein-like
FT                   Uroporphyrinogen III synthase HEM4; KEGG: mpa:MAP3706c
FT                   uroporphyrinogen-III synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06384"
FT                   /protein_id="ABG06384.1"
FT                   /translation="MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMV
FT                   PLPDDDELRAHTQALIDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSR
FT                   GPKATGALRAAGLPEEWSPDSESSREVLRYLLDGGIADKRIAVQLHGATDDWDPFPEFL
FT                   DELRAAGADVVPIRVYRWRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATE
FT                   MGVADRVLTALRTNVHAMCVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQA
FT                   RTVRVAGHLLEIRGTCVLVDGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGT
FT                   DTHAVETAVLRLRTALGDKQIVSTVVKRGYRLTVDDDLAEAL"
FT   gene            complement(304048..305442)
FT                   /locus_tag="Mmcs_0264"
FT   CDS_pept        complement(304048..305442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0264"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mbo:Mb0267c probable integral membrane nitrite extrusion
FT                   protein NarK3 (nitrite facilitator)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06385"
FT                   /protein_id="ABG06385.1"
FT                   /translation="MSHRITDWDPEDTIAWEAGNKYIARRNLIWSVAAEHIGFSVWSIW
FT                   SVMVLFMPEAVYGFSAGDKFLLGATATLVGACLRIPYTLATARFGGRNWTVFSAFVLLI
FT                   PTLGTMVLLANPGLPLWPYLLCAALAGFGGGNFASSMTNINAFYPQRLKGWALGLNAGG
FT                   GNIGVPMIQLVGLLVIATAGNRQPYWVCAVYLVALAVAGIGAALYMDNLEQHKIDFTAM
FT                   KDILRERDTWVISLLYIGTFGSFIGFAFAFGQVLQINFAARGQSPAEASLHAAQIAFVG
FT                   PLLGSLSRVYGGRLADRIGGGRVTLAVFAGMILAAGVLVTVSTLDDGSPGAATAATMIG
FT                   YVVGFIALFLLSGIGNGSVYKMIPSIFEARSRSLDAGEEQRVAWSRAMSGALIGFAGAI
FT                   GALGGVGINLALRQSYLSSGSATTAFWIFAVFYVVASAVTWVMYVRRPSGDASVDRASR
FT                   PDLART"
FT   gene            complement(305538..306161)
FT                   /locus_tag="Mmcs_0265"
FT   CDS_pept        complement(305538..306161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0265"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mbo:Mb0268c aminoglycoside 2'-N-acetyltransferase AAC
FT                   (AAC(2')-IC)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06386"
FT                   /protein_id="ABG06386.1"
FT                   /translation="MAGTPRWYNDGVLPQLSSEVRGHGVIHTARLVHTADLDNETREGA
FT                   RRMVSEAFRGDFTDDDWEHALGGMHALICSHGVLIAHAAVVQRRLLYRDAALRCGYIEA
FT                   VAVREDCRGQGLGSAVMDACEQVLRGAYQLGALATSTMARPMYRARGWVPWRGPTSVLS
FT                   PGGRISTPGDDGSVFVYPVGSALGSTDLDTTAELTCDWRHGDVW"
FT   gene            complement(306176..307117)
FT                   /locus_tag="Mmcs_0266"
FT   CDS_pept        complement(306176..307117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0266"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mpa:MAP0084c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06387"
FT                   /protein_id="ABG06387.1"
FT                   /translation="MQNSQVNRLFRRGGSTATPPPAAAPAWFAAAVGQRPRHHTIEVEG
FT                   CPIRVRAWGDPGNPPLVFVHGGGAHSGWWDHIAPFFTRTHTVVAPDLSGHGDSGTRQSY
FT                   AVAAWAREVLASASVSGSSARPTIVGHSMGGWVTAAAATRYGAQIDSVLIIDSPLRDRA
FT                   PEENRLRNRRRDSPGYRTEAEILARFKAVPAQEVTLPYIADPIARQSVRHTDNGWVWKF
FT                   DPEIFGGDLLEQTAAEHEIVEETFTRLPCRVGYLRCENGIVPPAMAEQIRSILQLRGPF
FT                   VELAEAGHHPMLDQPLPLVATIRTLLEFWSIT"
FT   gene            complement(307125..308003)
FT                   /locus_tag="Mmcs_0267"
FT   CDS_pept        complement(307125..308003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0267"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; KEGG:
FT                   mtc:MT0276 urea amidolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06388"
FT                   /protein_id="ABG06388.1"
FT                   /translation="MTTLEILNTGPLALVEDLGRPGLAHMGVTRSGAADRRAHALANRL
FT                   VANPGDRATVEVMFGGLTARVRGGDVTVAVTGADTDPAVNGKPFGTNSIHYAHDGDVIS
FT                   LGMAQAGLRSYLAVRGGIDVAPVLGSRSYDVMSAIGPQPLKPGDVLPVGEHTEDFPELD
FT                   QAPVAAIDDDVLELMVVPGPHDDWFVDPEFLVRTNWQVTNRSDRVGMRLVGMPLDYRWP
FT                   DRQLPSEGATRGAIQVPPNGLPVILGPDHPVTGGYPVIAVVVDEDIDKASQARPGQTVR
FT                   LHWSRPRKPFA"
FT   gene            complement(308042..308707)
FT                   /locus_tag="Mmcs_0268"
FT   CDS_pept        complement(308042..308707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0268"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   mle:ML2549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06389"
FT                   /protein_id="ABG06389.1"
FT                   /translation="MTAVPDVMEPMVLGTVLDYGDRALLLQFDDTAQVLAWTDAVRAAG
FT                   LPGVVDIVPGSRTVLVKLDGPRYQAPTRQRLAALRIDRGAVAESASPPDRADAVIDVVY
FT                   DGADLADVARLTGMDTDQVVAAHTGTLWRVGFGGFAPGFAYLVGGDERLHVPRRAEPRT
FT                   KVPAGSVGLAGEFSGVYPRESPGGWQLIGHTDAVLWDVDRENPALLTPGMWVEFRVAE"
FT   gene            complement(308782..309462)
FT                   /locus_tag="Mmcs_0269"
FT   CDS_pept        complement(308782..309462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0269"
FT                   /product="protein of unknown function DUF165"
FT                   /note="PFAM: protein of unknown function DUF165; KEGG:
FT                   nfa:nfa2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06390"
FT                   /protein_id="ABG06390.1"
FT                   /translation="MTVAPTDHRGSATIGSAYYPTLVAVFTGLVLISNVAATKGVAFGP
FT                   LLTDGGFLVFPLTYVIGDVLSEVYGFRAARRAVFIGFAMQALAVLVLWTTVRLPGAPDY
FT                   ANQDALATTVAAITGLAVAGLSGFLVGQLVNAWVVVQVKQRTKEQYLWARLLGSTVVGQ
FT                   FADTLVFCAIAAPIIGFGNMGSFAVYAALGWVYKTVIEAAMLPVTYRVIATIKRREPTY
FT                   EPAV"
FT   gene            complement(309475..310440)
FT                   /locus_tag="Mmcs_0270"
FT   CDS_pept        complement(309475..310440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0270"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: periplasmic binding protein; KEGG: mpa:MAP3710c
FT                   probable periplasmic iron-transport lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06391"
FT                   /protein_id="ABG06391.1"
FT                   /translation="MSTAWSRRNFLAMTATLAGSTVLAGCGGDAPGTVAKDGSVTVTHA
FT                   FGETRIPGPPTRVVSAGLTEQDDLLAVEVVPIAVTDWFGGEPFGVWPWARGQLGPAQPT
FT                   VLSLGDGIQIEAIRALNPDLIVATNAGLDADTYTTLSEIAPTVAQSGSAAFFEPWKDQA
FT                   TIIGQAVFKADEMAALIARVDEKFTNAASANPQFGGKKALLLRGPLYRDSVQAVRPGWR
FT                   TDFLTQMGFTVADPGDPLIPRDRMASVLDAADVLIWTTESEQEQGALLADPTIAGLKAV
FT                   AGGRTIFTDKELAGAIAFASPLSYPLVADRLPPLLAQILA"
FT   sig_peptide     complement(310366..310440)
FT                   /locus_tag="Mmcs_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.414 at
FT                   residue 25"
FT   gene            complement(310486..311283)
FT                   /locus_tag="Mmcs_0271"
FT   CDS_pept        complement(310486..311283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0271"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nfa:nfa54820 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06392"
FT                   /protein_id="ABG06392.1"
FT                   /translation="MRTPKSVFITGAAAGIGRKTAIAFARKGYTVGAFDIDEVGLKTLT
FT                   EELDRVQTPVVTGHLDVTDSDEMSQRIEEFTQVTGGRLDVLINNAGILRAGRFEELDLA
FT                   GHFKEIDINAKGVVNGLYAAFPHLRNTPGSVVVNLASASAIYGQAELANYSATKFFVRG
FT                   ITEALDLEWNRYGIRVIAMWPLYVQTAMTDNIKTGTTDSLGIRLTAQDIADAIVAAVEP
FT                   TALRRALHQVHFPVGAQSKVLATGARFSPAWLTRLVNKKLAHS"
FT   gene            complement(311595..312194)
FT                   /locus_tag="Mmcs_0272"
FT   CDS_pept        complement(311595..312194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0272"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mbo:Mb2008 probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06393"
FT                   /protein_id="ABG06393.1"
FT                   /translation="MTYPVVLGFLSALTLIAAIGAQNAFVLRQGIRGEHVAAVVALCTV
FT                   SDVLLIGAGIAGFGALVTAHPAALDIARFGGAAFLIGYGLLAARRAARPAALTPSEQGP
FT                   ARLVGVLVTCAALTWLNPHVYLDTVVLLGALANEHREDRWLFGVGAVTASAVWFTALGF
FT                   GARRLGGLFSAPSTWRVLDALIAMIMIALGVAVALG"
FT   sig_peptide     complement(312120..312194)
FT                   /locus_tag="Mmcs_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.455 at
FT                   residue 25"
FT   gene            312459..313229
FT                   /locus_tag="Mmcs_0273"
FT   CDS_pept        312459..313229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0273"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mpa:MAP0757 putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06394"
FT                   /protein_id="ABG06394.1"
FT                   /translation="MNRADLDRPLGAVGGLFGMALDAVRFTFRRPFQAREFLEQSWFVA
FT                   RVSLAPTLLVAIPFTVLVSFTLNILLRELGAADLSGAGAAFGAVTQVGPLVTVLIVAGA
FT                   GATAMCADLGSRTIREEIEAMEVLGINPVARLVTPRMLASGLVALLLNSLVVIIGIVGG
FT                   YAFSVFVQDVNPGAFAAGITLLTGIGEVIISCVKAALFGLIAGLVACYRGLSINRGGAK
FT                   AVGNAVNETVVYAFMALFVINVVVTAIGIRMTAG"
FT   gene            313233..314090
FT                   /locus_tag="Mmcs_0274"
FT   CDS_pept        313233..314090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0274"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mpa:MAP0758 putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06395"
FT                   /protein_id="ABG06395.1"
FT                   /translation="MGTLTTLGTAYPRVVSQFRKPASLVGRLGDHILFYGRALAGTPHA
FT                   AMHYRKEIVRLIAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGDIGIEAL
FT                   TGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEVDALETMGIRPIEYLVS
FT                   TRIIAGMIAITPLYSVAVILSFLASQLTTVVLFGQSGGLYDHYFNTFLNPVDLLWSFLQ
FT                   AILMALTVLFIHTYFGYFATGGPAGVGVAVGNAVRTSLIVVVAVTLLVSLSVYGSNGNF
FT                   NLSG"
FT   gene            314104..315291
FT                   /locus_tag="Mmcs_0275"
FT   CDS_pept        314104..315291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0275"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP2189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06396"
FT                   /protein_id="ABG06396.1"
FT                   /translation="MKSISARNVAGTLAVVYIAAIVALAVGLFNGSFTRSATVTVVSDR
FT                   VGLVMNPDAKVKLHGAQVGKVAAIEALPDGRAAIRLAMDPSQLAIIPSNVLVNVGSTTV
FT                   FGSKAVELVPPANPSPDPLRAGQVLDAGHVTVEINTVFEQLVSVLAKVEPAKLNETLGA
FT                   LSQGLAGRGEKFGRTLVDLDTLLADLDPSMDNLSRDIAVAPGVLNAYADAAPDLLATAD
FT                   NASRISDTLVERQSDLDALLVSAIGLAEVGNDVVATNRGAFTDVMRLLVPTTDLTNQYH
FT                   TALNCGLAGMLPLAMAPPPPVPGVLLLDSFVLGTERYRYPQNLPKVAARGGPQCVGLPD
FT                   VGYETRAPYVVSDIDANPAQYGNQGILLNSEGLKQMLFGPLDGPPRNTSQIGQPG"
FT   sig_peptide     314104..314181
FT                   /locus_tag="Mmcs_0275"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.707 at
FT                   residue 26"
FT   gene            315288..316313
FT                   /locus_tag="Mmcs_0276"
FT   CDS_pept        315288..316313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0276"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP2190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06397"
FT                   /protein_id="ABG06397.1"
FT                   /translation="MRRLGPTVVKFGVFAVVMVLFTAALVAIFGQYRAGSANEYSAVFG
FT                   DASSVKSGDSVRIAGIRVGTVNGVSLQPDNTVVVDFDARTDVVLTTGTRVAVRYLNLVG
FT                   DRYLELVDGPGATQIQPAGSRIPKDRTEPALDLDLLLGGLKPVIRGLNPEDVNALTHSL
FT                   IQILQGQSGDIESLFARTSSFTNSIAANGETVRQMIDHLNTVVETMSRDGDKFSGAVAR
FT                   LEELVTGLAQDRDPIGAAIESLDKGTASLADLMTEARPPLAGSIDQLNRVAPLLEKDKE
FT                   LLDISLQKAPGNYRKLVRLGAYGSWLNQYLCGLSVRVTDLQGRTAYFPWIKQDTGRCAE
FT                   P"
FT   sig_peptide     315288..315392
FT                   /locus_tag="Mmcs_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.400 at
FT                   residue 35"
FT   gene            316313..317395
FT                   /locus_tag="Mmcs_0277"
FT   CDS_pept        316313..317395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0277"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06398"
FT                   /protein_id="ABG06398.1"
FT                   /translation="MLKYGGSSSVRAGFIGLVLIVLVIVVGLQPQQLWSMATSVKYRAV
FT                   FAEAGGLAAGNDVKVSGVTVGTVSDVVLDKGKALVTFSLDGKVRLGSDSTAHIRTGTLL
FT                   GERMLTVEPKGSRRLGPMEAIPVSRTSSPYSLTEAVSDFTANTADTDTATLNQSLDILS
FT                   ETIDRLAPQLGPTFDGLTELSRSLNDRDETLGDLLAGAADVTAILSERSQQVNTLLLSA
FT                   NDLLAVLEQRRYAIVNLLANTSAMSQQLTGLVRDNEQELAPALEKLNSVSEMLERNRDN
FT                   IGKALNGLAKYQVTQGEAVNNGFYYNAFIGNLIPGGALQPFLDYALGYRRGVNAGQPPD
FT                   NAGPRAEFPLPYNGIPGGSR"
FT   gene            317392..318828
FT                   /locus_tag="Mmcs_0278"
FT   CDS_pept        317392..318828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0278"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06399"
FT                   /protein_id="ABG06399.1"
FT                   /translation="MIGRTKSAKVLTVALVALLAAGAAVIVRQEFFAPRTITAYFTSAT
FT                   SIYPGDEVRVVGVRVGTIESIEPVGEQARFTLAVDRGVSIPADAKAIIVAPNLIAARYV
FT                   QLTPAYESSGPVLPDDAVIGVERTAIPVEWDEVKEQLARLASELGPSGGVSDTSVSRFI
FT                   DSAANAMAGNGDKLRETISQLSGVGRILADGSGNIVDVIKNLQVFVTALRDSNVQIVQF
FT                   QDRLATVSSVVDGSRAEMDSALTNLAEAVGEVQRFIAGSRNQTAEQIQRLANVTQNVAD
FT                   NRVALENVLHVAPNAIGNGYNIYHPDTGTMLGGFAMGNFANPVQLICSAIGAVRNATAP
FT                   EASRICAEYLGPALRLLNFNYLPMPINAYLKKSPSPENLVYSDPALAPGGAGGSPTPPE
FT                   TPPAVSAFTGGGDVPPPAGWGTPPGPPGTYAPHGLPANPTPALLPGAPIPAGPSAPATL
FT                   DDMLLPAEAPPSPPQEGPPA"
FT   sig_peptide     317392..317463
FT                   /locus_tag="Mmcs_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.685 at
FT                   residue 24"
FT   gene            318825..320024
FT                   /locus_tag="Mmcs_0279"
FT   CDS_pept        318825..320024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0279"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06400"
FT                   /protein_id="ABG06400.1"
FT                   /translation="MIGRRSTLRVAAVAACVTVIASGCTFDGLNSIPLPGTVGTGSGAT
FT                   TYRVQLANVGTLESNSPVMVSDVVVGTVGKMTLRGWHADVEVTVRPETVIPANAVATVG
FT                   QTSLLGSMHLALDPPVGKLPSGRLQPGTTLGLDRSSTYPSTEQTLSSLSVVVNGGGLGQ
FT                   AGDIIREFNATLNGREDKLRDLLVRLRDFVGMLDTQRDDINASLAALNRLGGTLAGQRE
FT                   VITSALQRIPPALDVLIAERPRLTTALDKLRIFSDSATGLVEDTQADLVRNLKNLEPTL
FT                   KALADVGPNLGTALAYAPTFPYTQGFIDRAIRGDYMNQFIIFDFTIPRLKRGLFLGTRW
FT                   GEEGTPMVPAPGDPWYLNYTLDPLNAPVAPPTAVAPVPELTETSDGVDTVDPSPSAGGN
FT                   "
FT   sig_peptide     318825..318896
FT                   /locus_tag="Mmcs_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.714 at
FT                   residue 24"
FT   gene            320024..321562
FT                   /locus_tag="Mmcs_0280"
FT   CDS_pept        320024..321562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0280"
FT                   /product="Mammalian cell entry"
FT                   /note="TIGRFAM: Mammalian cell entry; PFAM: Mammalian cell
FT                   entry related; KEGG: mpa:MAP2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06401"
FT                   /protein_id="ABG06401.1"
FT                   /translation="MLTRFVRTQLIIFTVTAVVAMGVMIFGYLQAPTLLGIGRMTVTVE
FT                   LPGTGGLYRFSNVTYRGVEVGKVTDVRATRQGAVATLSLGTNQDIPADLHAAVRSVSAV
FT                   GEQYVDLQPRTGSAPYLHDGSVIGVENTSIPQAVGPMLDEVSAMIDSIPKDKISGLLDE
FT                   SAKALNGSAYDLGSMLDSSATVVGDAKGVSGEMRSLIDDSGPLLEGQAQTADQLRTWAR
FT                   SLAGVTGQVAANDPQVRTLLGTGPGAADEASRLLNAVKPTLPVLLANLTTIGQVAVTYH
FT                   ASIEQLLVLLPPYVAATQTVGVSRNNPTGMSLGDFTLNLNDPPACTVGFLPPSSWRSPD
FT                   DESDIDTPDGLYCKLPQDSPIGVRGARNYPCMGQPGKRAATAEQCASDKPFEPLAMRQH
FT                   VLGPYPFDPSLVAQGIPPDDRVDSDEQLYGPVGGTPMPPPSPEPAPAPGGPAVAPSAFT
FT                   PGESGGPSVAIATYDPQTGKYATPDGKVFTQPALGSKDAGGQNKTWQDLLPTGA"
FT   sig_peptide     320024..320116
FT                   /locus_tag="Mmcs_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.629) with cleavage site probability 0.389 at
FT                   residue 31"
FT   gene            complement(321567..322061)
FT                   /locus_tag="Mmcs_0281"
FT   CDS_pept        complement(321567..322061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0766c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06402"
FT                   /protein_id="ABG06402.1"
FT                   /translation="MVTTVGALAAVASLAHPATASADPEWGLNGTYSATSNGEWAKKNE
FT                   VFRDEATVRAVWTIDTVCSYPTECTGTVRSDQGWEAPIYKKGGIWYVKHTVPRWEPCPD
FT                   GTAADGLQVFRFVPTVPDGSMTDPASTTLTGEDQTTGPSGACGVSRPLFITMPFKLVKL
FT                   S"
FT   sig_peptide     complement(321993..322061)
FT                   /locus_tag="Mmcs_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.639 at
FT                   residue 23"
FT   gene            322201..322581
FT                   /locus_tag="Mmcs_0282"
FT   CDS_pept        322201..322581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06403"
FT                   /protein_id="ABG06403.1"
FT                   /translation="MRTPVFVVSAVVTAAVFASAPAGADPLGCEEPACVPGIAGNVTLG
FT                   APCANTSHFVFGTTDWGRLVFCGSPRRYAPRYFRSPPMEGIRVENTNCTGFENSVAQAP
FT                   DGLFLSCVASSGESLWVRGDNA"
FT   sig_peptide     322201..322275
FT                   /locus_tag="Mmcs_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.970 at
FT                   residue 25"
FT   gene            322578..322982
FT                   /locus_tag="Mmcs_0283"
FT   CDS_pept        322578..322982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0776c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06404"
FT                   /protein_id="ABG06404.1"
FT                   /translation="MNRFAAPAAIAGLILGMAPQASAQGPVPHHVRYTVTADQPTKADI
FT                   YYRAVDPPNWADYSHNPYRFSPKAEVVLDPASPWVFDTTLVDPNRWAMVTATSGVGPDQ
FT                   PHFRCELAVDGVVVASHEGPKGALCSQRSW"
FT   sig_peptide     322578..322649
FT                   /locus_tag="Mmcs_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            322986..323615
FT                   /locus_tag="Mmcs_0284"
FT   CDS_pept        322986..323615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0284"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: mtu:Rv1363c possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06405"
FT                   /protein_id="ABG06405.1"
FT                   /translation="MIDSIETRALAEEAEAEAAEALAEAARARAERLRAEAAEPQDKRR
FT                   RLRRPGWSTVVAVLAVFVTAASLAASGYVTWHHREAMHRQQQSAEFEAAARQIAITLMS
FT                   IDAAKAEESVKQILDSSTGQFHEEFKSASEDFVKLTQDGKVVTDVKVKAAAVESMTEDS
FT                   ATVLVTTTSTVTNAAGADKQPRAWRLSVDIVRDVGRLKMSKMEFVP"
FT   gene            323630..324118
FT                   /locus_tag="Mmcs_0285"
FT   CDS_pept        323630..324118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06406"
FT                   /protein_id="ABG06406.1"
FT                   /translation="MRQARWRLILTVLIAAASVGLAVVLYVTQYRTDVQTDGAAASAAV
FT                   RAASEGTVALLSYQPDSVDTDLTAAKTHLTGEFLTYYGKFSDEILLPAARERAVRSEAA
FT                   VVRAAEAEIHPDAAKVLVYVNQTTTSRERPDASQTASSVMVSLTKVGERWLISAFDPI"
FT   sig_peptide     323630..323698
FT                   /locus_tag="Mmcs_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.928 at
FT                   residue 23"
FT   gene            complement(324115..324696)
FT                   /locus_tag="Mmcs_0286"
FT   CDS_pept        complement(324115..324696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0286"
FT                   /product="thioesterase superfamily"
FT                   /note="PFAM: thioesterase superfamily; KEGG: nfa:nfa33640
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06407"
FT                   /protein_id="ABG06407.1"
FT                   /translation="MNDGHEPLTESVRSLIDAVIRTEVDPEKIAAAHAHVAAALDILGE
FT                   QMMPGAYGVRAAPDGRRAPRGNVLIGERNAIAPPLIVDRDEAGLVSTEVDLGAAYEGPV
FT                   GHVHGGVCSLILDHLLGATAHRPDRPAFTGTLQLRYVRPTPLGPLRAEAWVEHEDGRKT
FT                   YARGRILSAGQTTVEAQGVFIRPRADRSAD"
FT   gene            complement(324693..326237)
FT                   /locus_tag="Mmcs_0287"
FT   CDS_pept        complement(324693..326237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0287"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like; KEGG: nfa:nfa22440 putative
FT                   3-ketosteroid 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06408"
FT                   /protein_id="ABG06408.1"
FT                   /translation="MSAFDEEVDVVVVGSGGGVAGAYTAAREGLSVALVEATERFGGTT
FT                   AYSGGGGMWFPCNPVAQRAGIDDSPEDALAYFHRVVGDRTPLDLQRAYVLGGPRLIEYL
FT                   ERDEHFQFAELPWPDYFGAVEHARADGRRHIVPVPLPAADVGPQAAQIRGPLDAERLGH
FT                   PVPALLTGGRALIGRFLAALARFPHARTHLGAPLVDLVDVDGAVVGAVINRDGENVRVR
FT                   ARRGVLLAAGGFEQNSRMRESFGVPGRAEDTMGCPGNTGAAHRAAIRVGAATDLMDQAW
FT                   WSPGLTHPDGRSAFALWFTGGIFVDQRGERFVNESAPYDRLGRAVIAEMDSRGMTLPFW
FT                   MVYDDREGEVPPVKATNVSMVEAAQYRDAGLWRTADTLDTLADLIGVPADALTATVARF
FT                   NAMVAGGRDTDFGRGDEPYDRAFSGGRSPMVAIEQPPFHAAAFGVSDLGTKGGLRTDTS
FT                   ARVLDTDGRPIPGLYAAGNTMAAVSGTTYPGGGNPIGASLLFSHLAAMDMAGAGPR"
FT   gene            326258..327004
FT                   /locus_tag="Mmcs_0288"
FT   CDS_pept        326258..327004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0288"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR-like; KEGG:
FT                   mpa:MAP1431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06409"
FT                   /protein_id="ABG06409.1"
FT                   /translation="MATAGKCRSRSVDHTKAQVTARCYPGWVKSGDGPNVTATGWALLG
FT                   VLSYQDELTGYDIKKWTEWSLRFFYGSPAYSQIYTELKKLENIGLLTSRVETDGGARSK
FT                   RLYKITKAGLDALRDWADEGPVDPPQLKHNPLLRVTFGHLTNPRRLKEIMQDHVAYADR
FT                   MQREAATEARWAEAEPAWAYGRVALQWAERYYAAERELAQSVIKDLDAAEEAFAKSAES
FT                   NQDGKPSLAKDYWYEIERRVRAEEGD"
FT   gene            327074..328300
FT                   /locus_tag="Mmcs_0289"
FT   CDS_pept        327074..328300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0289"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   mbo:Mb3394 possible oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06410"
FT                   /protein_id="ABG06410.1"
FT                   /translation="MGRERPTAADDIDPLQPAVLGPVTLRNRVIKAATSEGRSPDGLVT
FT                   DDLIAFHKRFADGGVGMTTVAYCTVAEDAASAPGQILMSRRAVPGLRRLADTVHQAGAA
FT                   VSAQLGHGGVVATRKVNKVTPKAPSRFVNPQSFDYCRPISRDEILTVVDQFGTAAQVAV
FT                   DAGFDAVELHLGHLYLPSSFLSPLMNRRKDEYGGSIDNRARFARQIAQRVREVVGNRAA
FT                   VIAKLSMEDGKRGGIALSESLRVVQLLDADRNLDAIELTQGSSVFKPMYLFRGDTPVDE
FT                   FAAVMPPPMNLGVRMVGKRVLGTFPYRDLYMLDAARQFVPVAAHTPLILLGGITTGEHM
FT                   QDAMREGFAFVALGRALLREPDLVNQIREQPGKRSLCNHNNKCMVTVFGKTHCVLDPGQ
FT                   RYGPVVSQS"
FT   gene            328309..328731
FT                   /locus_tag="Mmcs_0290"
FT   CDS_pept        328309..328731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06411"
FT                   /protein_id="ABG06411.1"
FT                   /translation="MLGAVLALAAVLSPPAAHAETPYGNFEMQIQGRYDFHTWLWAVSR
FT                   CPGECLRVQAIAQPVAKAFAFRADAHLVDGRYTMTVDVPDGLRCGNVYYGPVIPTRDVY
FT                   TWDDATRSGTLSSSFATGCDGAPGGTLTYPFRLVRL"
FT   sig_peptide     328309..328368
FT                   /locus_tag="Mmcs_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            328742..329593
FT                   /locus_tag="Mmcs_0291"
FT   CDS_pept        328742..329593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0291"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa33450
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06412"
FT                   /protein_id="ABG06412.1"
FT                   /translation="MRIGVSTPVVVQVPGVAAEWERDAGIEDLRTVAQAADSLGFEYLT
FT                   CSEHVAVPAADALARGAVYWDPLATLGFLAACTSRIRLATSVIVLGYHHPLEIAKRYGT
FT                   LDRVSGGRLTLGVGVGSLAAEFELLGAQFGDRGRRADDALRALRASLSTTRPAYDGEFY
FT                   QYDSVVVEPCAAQPRVPIWVGGRTRRSLRRAVELADGWMPFGLSADRLSELLSTVDVPA
FT                   DFDIVLPVAPLDPSGDRDRAARRLRALDDLGATAVTCTLAATSAGHYCDQLEALRAVAE
FT                   DL"
FT   gene            complement(329604..330401)
FT                   /locus_tag="Mmcs_0292"
FT   CDS_pept        complement(329604..330401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0292"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nfa:nfa40900 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06413"
FT                   /protein_id="ABG06413.1"
FT                   /translation="MSRYTDRRVLITGGGSGIGQACVLRILDEGGHVVAADVSEAGLKD
FT                   TVSKAQSAADRLSTLVMDVGDEESVRAGVAEAIGILGGLDTLVNVAGILRSARLEQTTL
FT                   TDFERVLRINLVGTFLVTREAISALRNGNGPAVVNFSSTSAHFGHPYMSAYAASKGGIL
FT                   SMTHTLALEFAKDGIRFNCVQPGSISSGMTDGTGQARQSVGPGLPDDADYSLFSRLQPM
FT                   LAIDGGAMFADPSAVASVVAMLGSADAFFVTGTEVRVDGGTHM"
FT   gene            complement(330421..332127)
FT                   /locus_tag="Mmcs_0293"
FT   CDS_pept        complement(330421..332127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0293"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase; KEGG:
FT                   mpa:MAP1433c 3-ketosteroid-delta-1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06414"
FT                   /protein_id="ABG06414.1"
FT                   /translation="MTTAHTATIPGGLPVRDTTVDLLVVGSGTGMGAALAARARGLSVL
FT                   IVEKSEFVGGSTARSGGALWLPASQVIDGDGGGDTSQRAATYLDAVVDGTAPASRSAAF
FT                   LEHVDATIDLLRRTTPMRLFWAREYSDYHPEQPGGSAAGRTCECRPLDTAVLGEYLPRL
FT                   RPGVMEVKIPMPTTGADYRWLNLMSRVPRKGIPLVAKRLGQGIGGLLLGRRYAAGGQAL
FT                   AAGLFAGVLRAGIPIWTETALQRLVTDDGGRVTGAVVDHRGQEITVTARRGVVLAAGGF
FT                   DHHMDMRWKFQSERLGEHASLGAETNTGDAIRVAQDLGAAIDLMDQSWWFPAVAALPDG
FT                   DPKVMLAERSLPGSLIVDQTGSRFVNESCDYMTFGQAVLDRERAGDPVEAMWIVFDQQY
FT                   RNSYVFAAELFPRMAVPKAWYDAGIAHRSESLDDLGRKMGVPDAQFVATVRRFNEMAHA
FT                   GQDSDLGRGRSAYDRYYGDLTVTPNPNLRALDRGPFYAVKMVLSDLGTCGGLRADDRAR
FT                   VLREDGTTIDGLYAIGNTAANAFGATYPGAGATIAQGLVYGYIAAQDAAQA"
FT   gene            332228..333022
FT                   /locus_tag="Mmcs_0294"
FT   CDS_pept        332228..333022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0294"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nfa:nfa33460 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06415"
FT                   /protein_id="ABG06415.1"
FT                   /translation="MTDLDRYGPWAVIAGGSEGVGAEFARSLAGDGFNLVLIARKPGPL
FT                   DETAESCRELGADVRTLSLDLLDPEATSRIAEATADIEVGLLIYNAGASTCNDPFLDAD
FT                   LAEWRKIIDLNMSRMLELTQHFGRRMVAQSRGGIILVGSLSGYMGSVRHAVYSGVKAFG
FT                   RMFAESLWLELREQGVDVLELVLGVTRTPAMERAGLRFDIPGFIVNDPADVAREGLEHL
FT                   GDGPVHVAGGNAEQAARNSGPDRARIVLESHLAIQRLIGAQP"
FT   gene            333055..333522
FT                   /locus_tag="Mmcs_0295"
FT   CDS_pept        333055..333522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa33470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06416"
FT                   /protein_id="ABG06416.1"
FT                   /translation="MQRLEDERDIQRLIASYGPYVDAADADGAAALWAEDGSYDVEGWR
FT                   MTSRDDVRAMVSSDGHRALVAAGCCHFLGPSIVTVDDDEAVAVCESVVLRTTGETPVGY
FT                   AVWRAAANHFHLRRVGGVWQIAARTTRLLDGNPEAHRLLTAGVAGQRSDLS"
FT   gene            333574..334710
FT                   /locus_tag="Mmcs_0296"
FT   CDS_pept        333574..334710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0296"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="PFAM: Rieske [2Fe-2S] region; KEGG: mpa:MAP1434
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06417"
FT                   /protein_id="ABG06417.1"
FT                   /translation="MTSDIDEVRQIEADAAPTRFARGWHCLGLTRDFGDGKPHTVNAFG
FT                   QKLVVFRSGDGRINVLDGYCRHMGGDLSQGEVKGNEIACPFHDWRWGGDGRCKQVPYSK
FT                   RAPRLARTATWTTLEQDGMLFVWNDPERKPPPDDVTIPRIEGATSDEWTDWHWYTTVVD
FT                   TNCREVIDNVVDMAHFFYIHGSLPTHFKNIFEGHVATQYMNSAGRADLQPPEGPRMLGT
FT                   TSVASYHGPSFMIDDLTYHYEEADHHTVLINCHYPIDANSFVLQYGIIVKKSEALPDDL
FT                   AVQTAVSLGDFVKMGFEQDVEIWKNKARIDNPLLCEEDGPVYQLRRWYEQFYVDIADVT
FT                   PDMVDRFEYEVDTTRPREEWMKIVEANISARASATSAG"
FT   gene            334746..334997
FT                   /locus_tag="Mmcs_0297"
FT   CDS_pept        334746..334997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa33570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06418"
FT                   /protein_id="ABG06418.1"
FT                   /translation="MVPVACRACGAKVLARKSSWQQTSVQWSADAAQRCPQRRDSEALA
FT                   AHGRRTVFLSCSELSESIVEAVRAGRLSIVDETVDVAP"
FT   gene            335007..335819
FT                   /locus_tag="Mmcs_0298"
FT   CDS_pept        335007..335819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0298"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06419"
FT                   /protein_id="ABG06419.1"
FT                   /translation="MTEHIDPPVAVVTGASRGAGRGIARALIAAGWRVYLTGRTVDSLG
FT                   EGSVAVPLDHRDDAAVGALFTRVEDEAGRLDLLVNNAAAVHDALTGRDPFWQKPVELGD
FT                   ILDVGLRSSYVAAWYAAPLLLRGPRGLIAFTSSPGSVCYMHGPAYGAQKAGVDKMAADM
FT                   AVDFRGTPVHTVSIWMGILLTEKLRGAFDGNPDGLAAMAEHAETPEFTGRVIDALYRDP
FT                   ARESLSGHTVIGAELAARYGITDEGGRQPVSHRGMLGAPRTPSDVVVR"
FT   gene            335888..337021
FT                   /locus_tag="Mmcs_0299"
FT   CDS_pept        335888..337021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb1413c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06420"
FT                   /protein_id="ABG06420.1"
FT                   /translation="MLDEKRRAAEAAAGVPANKRGRGLASEVALARHDCPNKGGRHLGF
FT                   ARVLVHEMPHTLAALECGALSEWRATLIVRESACLSVEDRRSLDTELCRDVSSLEGLGD
FT                   KRIEAEAKKIAYRLDPQAVVDRAARAASERTVTCRPAPDTMTYVTALLPVAQGVAVYAA
FT                   LKRSADTTFDDRSRGQVMADTLVERVTGCPAEVAVPVAVNLVITDEALLGGDPEPAVIS
FT                   GYGPVPAAVGRRLVDAAVTDKRSKATLRRLYRRPRSGALVAMESRARCFPKGLAAFIDL
FT                   RDQTCRTPYCNAPIRHHDHARPHRAGGPTSAANGLGECEQCNYAKEAPGWQVTAAIDET
FT                   GTHTAEFTTPTGAVYRSTAPSPPGVTPPDAAGEARAA"
FT   gene            complement(337036..338112)
FT                   /locus_tag="Mmcs_0300"
FT   CDS_pept        complement(337036..338112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP1437c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06421"
FT                   /protein_id="ABG06421.1"
FT                   /translation="MLTDDRRLALSDVLRPASPPREVDDIYTDDQRERLLDVVRTQGPW
FT                   KLIIAQHFASAEELMATMSGAFPEGFEPSLDLFLTPTFRGYLANYGTVLYPELHDCFYN
FT                   EQFLAHAKSYWNAEYAKPEMMLFNINGPCANRDPGHLDSPSFRGVRHENAPTWLTSVMG
FT                   KSGLFQDHLIKMAQVITWFSLDEGSGFTYWPEGPLKAPQRLLPPVYNRGVVVQNEMMVH
FT                   RGEANGPLEQQTPAGLAFDTVFTGDPSDRDHWVLKNGDDVIARHHTDELRFLVHWSAEV
FT                   FSDYDELKKNMDHSDDLTIEQAIDTLVKDVNAQGISLKMPDNPLHDPQFIATLNAAYDL
FT                   GGPAAYPEEAPLSAFQLA"
FT   gene            complement(338204..339154)
FT                   /locus_tag="Mmcs_0301"
FT   CDS_pept        complement(338204..339154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0301"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG:
FT                   mpa:MAP1438c LipH"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06422"
FT                   /protein_id="ABG06422.1"
FT                   /translation="MTVPGLDPDAAARVASFGAIPPMRERGLDAVRRAVEATPHPDDTP
FT                   EMADVDDLSIPGPAQPIPVRIYRPTDDDSAPVLVYFHGGGMVMGSNRSFEPLARALAAH
FT                   SGATVVSVEYRLAPEAPTPAQFDDAYAATVWVAGNAEVIRVDASRLAVVGDSAGGSLAA
FT                   AVALAARDRGGPSILCQVLLYPGLDRDMTCESIQLLADAPMLTHADIDYMHELADQGAA
FT                   VPPDQYRFPALATDLTGLPPAIVVTAGCDPIRDWGERYATRLRDAGVQTTQTRYPGAYH
FT                   GFLMRSDATARGRLAIAETGALLRAKFACPVPVSR"
FT   gene            complement(339151..340755)
FT                   /locus_tag="Mmcs_0302"
FT   CDS_pept        complement(339151..340755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0302"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase; KEGG:
FT                   nfa:nfa4640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06423"
FT                   /protein_id="ABG06423.1"
FT                   /translation="MNFGAMNYDVIVVGFGAAGAAAAIEAADRGARVLVLDRGYGGGAT
FT                   ALSGGIVYAGGGTAEQHAGGYHDSVEDMRAYLESEVGDSVSGETLDRFCRQSPAMIEWL
FT                   KAQGVEFRGGEVPTYKTSYPTDDFYLYYSGNEKAYPYAGRARPVPRGHRVLARGMSSGK
FT                   VLFDRLARSARHKGVEFIPLAQVHSLIQDDDGRIAGVRYRALDPAHPNARKHKVLTKLT
FT                   GKAGTWMPGLVEGLVARAEEMRTGASVDAEARAPAVILAAGGFVHNREWMQAHAPQFMK
FT                   VSPLGTVGDDGTGIALGLAAGGVTGKMDNVTAWRFLSPPSAFLEGLTVGADGRRIANED
FT                   LYGATHGNVLMRDFGGTGWAIYDAQTWRKVKSQIRTQTQIFQRLQLIYLFTIGHKKAAS
FT                   IEDLAAENGIDAEGLRRTVDEYHRGLDNGAGDPAHKDPELCPPLLTPPFYSIDISADSS
FT                   MFFPIPGLTLGGLLVDESTGEILGADGESVPRLYAAGRNAVGVCSKSYVSGLSLADCIF
FT                   SGRRAGAHAADGLGQPR"
FT   gene            complement(340767..341555)
FT                   /locus_tag="Mmcs_0303"
FT   CDS_pept        complement(340767..341555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0303"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ttj:TTHA0660 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06424"
FT                   /protein_id="ABG06424.1"
FT                   /translation="MRITDRVFVVTGAGNGMGRQVTLDLLRRGALVAAADVDEVGLTGT
FT                   ARLAMAGTRLSTHVLDVTDRDAVAAMPGRVVDVHGRVDGLVNIAGVIHRFAPFIDLPPE
FT                   TADRIMAVNFTGTVDMCRAFLPVLLARPEANLTNMSSLSALLPFASQTLYSASKGAVKQ
FT                   FSEGLYAELCDTNVHVVTVFPGNVATELTSNSGVEMLDAGGKKVRSTTPEAAGRKIVDG
FT                   IAEDRFRVLIGADAHSLDVLARVSAKRTTRLVAKQIKSVL"
FT   gene            complement(341567..342427)
FT                   /locus_tag="Mmcs_0304"
FT   CDS_pept        complement(341567..342427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0304"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP1439c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06425"
FT                   /protein_id="ABG06425.1"
FT                   /translation="MNAGQTFGGGVAVITGAGAGIGAGLARHAARLGMTVVLADVDGDA
FT                   IAALRDELSDQGATAFDMVCDVRDFAAVEELAQRTYRDIGPVRLLVNNAGVEQFGYLWD
FT                   TPVENWQRVVDINVSGVFHGVRAFLPMMIEARTPAWVWNLSSIGGVAVVPLQAPYIMSK
FT                   HAVLALTECLALEVQLAEHDHIHVQAVLPGAVTSNIFESAGGVTDGDVGAAESQRLAML
FT                   DIKAAAMDPLAAAEVVFDQAADGRFYLLTQPEYVGNAMAERADVLTTQRAPLLRTKPRF
FT                   DPAQH"
FT   gene            complement(342432..342914)
FT                   /locus_tag="Mmcs_0305"
FT   CDS_pept        complement(342432..342914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP1440c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06426"
FT                   /protein_id="ABG06426.1"
FT                   /translation="MSNEIALSELQEFVAGFWYHYDEAHYDDMAAAYADDIRYISRSES
FT                   GASPFEELMSPELVGREAVMEWLSEHRKQSPYPLRHHATNLHRTGTDGDVTRARFYIFV
FT                   NQIANYVPFAVSSGVAEVAVRRGAGGLEFTEMEVILDTTNSVLLSEYSADPAAAGA"
FT   gene            complement(342977..343762)
FT                   /locus_tag="Mmcs_0306"
FT   CDS_pept        complement(342977..343762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0306"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa29860 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06427"
FT                   /protein_id="ABG06427.1"
FT                   /translation="MTADMSGPLRITTTAAIQVWTIDLPHVGNAITDDGFIAAFEAAVH
FT                   AVNADNAIRAVILTGEGKIFSAGGNVKEMADRQGMFGLEPLDQRRAYLDGIQRIPRALE
FT                   RLEVPLIAAVNGAAVGAGCDLAMMCDIRIASDRASFAESFVQVGLIPGDGGTWFLPRAV
FT                   GYARAAEMTLTGDRIDAATAAEWGMVSRVVPHEDLLAEAQALAERITKNPAHVLRMAKR
FT                   LLQESRTGSLESTLGMAAAMQPLAHRDAEHERRISRWRS"
FT   gene            complement(343759..345177)
FT                   /locus_tag="Mmcs_0307"
FT   CDS_pept        complement(343759..345177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0307"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: sma:SAV6595
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06428"
FT                   /protein_id="ABG06428.1"
FT                   /translation="MHDYTRKTLFIDGRWATPDGGDAIEVIDPATEQVIGSVPDGTTAD
FT                   VDAAVAAARRAFDPLITVAERRERLDRVIAAMEKRLPDIGETITREMGAPVRIAQGVQT
FT                   KVPLAVARGIADVLATFEFEERMGNSLVVREPYGVVGAITPWNYPLYQVVAKVVPAIAA
FT                   GCTVVLKPSNEAPLSVFEFVEALDEAGLPPGVVNLVSGSGRVVGERIAEHPDVDLVSFT
FT                   GSTAVGQRVAELAAKTVKKVALELGGKSANVILEGGDLTTAVKVGVGNAYLNGGQTCMA
FT                   WTRMLVPESRYGEALELVEAAAARYTVGDPLDPATRIGPSASASQFATVRGFIERAQRD
FT                   GARLITGGAEKIRDIGYYVAPTVFADVDPDSELGQEEVFGPVLAVIPFRDEDDAVRIAN
FT                   GTPYGLAGAVWAGDLDHAIAFARRVQTGQLDLNGGAYNPVAPFGGYKKSGVGRELGRAG
FT                   FEEFLQTKSLQLPA"
FT   gene            complement(345192..346298)
FT                   /locus_tag="Mmcs_0308"
FT   CDS_pept        complement(345192..346298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0308"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: nar:Saro_1476 alcohol
FT                   dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06429"
FT                   /protein_id="ABG06429.1"
FT                   /translation="MFEGRIARFDAPGQPFVIDTVDLADVGPGEILVKVTRTNICGSDL
FT                   HAWHGTFATRGLGGQLPTVLGHEMVGAVAALGDGVTADSNGVPLAEGTRVVFPYFYSCH
FT                   RCRNCLLGRRGACLNLKMAMLGRADEPPYFVGGYGDYYLLPAGAVVYTVPDVVSDEVAS
FT                   GANCALSQVMYGLERVDQQLGEVVVVQGAGALGLYAVAVAKARGAAKVIAIDGVPERLE
FT                   LATAFGADAVVDITEATTVKDRAKIVRTLTDGHGADVVVEVVGHPAAIDEGLKLLGQFG
FT                   RYVEIGNINIGKTFEFDPSRFVFGHKTMVGVSLYDPAVLSRALTFLEQHQDHLPLDRLA
FT                   AAHYPLDHINEAFAAADGKRDVRASIIP"
FT   gene            complement(346311..347924)
FT                   /locus_tag="Mmcs_0309"
FT   CDS_pept        complement(346311..347924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0309"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bja:bll7864 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06430"
FT                   /protein_id="ABG06430.1"
FT                   /translation="MAGDRACLGFPMDAAMDPVVVQARSHTLGDIPRRSARRFPDKTAI
FT                   VDGDVVLTFAEFERLVDRAAAALQDNGFGPGDRIALLSHNCWQYAVLAFATARAAVVLV
FT                   PINFMLTAEEISYLLGHSGVRGFLVEADLTATAEEAMRLGGSVTTKVALVPDGDAPAEG
FT                   WDDFARWLTTESPAPSPHIDDDQLLRLMYTSGTESRPKAVMHSSRSLMWQYVSTIVAGS
FT                   MAGDDVEVHSLPLYHCAQLDNFLATDVYLGATSIILPRPEPELVLRTIERYGVTNYFAP
FT                   PTVWISLLRCPVFDEVDLSSLRKGYYGASAMPREILAELRERLPDLRLWNFYGQTEMAP
FT                   LASALGPDEQDAHAGSAGRPVVNVETTILDEDDTPVATGVVGEIAHRSPHLMLGYLDDA
FT                   AKTAEAFRGGWFHSGDLGYYDEHGLLHVVDRKKDMIKTGGENVASREVEETLYRHAGVQ
FT                   EAAVFGLPHPVWVETVVAAVVLRDGSAVTEDDIIAHCRAHLAGYKTPKQVFFVDTLPKN
FT                   PSGKLLKRDLRQRFSAAHSH"
FT   gene            347992..349875
FT                   /locus_tag="Mmcs_0310"
FT   CDS_pept        347992..349875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP1441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06431"
FT                   /protein_id="ABG06431.1"
FT                   /translation="MTTDAELRSHLRQADPGVLVAVLAQMTGDPSVIDEFAPAISHIPD
FT                   PPERAGVTDPDTMEALVDRIVEALDTPRSGGLAADDPNLFTRLLPVALGSDVEDEFVPL
FT                   LLEQGGFQLSQPTLPRDVPIPASTTVTIIGAGIAGIVAALAARDAGVAFEILDRNDEVG
FT                   GTWLTTKYPGIGVDTPSAYYSLSREVNPDWTNYYPQGAEYQAYLVSLADKYGLREHTRF
FT                   GTEVEALWWDDDRQEWQIHAVDRDGNRSVSHSRVVITAAGYLNRPRWPDIPGRDTFAGI
FT                   SVHSAQWDPSLDLTGKRVAIIGAGCTAVQIVDACVDQVEHLTVFQRQPHWVAPRKRLSD
FT                   DVPEYRRYLGRHLPYYANWHRLKSYWATADNNYPVIVRDPEWAERHLSISPANDVLLQM
FT                   CLEYIDRMFGEGTELAKKVTPDFAPYGKRIIRDPGGYYAALTRDHVDVEASEPAEVNAR
FT                   GIVTQDGRQIDLDVIVYATGYHLDFLSTVDIRGRGGRTLREEWGDSPRAYRGGTVPGFP
FT                   NLFITSAPNYSPGHGAGANFSMEVLAHYIMECLQLMASRRATTIEVTQEAYDDYVADID
FT                   DAMSRTVWCHTPNAHTYYRSGSGRVVVATPYRLIDVWQQHRAPVEDHFVIR"
FT   gene            349872..350759
FT                   /locus_tag="Mmcs_0311"
FT   CDS_pept        349872..350759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0311"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP1442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06432"
FT                   /protein_id="ABG06432.1"
FT                   /translation="MSRLLSGKTALVTGSSRGIGRAIAQRLAAEGATVVVTARSHTPSP
FT                   SVRAGAAAALPGTIGETVEMIEAAGGTAYGVAADLEDQQQRLRLIDEVLDRTGRLDILV
FT                   NNAGYADYSVVEHMAMDTFDRTVEHYLRTPFVLSQCAIPHMRTQGAGWIVNIGSVTGMA
FT                   PVRPFREYNKSSGDVVYASVKAALHRFTQGLAAEVVDDDIAVNCVGPSTAVRTPGASQL
FT                   IPDTFPTEPVEYLAETVLAMCHLPAADRTGLVAFSLHYPWSQGLPVHTLDGSAVLPPLE
FT                   PPATANPNIRPAGL"
FT   gene            complement(350765..351385)
FT                   /locus_tag="Mmcs_0312"
FT   CDS_pept        complement(350765..351385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0312"
FT                   /product="Stress responsive alpha-beta barrel"
FT                   /note="PFAM: Stress responsive alpha-beta barrel; KEGG:
FT                   mpa:MAP1443c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06433"
FT                   /protein_id="ABG06433.1"
FT                   /translation="MYSVIRLLDVDESERDDVLDTLRRSTFGAEWTLVEPTLPGVRNGG
FT                   DILVRLRFSDRHARADAVTKLDELLDRNAVRHVNGATYSGSSTPGADGIATVYRALLLR
FT                   VRPGTDEATVRRFEDDLRLLPRYVRTIHSWQLSRVEDAIGTSTWTHVFEQEFTDVDGLM
FT                   GPYLMHPIHWAYVDRWFDPECPDMIVRDRVCHSFCRNDAVVHA"
FT   gene            complement(351378..351719)
FT                   /locus_tag="Mmcs_0313"
FT   CDS_pept        complement(351378..351719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP1444c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06434"
FT                   /protein_id="ABG06434.1"
FT                   /translation="MAEVFVTDRVVTRPGRTREFVDAYLTGYAPGARQRGMTLQRVLVS
FT                   PPIWFEDQPNTVTVTWSLRSARAWWEMTWQGRPDPSIGEWWTGIDELVTERSREVAADA
FT                   ADVDGLCDV"
FT   gene            complement(351712..352644)
FT                   /locus_tag="Mmcs_0314"
FT   CDS_pept        complement(351712..352644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0314"
FT                   /product="Alpha/beta hydrolase fold-3"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3; KEGG:
FT                   mpa:MAP1445c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06435"
FT                   /protein_id="ABG06435.1"
FT                   /translation="MTGALDPQIADLIEGLDRGFPPVQTMTGAQARATIRSRFIAPAEP
FT                   EPVAAVEDRSVGEIPIRIYHPAGAGPLPVLVYAHGGGFVFCDLDSHDGLCRDIANQTAA
FT                   IVVSVGYRLAPEHPWPAAAEDVYAVTRWVADNCTALGADPGRIAVGGDSAGGNLAAVTA
FT                   LIARDRGGPSLVAQLLVYPMVTPDFTTESYRLFGSGYYNPAEALRWYWDQYVPNDFDRT
FT                   HPYVSPLHADLSGLPPAVVVIAGHDPLRDEGVRFGEALSAAGVPTVVRRFDGGIHGFMT
FT                   MPSLELAQTARAQLCQDAVALLTGVPAGG"
FT   gene            complement(352641..353567)
FT                   /locus_tag="Mmcs_0315"
FT   CDS_pept        complement(352641..353567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0315"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mpa:MAP1446c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06436"
FT                   /protein_id="ABG06436.1"
FT                   /translation="MIQTGIFLIGICLICTSAPGGAMTVQPGLAPVSPESTPSAVIDRV
FT                   SLVLDAFDGPGRLTLAQIVRRTGLPRSSAHRMLERLVQLRWLRRNGRDYELGMRLVELG
FT                   SLAVHQDRLHRAATPLLHDLHRATGLVVHLAVLDGADVVYLEKIGDRMVAALPSRVGGR
FT                   QPAHCTAIGKALLAYNADACDDVDLDNRRTKYSIGSAAQLANELAKTRAHGVAFDREES
FT                   LPGFGCVAAPIGAPGEAVAALSVCGPMGRMVFDQRLAAPVRMTAMGVWRNVEGGPQRVA
FT                   PTLQQVRPLRSGPTPRPAHESTALQLA"
FT   sig_peptide     complement(353493..353567)
FT                   /locus_tag="Mmcs_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.578 at
FT                   residue 25"
FT   gene            complement(353675..355138)
FT                   /locus_tag="Mmcs_0316"
FT   CDS_pept        complement(353675..355138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0316"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase; KEGG:
FT                   mpa:MAP1447c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06437"
FT                   /protein_id="ABG06437.1"
FT                   /translation="MTADDVRPVPASSVTSWDHEADVVIAGYGVAGAAAAVEAAHAGAD
FT                   VLVLERTGSWGGAASMAGGFIYLGGGTPIQKACGFEDSVDNMAAFLNAAMGPGADDRRI
FT                   ADYCEGSVAHFDWLVECGVPFKAEFFGEPGWEPMGDQGLMYSGGENSYPFNTIATPAPR
FT                   GHVPQMSDKKQGEASAGYMLMKPLVETATAAGARALYDVRVQRLVVEADGRVTGICARQ
FT                   YGTDVTIRARRGVVLATGSFAYNDAMVAQYAPRIAGRPAASIEQHDGQAIRMAQALGAD
FT                   LAHMDATEVAIFIDPQQLVRGVLVNERGQRFVAEDTYPGRVGQLTLYHQNNTAYLIIDG
FT                   DAQEEAMASLSPQLMMRPPTWVCETVAELEAEIGLAPGSLQTTIAAYNDGAARGEDPLL
FT                   HKKPQWLRPVGSPVGAIDLRESTGGFTLGGLQTSLDGEVLHVDGEPIPGLFAAGRSTAG
FT                   LAAWGYASGISLGDGSFYGRRAGRAAAKG"
FT   gene            complement(355135..356043)
FT                   /locus_tag="Mmcs_0317"
FT   CDS_pept        complement(355135..356043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0317"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: nfa:nfa40980 putative
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06438"
FT                   /protein_id="ABG06438.1"
FT                   /translation="MTVLKSLGYVTVQTADIDRWRHFAFQVLGFAEGSGPDDSCLYLRM
FT                   DERAARIIVRPGDTDRIVTVGWEVRDHAALEQVKRDLDAAGTPFKQLSLEEADARRVEE
FT                   VIAFEDPAGTALEVFHGAVLDHSPVVTPFGARFVTGAQGLGHVVLPALDVNGVFEFYTG
FT                   VLGFRSRGAFRVPVPPEFGPVRVRFLGINDRHHSLAICPASTVRDPGLVHLMVEVDSLD
FT                   AVGQALDRVAADGYQLSSTLGRHTNDKMVSFYVRAPGDWDIEFGTEGMRVDETYYTAEE
FT                   ITADSYWGHQWVGDLPAAMRP"
FT   gene            complement(356059..357240)
FT                   /locus_tag="Mmcs_0318"
FT   CDS_pept        complement(356059..357240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0318"
FT                   /product="Acyl-CoA dehydrogenase, type 2-like protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2-like; KEGG:
FT                   mpa:MAP1448c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06439"
FT                   /protein_id="ABG06439.1"
FT                   /translation="MTERVIDRVMELADQFREQAVEAERIGKISDTTVKNMKAVGNIRL
FT                   LQPEEYGGYEVHPREFAETVMATAALDPAAGWVNGVVGVHPYQLAYADPKVAQEVWATD
FT                   VDTWIASPYAPQGVAKPVDGGYLFNGRWQFSSGTDACDWIILGAMVGDADGRPVMPPQI
FT                   LHMILPRSDYEIVDDSWDVVGLRGTGSKDVVVRDAFVPAYRTMDGLKVMDGSAQVEAGM
FT                   TKTLYKMPWSTMFPLGISSATIGICEGALAAHLDYQRERVNASGVAVKDDPYVMYAIGE
FT                   AAADIQASRQALLANVDRIFDMVDTGTEVTFADRAAVRRDQIKAVWRAVTAVDQIFARS
FT                   GGNALRMDKPLQRYWRDAHAGVAHAIHTPGTIYHASALSSLGVDPQGALRAMI"
FT   gene            complement(357328..358368)
FT                   /locus_tag="Mmcs_0319"
FT   CDS_pept        complement(357328..358368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0319"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin oxidoreductase FAD/NAD(P)-binding
FT                   Oxidoreductase FAD-binding region; KEGG: nfa:nfa50680
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06440"
FT                   /protein_id="ABG06440.1"
FT                   /translation="MIADVDSPSEPRTVRLTVTDVIEESHDARSLVFAVADGARFDYRP
FT                   GQFLTLRVPGEQGGAVARCYSLASSPHTDAAPKVTIKRVDGGYGSNWLCDNVVAGQVIE
FT                   ALPPSGVFTPGDLDRDLVLWAGGSGITPVMSILKSALAVGSGRVVLVYANRDERSVIFA
FT                   AELRDLTARHPDRLTVVHWLESVQGLPRQDQIATLARRFTGGEAYLCGPAPFMAAVQAA
FT                   LAEAGVPRDAVHTEVFRSLTGDPFAEVAPVPVDGDAADLQVELDGGKHSLRWPRQATLV
FT                   DAMIAAGLDVPYSCREGQCGSCAATLLRGRVDMPDTEILEPEDIEAGTILGCQARPASD
FT                   EIHIEF"
FT   gene            358450..360081
FT                   /locus_tag="Mmcs_0320"
FT   CDS_pept        358450..360081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0320"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mpa:MAP1450c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06441"
FT                   /protein_id="ABG06441.1"
FT                   /translation="MIVVDTSADQLPNQVDAVVVGAGFAGLYALHKLRSQGLTVRVFEA
FT                   APDVGGTWYFNRYPGARCDVESVDYCYSFSEELQQEWNWSEKYATQGEILRYINWVADK
FT                   LDLRSGITFNTKVTSAVLDEDTLRWTVTTDAGTVLSARFAIMATGPLSAALTPQFPGLD
FT                   TFAGDIYHTADWPHEDVDFTGKRVAVIGTGSSGIQSIPIIAEQAAQLYVFQRTPNYSVP
FT                   AGNRPLTAEDIATVKANYDERRQLSWRSGGGSPHVAHPKLTMEASLEERRAAFERRWEL
FT                   GGVLFSKTFRDQMIDPQANDEARKFYEEKIRAVIDDPEVADLLIPKDHPIGTKRICTDT
FT                   NYFQTFNRPNVELISVRKTPIESVDPAGINTSDAHYELDVIVLATGFDAMTGALAKMDI
FT                   TGRDGEKLADDWRDGPRTYLGLGVDGFPNLFIVSGPGAPAVLANMVLHAEAHVNWIADC
FT                   IDYLDSHGYAAIEATPQAVDDWGAELSRRADATLFTQANSWYMGANVPGKPRVFMLFIG
FT                   GFGVYLDICAEVADAGYKGFELLKID"
FT   gene            360078..360881
FT                   /locus_tag="Mmcs_0321"
FT   CDS_pept        360078..360881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0321"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: mpa:MAP1449c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06442"
FT                   /protein_id="ABG06442.1"
FT                   /translation="MMPRLLDKVVVVTGAARGTGRVHCERFAEEGADVIALDVAAVADE
FT                   LSGTAAAVARHGRRCVTGEADVRDFAALTAAIDRGVEELGRLDVVVANAGVHPAGAPAW
FT                   ELTGEAWRQALDVNVTGVWHTVKAAARHMDSGGGAVIVISSTNGLRGTPNSAHYTTSKH
FT                   AVVGLARTLANELGPRSIRVNTVHPGAVATPMVLNEATFRRLRPDLEEPTADDAAEVLR
FT                   ARNLLPVPWVDPVDVANAVVFLASDEARYITGSQLVVDAGLTQKV"
FT   gene            360878..361717
FT                   /locus_tag="Mmcs_0322"
FT   CDS_pept        360878..361717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0322"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP1451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06443"
FT                   /protein_id="ABG06443.1"
FT                   /translation="MTVGRLAGKVALITGAARGIGRAQAVRFAQEGADIIALDICGPVD
FT                   DTVVVPSATRRDLDETACLVAEVGVRVVTEVVDVRDPDALQAATDAAVTDLGGIDIVCA
FT                   TAGITSRGAATQMPEDTWQTMLDVNLTGVWHTCKVSAPHLIARGAGSVILVSSIAGLRG
FT                   LVGVAHYTAAKHGVVGLMRSLAHDLAPHGIRVNSVHPTNVDTPLIQNTAVSSAFRPDLD
FT                   RPPTRAEFAAAARPMNLLAIPWIDPVDVANASLFLASDEARYITAVSLPVDAGSTQR"
FT   gene            complement(361723..362580)
FT                   /locus_tag="Mmcs_0323"
FT   CDS_pept        complement(361723..362580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0323"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mpa:MAP1452c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06444"
FT                   /protein_id="ABG06444.1"
FT                   /translation="MTATSDQLPLQELTTPSGTLRYYDTGAGPTVLFLHGSGPGVTGWR
FT                   NFRGVLPAFSAHFRCLILEFPGFGVSDDAGGHPMIDAQGAVAPFLDGLGVDRVDIVGNS
FT                   MGGGVGINFAIHHPDRIRRLVTIGGIGTNVFSPGPSEGIRLLQEFTEDPTRARLVDWLR
FT                   SMVYDEALVTEELIAERWELATDPETLAAARRMYGKAAFTQMMAFMRKSEAPLPWAQMH
FT                   RVAAPTLLTWGRDDRVSPLDMALIPMRTIPNAELHVFPNCGHWAMIEAKAAFEAAVLSF
FT                   LLRE"
FT   gene            complement(362615..363220)
FT                   /locus_tag="Mmcs_0324"
FT   CDS_pept        complement(362615..363220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0324"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mtc:MT3679
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06445"
FT                   /protein_id="ABG06445.1"
FT                   /translation="MDSTITAVTRRDRVVAAALHLAADGYDAVHIRTVAELAGVAPSTV
FT                   YQHFASKDDLLVASLHRWLSACETDARAPLDRIAEPYDRLLYVADFITQRLWAEPLLAD
FT                   ALTRAYLCAESVAATNADRVRTSLSRMLTSAMGRELPTARQRHIGDLVADIWASSMLAV
FT                   AQNRATADGSRERLARTIAVIARHDAEESLPSAGLRAV"
FT   gene            363271..364644
FT                   /locus_tag="Mmcs_0325"
FT   CDS_pept        363271..364644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0325"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: nfa:nfa33530 putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06446"
FT                   /protein_id="ABG06446.1"
FT                   /translation="MGFRPTGAPGNAKIGDMDETATPDPALLRRVAISSLLGTAIEYYD
FT                   FLVYGTMSALVFGIIFFPESDPAVATIAAFGTLAAGYVARPVGGILFGHFGDRIGRKSM
FT                   LVLTMTLMGVASFLVGVLPTFAAIGVAAPILLVALRVIQGVAIGGEWGGATLMVTEHAE
FT                   PHRRGAWNGVMQMGSPIGSLLSVAVVTAITLMPDESFMSWGWRVPFLVSLLLLGLGIYV
FT                   RLSITESPVFEQAKRADDRPQGPPLVEVLRRPGNLVLACAVGIGPFALTALISTYMISY
FT                   ATAIGYHRTDVMTALIFTSTTALITIPLFSALSDRVGRRAVIVTGAIGIVCYAWPFYAL
FT                   VDMGSVPLLTVAMVIAQVLQSLMYAPLGALFSEMFGTRVRYTGASMGYQFAALLGAGFT
FT                   PLIASSLLAEGVSRTPLVVLAAGCGVVTIVAIWRVSETRGADLTDAGRLPRGAAAADR"
FT   gene            complement(364641..365480)
FT                   /locus_tag="Mmcs_0326"
FT   CDS_pept        complement(364641..365480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0326"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   nfa:nfa8050 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06447"
FT                   /protein_id="ABG06447.1"
FT                   /translation="MGTYAVTGSASGMGRATAERLRADGHRVIGVDVKEADVVADLSTP
FT                   DGRARAVSQVVSAAGGHLDGAVLAAGIGPGSGKGRLRLIAEVNYRGVVELLDGWRPALA
FT                   SAGNAKVVVVSSNSTTTTPLVPKRAVKALLAGDVDKAVRAVRLFGPVGSALIYAASKIA
FT                   VSRWVRRHAIRPEWAGAGIRLNALAPGAIMTPLLEEQLASKQQAKAVQRFPVPVGGFGD
FT                   AGQLADWIRFMLSDAADFLCGSVIFVDGGTDAHFRTDDWPKPVPARRLVSYLKRFRN"
FT   gene            365578..365955
FT                   /locus_tag="Mmcs_0327"
FT   CDS_pept        365578..365955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_2195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06448"
FT                   /protein_id="ABG06448.1"
FT                   /translation="MAEPPTTEDGHHVVVNGRKWRATDPSIPADRRAELTRILMSWRRE
FT                   VRRTEGTDQERAARAGVQAAKVALGERGTPPWWEQTDEQRRARWQADVPAPGGPLPPEA
FT                   PVREHRGDHPHPGNGERTEHA"
FT   gene            365948..366844
FT                   /locus_tag="Mmcs_0328"
FT   CDS_pept        365948..366844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0328"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: nfa:nfa35690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06449"
FT                   /protein_id="ABG06449.1"
FT                   /translation="MPENTSAVVVGIDGSDSALQAARWAGAVAAACGAPLHILHGMPSL
FT                   GRNLTETAAAIQAAIMSYQRDSALIFLRAAADAVHEDRPDLSVTTEASETPVDEALIEA
FT                   SATARLIVLGGQDVTGAAALILGSTTLRVATHADCPAVAFRGDDVTVSDKPIVVGVDNT
FT                   AAGAGVLATAFEFADAMKVKLIVVRSWTTRAPAGDVTIPFLIDWEALEAAEWAALTELV
FT                   DGWRQRYPDVDAECVVETMSPARALLSHATGAQLVVVGSRGRNALAGLVLGSTSMNLLH
FT                   HSQVPVMVTRAHAPEGD"
FT   gene            complement(366905..367825)
FT                   /locus_tag="Mmcs_0329"
FT   CDS_pept        complement(366905..367825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0329"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: mpa:MAP1430c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06450"
FT                   /protein_id="ABG06450.1"
FT                   /translation="MKLVFNLPHMLRLKAMMQPWEAAVTGADQTRMAKCADAWGYDMIA
FT                   VPEHFVIPNDHVELSGPHYLQSTVAQAYLAGATERIRLNSCITVLPLQHPIVLAKALAT
FT                   ADWMSGGRMMVTFGVGWLEKEFELLGVPFHERGRMADEYLAAIVELWTSDSPSFHGKYV
FT                   SFDDIAFEPKPVQKPHLPVWIGGDADAALRRAAKFASGWWSFLTPPEKIAERLEFIKSQ
FT                   PGYDGRPFDVVHGLGTTRVGEGHVARDDPHGRPGMNAAEIVDRLCWLGEQGVTVSAVPL
FT                   PPVSGVDEYLDYAQWVVEEIKPQVP"
FT   gene            complement(367854..368693)
FT                   /locus_tag="Mmcs_0330"
FT   CDS_pept        complement(367854..368693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0330"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP0665c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06451"
FT                   /protein_id="ABG06451.1"
FT                   /translation="MGGRVDGKVAFITGAARGQGRSHAVRLAEEGADIIAVDVCGPISS
FT                   HTDIPPATPDDLAQTADLVKGLNRRIVTAEVDVRDFDALDAVVRSGVEQLGRLDIVVAN
FT                   AGIGNGGQTLDKTSEDDWRDMIDVNLSGVWKTVKAAVPHLLSGGRGGSIILTSSVGGLK
FT                   AYPHTGHYIAAKHGVIGLMRTFAVELGQHSIRVNAVCPTNVNTPLFMNEGTKKLFRPDL
FT                   ENPGVDDLAVAAQFMHVLPVGWVEPIDISNAVLFLASDESRYVTGLPVTVDAGSMLK"
FT   gene            complement(368773..369360)
FT                   /locus_tag="Mmcs_0331"
FT   CDS_pept        complement(368773..369360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0331"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP0666c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06452"
FT                   /protein_id="ABG06452.1"
FT                   /translation="MSAPRKPKADISARQRLIEATAKIMREEGYAAATSRRVAAEAGVK
FT                   QALVYYYFPTMDDLYVEVLRAGAEASLERMREALTADEPLHTLWTMNSDLRLTGLNTEF
FT                   MALANHRKAIRAELKSYAERVRDIETAAVAVALRERGVDLQEYPPTAVSMLIAQTARSL
FT                   CNESAVGVTLGHDEFRAFMERLLDRLTAGQDG"
FT   gene            369473..370750
FT                   /locus_tag="Mmcs_0332"
FT   CDS_pept        369473..370750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0332"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP0668
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06453"
FT                   /protein_id="ABG06453.1"
FT                   /translation="MTDLASVDFFSDPDISQNPYGYWDALREQGPVVREPHHGVVAVTG
FT                   YQEVLAAFRDHDHFSAVNAIGGPFPPLPFEPQGDDITEQIEAHRHLFPIHEHMVVMDPP
FT                   AHERARSLLSRLLTPRRLKENEDFMWQLVDQQIDQIIGNGRCEFLSEYAKPFATSAIID
FT                   LLGVPEDDRPEFLAALGAETRQGTRVGALDGESVGLDPLQYLDDKFAGYLADRRREPRD
FT                   DVLSGMATATYPDGSTPELMEVVKPATFLFAAGQETVTKLLSAAVQTLGDHPEYQDLLR
FT                   EDPRRIPTFIEEALRMHAPTKVDFRLVRKTTTLGDVHLPAGTIVMLCLGAANRDPLKFD
FT                   DPHEFRPDRKNVREHLAFGRGIHTCAGAPLARVEGVVTVRRLLDRLRDIGIDESVHGPA
FT                   RRRNYVYEPTFLLRGLTSLHIEFTPA"
FT   gene            complement(370747..371556)
FT                   /locus_tag="Mmcs_0333"
FT   CDS_pept        complement(370747..371556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0333"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mpa:MAP2781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06454"
FT                   /protein_id="ABG06454.1"
FT                   /translation="MSHSAETNADAYERVRHAYTDVMGVAAPEPHSSAMARLYDFVFAE
FT                   VWQRPVLSRRDRRFITLACVAAADAETPLRDHVYAALSSGDVTIAEMQEMVLHFAVYAG
FT                   WPKASRFNMIVDELWERIHAERGHQLPSPEPLLPLTTPSDPEDRLAVGEQAFKDVNCLA
FT                   FAPTRDNPFSGAGILNFVFGEVWLRPGLGMRERRLITVTCVGFQDAPYPIVSHVYAALK
FT                   SRDLSFDEMDELALHFAAHYGWPKAAHLAEAIREQKQRVTAEWADTG"
FT   gene            complement(371540..372349)
FT                   /locus_tag="Mmcs_0334"
FT   CDS_pept        complement(371540..372349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0334"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: mpa:MAP2780
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06455"
FT                   /protein_id="ABG06455.1"
FT                   /translation="MNERNGRVAGKRVVVTGAARGMGRSHAVRLAEEGADLILVDICRS
FT                   LPELEYPLATAEELDETGRLAETHGARVVTHVVDVRDGAALAAAVDDGVAQLGGLDAAV
FT                   ANAGVLTVGTWDTTTSEQWRAVVDVNLIGTWNTCAAAIPHLLEHGGSLVNISSAAGVKG
FT                   TPLHTPYTASKHGVVGMTRALANELAAKSIRVNTVHPTGVETGMRPDSLRGVLESRPDL
FT                   VPLFLNALPVVMADAVDISNAVLFLISDESRYVTGLEFKVDAGVTLR"
FT   gene            complement(372346..373176)
FT                   /locus_tag="Mmcs_0335"
FT   CDS_pept        complement(372346..373176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0335"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP2779 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06456"
FT                   /protein_id="ABG06456.1"
FT                   /translation="MGSLDGKVAFITGAARGQGRSHAVRLAADGADIIGVDICADIESN
FT                   GYPMATRDELDETVALVEAQGGKMLGSVADVRDFHALRTALDAGVEHFGRLDIVCANAG
FT                   IATMAFRELTIEEDLEMWNDVVDVNLVGSFHTAKAAIPHLIAGQRGGSIVFTSSTAGLR
FT                   GFGGLQGGGLGYAASKHGIVGLMRTLANALAPHSIRVNTVHPTAVNTMMAVNPAMTAFL
FT                   ENYPDGGPHLQNPMPVQLLEPEEISSAIAYLVSDEAKHVTGVTFPVDAGFCNKL"
FT   gene            373258..373872
FT                   /locus_tag="Mmcs_0336"
FT   CDS_pept        373258..373872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0336"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP2778c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06457"
FT                   /protein_id="ABG06457.1"
FT                   /translation="MRMGEPGDRSDDRLLAVVVEILDTDGYDAVQLREVARRARVSLST
FT                   IYKRYATRDELILAALEAWMEDNRYSGVVPHPKASDASLHEALMDLFRTIFEPWEQHPG
FT                   MLTAYYRARSSPSGQTLLQRGLDVVVPAGLELLADVDESFIDDLNAVVSSVVYGLLGRF
FT                   STGEIAITEILPTLDRAVYWLTTGYEAAKGSVAAVHTRDVR"
FT   gene            complement(373837..374526)
FT                   /locus_tag="Mmcs_0337"
FT   CDS_pept        complement(373837..374526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0337"
FT                   /product="protein of unknown function DUF899,
FT                   thioredoxin-like protein"
FT                   /note="PFAM: protein of unknown function DUF899,
FT                   thioredoxin-like; KEGG: mpa:MAP1702c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06458"
FT                   /protein_id="ABG06458.1"
FT                   /translation="MTTGITGLPPEVDQQTWRAALEDLRRREKAATRELDAIAAQRRRL
FT                   PMVRMPDYTLIGAEGPVRLADVFKGRSQLITYNHMWTDGQEWQCGGCTGFTSQFTRLEF
FT                   LDNYDARFVIVTNGPIEEALAYKDKVGNKMEWYSSSESSFGADVDAPPGGGFGVNVFLR
FT                   DGDTVFRTWHTNGRGTEQLSHTFALIDLLPWGRQEEWQDSPDGWPQRPTYSGWLDSPDI
FT                   ARMYGSH"
FT   gene            374575..376053
FT                   /locus_tag="Mmcs_0338"
FT   CDS_pept        374575..376053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0338"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: protein of unknown function DUF222; SMART: HNH
FT                   nuclease; KEGG: mpa:MAP2495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06459"
FT                   /protein_id="ABG06459.1"
FT                   /translation="MCARKSSPRFDFLAHARGLLETSFVTVVSIVTSPAVLSDPRTSVR
FT                   SMDGLSGAVDHLVASIAALQTASIDELSYEQIVAELDRIKAAVWAVPSVEHRLTARLMD
FT                   ADPHELGATSIKEVLANHLRISRKTAGDRLTDARQLGPRYTLTGERVQTELAHTADAVA
FT                   RGDIGTTHVRIIQEFVRKLPAWVSWERRDHYERDLVGHASALRPEDFRKVADTLLGFID
FT                   QDGTEPDHHTHQRRREFTVGRQQADGMSRVTGWLTPEARAHWDLIAAKYAAPGTNLPHD
FT                   DAHTGRDDRTTGQRHHDALTTVLRDAVTSGSLGQVAGVPASIVATMTLSELERAAGWAH
FT                   TGGGNRLPIRDLIRMAAHSRHYLAVFDDHTEEILYFGRARRTASTAQRLALFARDKGCT
FT                   HPGCTVPFYWTEAHHTHDYSRGGRTDIDDLTLACQPANLLIEKTGWTTHRPGNGRTEWT
FT                   PPADHDTGQPRINNHFHPHRYLTDNDDGQDDEPE"
FT   gene            complement(376090..376755)
FT                   /locus_tag="Mmcs_0339"
FT   CDS_pept        complement(376090..376755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0339"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   tfu:Tfu_1374 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06460"
FT                   /protein_id="ABG06460.1"
FT                   /translation="MPLATTRRAGLVDQVIAQLRASVSAGEWPVGTRIPTEPALVAALG
FT                   VGRNTVREAVRALAHSGILEVRQGDGTYVRATSEVSGAVRRLCGSELREVLEVRRCLEV
FT                   EGARLAATARTAEDLAEIRATLARRDALDARDEFVRADAEFHFAVVRASHNAVLTELYR
FT                   GLTEVVTASVATTVETHAFDRIPHDGLVEAIARGDVDRAGHEAGGFLEELIEELPDRR"
FT   gene            376802..378013
FT                   /locus_tag="Mmcs_0340"
FT   CDS_pept        376802..378013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0340"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV6466 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06461"
FT                   /protein_id="ABG06461.1"
FT                   /translation="MKGHTRVDATAGQASEAGVRAAGGVLLTIAVILTALNLRPAITSV
FT                   GPMLGEMRTSMGASATWAGVLTTLPGLCFAAAGLTAPWLSRRFGLSRAISAALTILSAG
FT                   LLIRVLDGPYVVLGGTLVATAGIALTNVLIPVVIKGSFPTRVGLMTGVYTAALQGGGAL
FT                   GSAVTPGLEAVFDDWRTALASWAVVAVVALVFWILASRGIAGGQPSTTRVNGRSLLRNR
FT                   MAWTVTLFFGCQSLLAYVMMGWLPEVFIDSGVSKSTAGLLVGLMSLIAVPISIFVSPLA
FT                   ARSSSQSPWIVGLGTIGVAGVIGLLIDPGAAPLLWSILVGLGLSVFSLALTVIALRART
FT                   TEDTAQLSGMAQGFGYLLAGLGPFLFGLLHDVTDGWTVPWAMVLVVYLVQMTMGALAGR
FT                   NRYV"
FT   gene            complement(378015..378509)
FT                   /locus_tag="Mmcs_0341"
FT   CDS_pept        complement(378015..378509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0341"
FT                   /product="putative alanine and proline rich membrane
FT                   protein"
FT                   /note="KEGG: mbo:Mb2500 possible alanine and proline rich
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06462"
FT                   /protein_id="ABG06462.1"
FT                   /translation="MPPGPQPIGAARSRSTALSVIACLIATAALILSVWTWWQARPPSY
FT                   DAAAQAGAKDTACAAYTQVRTGVATNTHLASPGGDDDVTGVLAVAANARVALMGGGQYL
FT                   LDILDPATPPELADAVRQFAMKLMQFGAAATAGAPDSDPGQQAVKRDLDALTATLDGLC
FT                   G"
FT   gene            378565..379137
FT                   /locus_tag="Mmcs_0342"
FT   CDS_pept        378565..379137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0342"
FT                   /product="peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: nfa:nfa32010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06463"
FT                   /protein_id="ABG06463.1"
FT                   /translation="MGVWRTVCRVSVAVGCACGVLFGAAPSHADPAEPGVDTLVGPAAT
FT                   DTFGGYLPEDGTLTAFDVENPIVGRLDPALLAAVQEASRAAAADGVEVEINSGWRSIGF
FT                   QERLFEDGVRTYGSVEVARQFVASPQTSMHVVGRAVDVGGPGAAAWMSRNGPRFGLCQV
FT                   YANELWHYELTADANGACPPMKPNATG"
FT   sig_peptide     378565..378654
FT                   /locus_tag="Mmcs_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            379197..379847
FT                   /locus_tag="Mmcs_0343"
FT   CDS_pept        379197..379847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0343"
FT                   /product="FadD16"
FT                   /note="KEGG: mpa:MAP0781 FadD16"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06464"
FT                   /protein_id="ABG06464.1"
FT                   /translation="MTTGVAGSLILTSDYRVADPSRVWPLLERRRAELAAIGAHHVFVH
FT                   TSISEPDRVLVTMALHTVEPVADLLRSHVFFDWFDAVGVADLPAVFAGELVDRFHIEPG
FT                   HHWTAKAPAVVIAGVTVVRDVDTLLGQVHRTRDLFRRNGIENVWIFRALDDPHEVMFLQ
FT                   DVADEASARRWLERPETAEKWLAEAGVGAYPPVFVGALRHVMRIDVAEHVNGP"
FT   gene            complement(379844..381124)
FT                   /locus_tag="Mmcs_0344"
FT   CDS_pept        complement(379844..381124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06465"
FT                   /protein_id="ABG06465.1"
FT                   /translation="MSGDWVVGDHLGLPIPATAAALRDGGETFLTNAFRAFGALTEDNR
FT                   VVRIGRCDEMTGGSTGRKMLLDVEYARPEPGLRTDLFVKFSRDFDDPVRDRGRTQMASE
FT                   VVFAALSRTPGFPIAIPHPRFGDYHAGTGTGILITDRIPFGCNGVERQYEKCLDEDMPH
FT                   PDEHYRALVTALARLAGAQRSGRLPEQLSAAFPVDLRAATVGEPVTLSPDRLQRRLSRL
FT                   GEFTETHPGLLPPHVRTSGFLARLGEEAHEVLRREQAIWRSLRDADDHIALSHWNANVD
FT                   NAWFWRDGGGVLQCGLMDWGCVSRLNLAMALWGALCAAETDLWDNHFDELLVLFCTEVE
FT                   GAGGPRPDPVLMRRHLMLYMALMGITWLLDVPARIGNRLPDADVHTTRHDPRIRGDESL
FT                   RAPLQMFTNMLNLWQTRGLSGHLEGLD"
FT   gene            complement(381124..381390)
FT                   /locus_tag="Mmcs_0345"
FT   CDS_pept        complement(381124..381390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06466"
FT                   /protein_id="ABG06466.1"
FT                   /translation="MPEHDMRAYDYEKMKKDAEPFIKFEKDVENRIAYITFDRPEAQNS
FT                   TTMGMRQNYADLIHKCNVDDDVKDNDLNFPPEWRLSRSGRNKP"
FT   gene            complement(381483..383753)
FT                   /locus_tag="Mmcs_0346"
FT   CDS_pept        complement(381483..383753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0346"
FT                   /product="Trehalose synthase"
FT                   /note="TIGRFAM: Trehalose synthase; PFAM: alpha amylase,
FT                   catalytic region; KEGG: psp:PSPPH_2425 trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06467"
FT                   /protein_id="ABG06467.1"
FT                   /translation="MSEAPETDYDDQAGSGTDDQTNEPSEITYDEYLHPARPRALRFRP
FT                   RVKSPFTRRSVAQDGPARADNPAYVSWLLSQSMLADANEISQQFSGQGSMWQNPYATPS
FT                   PRGAVETASVWFTAYPLSLITRPNESFLKALADDEMWKAFADIGIEAIHTGPVKRAGGI
FT                   SGWQTTPSVDGHFDRISTEIDPAFGTEEEFRKMCGTANWYGGTIIDDIVPGHTGKGADF
FT                   RLAEMKYADYPGIYHMVEVDPRDWEHLPAVPPGVDSVNIDQATEEWLDKAGYIIGRLQR
FT                   VIFYAEGIKETNWSVTRPVLGVDGVERRWVYLHYFKDGQPSINWLDPSFAGMRLVIGDA
FT                   LHSLADLGTGGLRLDANGFLGAEKTAAEDSTAWSEGHPLSEAANHLIASMVRKVGGFTF
FT                   QELNLTIDDIRQIGEAGADLSYDFINRPAYQHALATADTEFLRLTLRTTLELGVDPASL
FT                   IHALQNHDELTYELVHWSNGHRDDIYTYKGEEITGEALGETIRRDLSVRLTGENAPYNL
FT                   VFTTNGIACTTATVIAATLGITDLDEIDDDPVRIDRIRRAHLLLAMFNALQPGVFALSG
FT                   WDLCGMLTLPAGQVGELLRGGDTRWIHRAAHDLMGVNPGATQSLAGMPRGRSLYGSIPD
FT                   QLDDETSFLRQLQAILRVRSHYGIATSRQVDIPEVSHRGMLVLVHQLADEGRYQLTVLN
FT                   FANEEVAGTVRSEALPPGAEVSDMFTGHAFATVDDLHSFTVEMPAHHGMSLLVEVTADD
FT                   SET"
FT   gene            complement(383933..385312)
FT                   /locus_tag="Mmcs_0347"
FT   CDS_pept        complement(383933..385312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0347"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sco:SCO3622
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06468"
FT                   /protein_id="ABG06468.1"
FT                   /translation="MTLTNETTLPNGLSVDDARAEAARAYELDRKHVFHSWSAQAEISP
FT                   MVITAAQGSYIWDGEGRRLLDFSCQLVNTNIGHQHPKVVAAIQAQAAKLCTVAPQHAND
FT                   ARSEAARLIAERTPGELNRIFFTNGGADAVEHAVRMARLHTGKYKVLSRYRSYHGGTET
FT                   AINLTGDPRRWPNDHGNAGVVHFFGPFLYRSQFHATTEAEESARALAHLEDIVRLEGPS
FT                   TIAAIVLESIPGTAGIMVPPPGYLAGVRDICDRYGIVMIADEVMAGFGRSGKWFSIDHF
FT                   DVTPDLLTFAKGVNSGYVPLGGVAIGPAIAETFAHRPYPGGLTYSGHPLATAAAVATIN
FT                   AMEEEDIVGNAARIGAEVLGPGLAELAARHPSVGEVRGTGVFWAIELVANPQTREPLAP
FT                   YGASSAAMNAVVAACKANGLLPFANFNRIHAVPPCTVTADEVREGLAILDQALDVADSH
FT                   L"
FT   gene            complement(385399..386892)
FT                   /locus_tag="Mmcs_0348"
FT   CDS_pept        complement(385399..386892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0348"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: tfu:Tfu_0687
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06469"
FT                   /protein_id="ABG06469.1"
FT                   /translation="MANTVQHWCNNDVFAGGSQATAPVTNPATGEVTGQVALAGVEDAR
FT                   TVIEAAAAAFPAWRDTSLAKRTSVLFNFRELLNARKHELAAIITAEHGKVLSDALGEVS
FT                   RGQEVVEFACGIPHLLKGGFTENASTNVDVYSIRQALGVVGIISPFNFPAMVPMWFFPV
FT                   AIATGNTVVLKPSEKDPSASLWLARLWKEAGLPDGVFNVLQGDKTAVDELLTHPKVKAV
FT                   SFVGSTPIAQYVYATGTAAGKRVQALGGAKNHAVILPDADLDLAADAMVNAGFGSAGER
FT                   CMAISACVAVGPIADDLVAKIGERARALRTGDGTKDSDMGPLVTKAHRDKVASYIDAGE
FT                   ADGAKVVVDGRQVSADGGENGFWLGPTLLDNVTPEMSVYTDEIFGPVLSVVRVETYDEA
FT                   LELINSNPYGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFGGWKNSLFG
FT                   DSHAHGTEGVHFFTRGKAITQRWLDPSHGGINLGFPQNN"
FT   gene            386973..388601
FT                   /locus_tag="Mmcs_0349"
FT   CDS_pept        386973..388601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0349"
FT                   /product="purine catabolism PurC-like protein"
FT                   /note="PFAM: helix-turn-helix, Fis-type purine catabolism
FT                   PurC-like; KEGG: tfu:Tfu_0685 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06470"
FT                   /protein_id="ABG06470.1"
FT                   /translation="MTMTVADVIGLPVVARGEPEVLSARRWEDPIRWVHVGDVADLSAL
FT                   LQGGELVLTTGAGLAADPRRYLQGLADAGAVGVVVELGTAMTAVPQWVVAHAERLDLAL
FT                   VALHRQIKFVAVTEVVHRRIVAAQYDEVAFDRRVHETFTELSMKRASPAGIVDAAARIL
FT                   GEPVVLEDLAHQALAVAPGGDAAATLLQNWERRSRASAADGDWAVTSVGPRGEEWGRLI
FT                   VPAAPPDRARATMVLERAAAALALHRMIERNRSGLHQQAQSGLIDDVVAGRITDEREAA
FT                   ARAHALGLRRSARYLPLVVRVDRGAVTMDPVVAQRRNVELLDAVAHTVNAAGHTALCSI
FT                   RRDGEIGALVALDPGRGGWDRALTALGERVHAEVRRRDGGARSEGRSVCAVGDPAAEIV
FT                   EAIHGLGEAAHVGEVAIAMHGHGQAVYRASDVRLRGLIALLRDDPRVQQFAETELRALL
FT                   LDDDERVPSNLEVLRQYLQVAGNKAALAQRLHMSRPALYKRLAAIGRTLGVDLDDAESM
FT                   TSLHVAVLILDAQRRAAPAVLTRGG"
FT   gene            388781..392953
FT                   /locus_tag="Mmcs_0350"
FT   CDS_pept        388781..392953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0350"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver ATP-binding
FT                   region, ATPase-like histidine kinase A-like Stage II
FT                   sporulation E PAS fold-4 PAS fold; SMART: PAS PAC motif
FT                   Protein phosphatase 2C-like; KEGG: gvi:glr2749
FT                   two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06471"
FT                   /protein_id="ABG06471.1"
FT                   /translation="MGVEEAGAASLTSSASALFGADPEVGRHLAMVDWASTALGDPTAW
FT                   PQSLRTAVNILLSSRFPMWMAWGPELTFFCNAAYRRDTLGRKYPWALGRPASEVWAEIW
FT                   PDIGPRIESVLSTGRATWDSALLLFLERSGYSEETYHTFSYSPLRDDGGQVVGMLCVVS
FT                   EDTERVIAERRMTTLRDLGSDPSVVRTERQMLDFAAEQLGRNRHDLPFTLTYLFGDDGD
FT                   AVLAASSGITPGHAAAPETLSADGMSVWPVRQPAEGETVLLEIDGESLALPRGVWPDPP
FT                   TQALVVPLLQQGADPVGFLVAALNSHRRLDAPYRGFIELVAGHIAAGIGSARSYGAQQR
FT                   RAEELAELDLAKTTFFSNISHEFRTPLTLILGPLAEMLRTSELDVRVREELELAHRNGL
FT                   RLAKLVNTLLDFSRIQAGRMRAQFEPVDLAAVTAELASVFRSAIERAGLEFTVDCPPLA
FT                   EPVFVDRDMWEKVVLNLLSNALKFTREGAVTVRVTADDGVAVVTVADTGVGIPEAEMPR
FT                   LFERFHRVETVDARSTEGSGIGLALVKELIGLHGGTIGAQSEEGRGTTFTIQMPFGAAH
FT                   LPADEVVPHGRVSGVSANADPYLQEALRWLPASDPESDSRDPIAAPVPATGGSGTGTAV
FT                   PARILIADDNADMRAYLTGLLRGAGYEVTAVSDGRQALESIRAELPDLVVSDVMMPGLD
FT                   GLELVAALRAESRTAALPVLLLSARAGQESSIEGLHAGADDYLVKPFAAAELLARVHAN
FT                   VALARLRNHHSRWRTALIDSLQEAFFVCDEDGAVVEINAAFSQILGYGPEGLPYQPVQP
FT                   WWPDPDTDPEGYRQTSQAFGGVMGQSRGEFTFPVVHRDGHRLWVNANFNPARDPDTGRR
FT                   VAVGTFRDVTAEHYIVQREMALAALNAQLAEADTLDGALRAAVAELHRLWQARRVLAVT
FT                   FPGADGDVTPDVICAGEAVQWSDLPAGQRDTITALRTADLLTADTEEYGTAGITLQHPR
FT                   GVLVLWIELLEQRPFTPEDRTLLTVLAGRLGQGLQRVHRLDQQRETALTLQHAILGPAR
FT                   LPGGFAVRYHPATRPLQVGGDWYDVVDLDGDCIALVVGDCVGHDLEAATVMGQLRSACR
FT                   ALLLDQPSPGAALAGLDRFAARLPGARCTTVWCAVLSPETGELVYSSAGHPPPILVGPD
FT                   DGHRVLDDARGFALALRPDQERPEARVTLSARTTLLLYTDGLVERRRASLETGIGRAAD
FT                   LVADGRSDALDAVADQLMSRLAPDGGYQDDVALLLYRQPAPLDLVFPARNEYLASSRTA
FT                   LRRWLTKAGVGPDQAMNVLIAAGEAVANAIEHGHRDRPDGRVTLRATAMVDRLQVSILD
FT                   TGSWKTPRTEVDTRRGRGVALMEGLMDDVTIRPGDDGTTVHLEAGIL"
FT   sig_peptide     388781..388843
FT                   /locus_tag="Mmcs_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.845) with cleavage site probability 0.844 at
FT                   residue 21"
FT   gene            392953..393285
FT                   /locus_tag="Mmcs_0351"
FT   CDS_pept        392953..393285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0351"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mpa:MAP2077c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06472"
FT                   /protein_id="ABG06472.1"
FT                   /translation="MATPLTVNADRHTDGTPLLVAAGEIDLSNVETFTRALITVIAAAD
FT                   GAGGTVTVDLSAVEYLDSAAIGALSVHADQVPQMRLVANPYLIPVLRISGIDQLATVEP
FT                   AQPTDG"
FT   gene            393296..394459
FT                   /locus_tag="Mmcs_0352"
FT   CDS_pept        393296..394459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0352"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: mpa:MAP1682c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06473"
FT                   /protein_id="ABG06473.1"
FT                   /translation="MIGWFDRLQQRSRAMGYVIAVVYKYVDDQGGYLAALITYYAFVSL
FT                   FPLLLLLTTALGVVLVGRPELQRQIVESTVNQFPLIGEQLAQPEQLSGGAVAVVVGILG
FT                   ALYGGSGVGQAVQNAMNSVWAVPRNVRPDPIRSRVRSLLLLLVLGSAAIAATLLSAVGR
FT                   AVDDLGVLGTAGVVVGTIAINTGILLVAFRTTTSRELTYRQVLPGALAGALIWQFLQWF
FT                   GAGYVARTVSSASATNTVFALVLGLLAFLYLISVSLVLCAELNVVRVDHLYPRALLTPF
FT                   TDSVTLTSADRRTYTRKAKAERVKGFQHVAVTFRPSRSHSHEGLDPAAGEVEEEAGGHD
FT                   PQQRADLAGLPGAGADDHPRDEPDTDSVGDGVGERHGGDGEDDRQRH"
FT   gene            complement(394250..395665)
FT                   /locus_tag="Mmcs_0353"
FT   CDS_pept        complement(394250..395665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0353"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   lxx:Lxx08900 xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06474"
FT                   /protein_id="ABG06474.1"
FT                   /translation="MNRLDRFFEISARGSTLGAEVRGGLVTFIAMAYIIVLNPIILSSS
FT                   DDVEGNSLQFAQVSATTALAAGVMTILFGLIARLPFAFAAGLGINSFLATTVVGDVTWP
FT                   EAMGLVVINGLIIVLLAVTGLRRLVFDAVPMQLKLAITAGIGLFILFIGLVDAGFVNST
FT                   GLASPPVGLGAGGLGSINTVPTLIFVITLLVTGVLVARRVRGGILIGLVAGTVIAVVVE
FT                   AIWDLGSAQDKAGGWSLSVPQLSGSPFALPDLSLVGEFSLTGAFERIGILAAVMLVFTL
FT                   VFANFFDAMGTFTGLSREAGLSDDRGTFPRLRSALIVEGAGAAVGGASSASSNTVFIES
FT                   GAGIEEGARTGLANLITGALFLAAMFVSPLASIVPTEVAAAALVVVGAMMVSHLRHIEL
FT                   SEFSVALPVVLTVAAMPFTYSIANGIGVGFISWVVVRSGAGKAREISPLLWVVAAGFLF
FT                   YFARSWIETLMGV"
FT   gene            395740..396654
FT                   /locus_tag="Mmcs_0354"
FT   CDS_pept        395740..396654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0354"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mbo:Mb2007c
FT                   chromosome replication initiation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06475"
FT                   /protein_id="ABG06475.1"
FT                   /translation="MATAHSRTRDEVRLGADQLAALAAVIEFGSFDAAAEHLHVTPSAV
FT                   SQRIKALEQRVGQVLVVREKPCRATASGIPLLRLAAQTALLEAEALGELGGPGAALVPR
FT                   VAVAVNADSMATWFTAVLGDVSEVLFDIRIEDQDHSARLLREGVVMGAVTTERSPVPGC
FT                   RVQSLGVMRYLPVASAGYVERYLPDGFTAVAAAHAPSLAWNRDDALQDMLIRRAFRRAI
FT                   TRPVHYVPTAEGFGAAVRAGLGWGMYPEQLAVPELAGGSLVRVADVHLDVPLYWQCWKL
FT                   DSPLVARLTGAVRSAAAGLARRR"
FT   gene            complement(396659..397870)
FT                   /locus_tag="Mmcs_0355"
FT   CDS_pept        complement(396659..397870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0355"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sru:SRU_0317 putative filamentous
FT                   hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06476"
FT                   /protein_id="ABG06476.1"
FT                   /translation="MDPTAEPADRCFDVLVVGGGNAGVSAAARLIRKGVTDVALIEPQR
FT                   VHTYRPLLSYVGGGQAAMRDAERTQRSVTPRRCTWLQDAAAMIDAPNRTVSCSSGRRYR
FT                   YRDLILGTGLVPDTDALPGIHTALDTPAVASNYVDRAEETWQLVQAMPPSGRAVFTVPR
FT                   PPVSCTATTLKPLFLAAAHWKRTGRFPGVDITLVVDRPHLLPAPRIDDRLRDHLRALEV
FT                   RVLFDTAVTALSPDQRNITVTGRDGSSETLPYDMLHLVPPFRGVRWLEGSGLTNGRPHG
FT                   LIDIDPETLRHRTHPEIWAAGDAAAVETDPSGGALRRQVSILVENLLAAREGGDLQRYD
FT                   GYTVAPVTTDAHHLIPGEYDRTGSVASSLPSFVDPLESRRTAWAFDRYVLPRTYWNLIL
FT                   RGRV"
FT   gene            397961..399073
FT                   /locus_tag="Mmcs_0356"
FT   CDS_pept        397961..399073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0356"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: GGDEF domain; PFAM: GGDEF; KEGG:
FT                   tbd:Tbd_2814 putative diguanylate cyclase (GGDEF domain)
FT                   with PAS/PAC sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06477"
FT                   /protein_id="ABG06477.1"
FT                   /translation="MPVGEGGSLVHWFRRWWRQPDHFDWITGYLAARGMLGVARWNLAS
FT                   STVALALVPAVLAMSSRGPDAGPDQVLSRIAVLGGLCAATLWVVRWPTRAQSVAYILAA
FT                   NLFITLACYVQDDPMVGLMGCTVFATTGGYIALFHTPGYMLYNFGVALYVGVLQTVRLA
FT                   VETSDPALAVGLLLLVLVLNVAVPFAVQAIVHALGVDLLRAARDPLTGLLNRRAVYQQI
FT                   EQLLSSHRDRHVHLAVAVVDLDDFKQLNDSHGHAIGDEALVAVAQALRAGAGEGAVVGR
FT                   LGGEEFVLAELLEAGQIDHWAQRMCTAVDVVPFPVTASVGVAAVCLPLPADDDAQTVIH
FT                   MLIGAADHAMYAAKRAGGNQFRHDDRSACC"
FT   gene            399087..399776
FT                   /locus_tag="Mmcs_0357"
FT   CDS_pept        399087..399776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0357"
FT                   /product="4-amino-5-aminomethyl-2-methylpyrimidine
FT                   deaminase / thiaminase"
FT                   /note="PFAM: TENA/THI-4 protein; KEGG: sto:ST1007
FT                   hypothetical transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06478"
FT                   /protein_id="ABG06478.1"
FT                   /translation="METPDESTTNTWSQRLWHETEPIFSAIMAHPFISGLTDGTLDPEV
FT                   FAHYVAQDVHYLRDYARALAVVGAKAPRLADTAMFARHSAEIVEVELSLHETLLPEIGL
FT                   DPAELDRVPVAPTTRAYTSYLLATVYGGSFADGLAAILPCYWIYARVGEELIGRGSPDS
FT                   RYQRWIDSYGGDEFAATVKEVLELTDRVGPTLKPAEEAAARAHYVTTARYEWMFFDAAH
FT                   RREAWPV"
FT   gene            399779..400429
FT                   /locus_tag="Mmcs_0358"
FT   CDS_pept        399779..400429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC1708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06479"
FT                   /protein_id="ABG06479.1"
FT                   /translation="MAPHSFDAPVRRWEDIPGWFGWRQAQEEAVAHFGDGDRFSAPRFV
FT                   APRFVEVGSYLGRSLCSLAEVVRQSGREIGIVGVDTCRGSGPEGAREINAHGPAVEFGG
FT                   GTFAGLLHRNVIACGFADTVALLITDSVSAARMFDDESLAWVHIDARHDYESVRADIAA
FT                   WAPKVGPGGWLSGDDYHPEWWPGVVAAVEEALPDAREWTPGQWRWRKPPASDR"
FT   gene            complement(400530..400985)
FT                   /locus_tag="Mmcs_0359"
FT   CDS_pept        complement(400530..400985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0359"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mpa:MAP4007c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06480"
FT                   /protein_id="ABG06480.1"
FT                   /translation="MTLTSTSTGSHSAFHYGNPSFDCDRVRMRARCRQLATVVTVTGDI
FT                   DADNLSCVADYARRFVLAEKPFILDLSGVSTFAAEGLSLFYEIDARCAEADVEWSVIGS
FT                   QPVLQVLRASGTLDDMPVTASVPEALHHFSEGILARRRLLPLLTKTA"
FT   gene            complement(401138..402442)
FT                   /locus_tag="Mmcs_0360"
FT   CDS_pept        complement(401138..402442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3713c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06481"
FT                   /protein_id="ABG06481.1"
FT                   /translation="MADMAGPRAQGLTLDIAGRTLTVTHPDKVVFETHQGRPPISKLDL
FT                   IEYYLAVADGALRGVADRPMILKRFVKGITEEAVFQKRAPAKRPDYVDVAELKYASGTS
FT                   AKEAVIHDAAGLAWAVNIGCVDLNPHPTRSGDLAHPDELRVDLDPMPGVDWQQIVAVAM
FT                   VAREVLEDHGLTAWPKTSGSRGFHIYARIEPRWPFKFVRLAAQTIAREVERRAPDLATS
FT                   RWWKEEREGVFVDFNQNAFDRTVASAYSVRATPDARVSTPLRWDEVPGCRPEAFTVATV
FT                   PARYAEIGDPWESMDDHPGRLDALLDLADRLGPAEKAPRGAKRQGAGATGRRQSVMPLI
FT                   EIARTKTKDEALAALDTWRQRHPAAAERLQPPDVLVDGMRGPSSIWYRIRINLRHVPEE
FT                   QRPPQEPLLADYSPWENYTGPQWASQSRHGPDTDR"
FT   gene            402500..404233
FT                   /locus_tag="Mmcs_0361"
FT   CDS_pept        402500..404233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0361"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpa:MAP3714 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06482"
FT                   /protein_id="ABG06482.1"
FT                   /translation="MPKLTELPSQVAAKAKLYLDRGSAELHYARKMFEAGALQLEPPQN
FT                   MAAFVADMRRWGEFGMIPALNARRTPDRNAVIDDEGEMTYAELDEAAHAVAHALLAKGI
FT                   KGGDGVAVLARNHRWFLVAVYGAARTGARIILLNSEFSGPQIKEVSEREGAKLIIHDDE
FT                   YSKAVSQAKPELGYLRALGTNPDNSEPSESDAQTLADIVAGGDKAPAPKVTKHSSVIIL
FT                   TSGTTGTPKGANRKPPMSLAPIGGILSHVPFKSGEVTLLPAPMFHALGYLHATIGMMLG
FT                   STLVLRRRFKPATVLADVEKYRATAMVVVPVMLSRLLDHIEKTDTKPDLSSLRIVFVSG
FT                   SQLGAELATRAMKDIGPVIYNLYGSTEIAFATIARPEDLQKNPATVGPVVKGVRVKLFD
FT                   ENGKEVPRGEVGRIFVGTTFPFEGYTGGGHKQIIDGLMSSGDVGYFDEDGLLYVSGRDD
FT                   EMIVSGGENVFPAEVEDLISGHPDVVEATALGVEDKEWGHRLRAFVVKAEGASVDEDAI
FT                   KGYVKEHLARYKVPREVVFLDELPRNPTGKILKRELREMDVDGSDGSDGSDGSGGDTKA
FT                   E"
FT   gene            complement(404237..404545)
FT                   /locus_tag="Mmcs_0362"
FT   CDS_pept        complement(404237..404545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa24380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06483"
FT                   /protein_id="ABG06483.1"
FT                   /translation="MTNDVEKRWHDPQAFHSAVTYVVAVIAVAGVCFAFYAIPDDHSLI
FT                   AAILVPVVLFAGGVGAFIQTYRVWKFRGTWPIWHGAGWFLFMLFLLCLSVPGSALTD"
FT   gene            404606..405511
FT                   /locus_tag="Mmcs_0363"
FT   CDS_pept        404606..405511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0363"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   pfo:Pfl_4137 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06484"
FT                   /protein_id="ABG06484.1"
FT                   /translation="MGDASVRSRIRAGLLAYAAGDAAGVPWEGCLAAEIDRPGIDELPR
FT                   RGDWPPGATSDDTALTLLVAEYLRDRGAVVEEADFLTRLAAAAPHIRGIGPSTRAAVDR
FT                   FRTRGALHAETGDTNGAAMRALPIGWAVADDGLRRTVTTGLSRTTHGAASAVAAACIAS
FT                   AMASAAVDGSSLFDAAATEIDWAETQFGIELRPVRDAVDGRWRPGRNGVSLEAVGAVAA
FT                   VVDVVRHADVGHLSVADALRYAVSLGGDTDTAAAIAGGILGGRVTGTPDIPWLDRVDLP
FT                   DGATLDGLSAALAELRASTG"
FT   gene            complement(405471..406757)
FT                   /locus_tag="Mmcs_0364"
FT   CDS_pept        complement(405471..406757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0364"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA0865 probable transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06485"
FT                   /protein_id="ABG06485.1"
FT                   /translation="MWRTVPILMALYFVNYLDRTNLGIARADISAHLQLSATMFGFASG
FT                   IFFIGYVLVEVPSNLALHRFGARRWLARIAVSWGLVVVAIGFAPNAPTLLALRFLLGVA
FT                   EAGLFPGVILYLSRWFPTAYRARVVAMFMLASPIAAAVGTPVGAWLIDVGDGLFGLAGW
FT                   QFMMICSGLPAIALGVVCWIALTDRPADANWLPDDEKRWLIGVLAAEEHAVSSRFDFPL
FT                   RRALRSPRVWALAVVYFGVAYGLYALAFFLPSIIAGFREDFGLTLSIEQVGLITAIPYA
FT                   FAAVAMYLWSRRADRTGAHTRHVAVPMLLGGLAIPVALYLDSPVLVMIPVTLAAMGVFS
FT                   AIPSFWALPSRFLTGAAAAGGIGLINSVGNLGGFAAPYVTGALDDALGSARAGMWAVGL
FT                   MMVISAGVVFTLSNDRLSPSTPATPPARR"
FT   gene            complement(406844..407137)
FT                   /locus_tag="Mmcs_0365"
FT   CDS_pept        complement(406844..407137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb2718c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06486"
FT                   /protein_id="ABG06486.1"
FT                   /translation="MTVDYDAPRRKQEDLESDSLDELPVGRADARTAVLDDDAEEVDTV
FT                   DLPGADLSGEELTVRVIPKQADEFTCSSCFLVFHRSRLARDSNGTMICADCA"
FT   gene            complement(407239..409431)
FT                   /locus_tag="Mmcs_0366"
FT   CDS_pept        complement(407239..409431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0366"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   mpa:MAP3716c FadE6"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06487"
FT                   /protein_id="ABG06487.1"
FT                   /translation="MPIAITEEHNDLADSVRSLVARVAPSEMLHDALENPIPNPPPFWR
FT                   AAAEQGLQGVHLPESVGGQGFGILELAIVLAEFGYGAVPGPFVPSAIAGALIAAHDPDA
FT                   KVLSGLASGDVIAAYAIDSGLTATRHGDGLVIRGEVRAVPAAAQASVLVLPVAIDSSDE
FT                   WVVLDAGQLEIEPVASIDPLRPVAHVRANAVDVADDRVLSNLTPALARALIVTLLSAEA
FT                   IGVARWATDTASGYAKIREQFGRPIGQFQAIKHKCADMIAQTERATAAVWDAARALDEV
FT                   RENVTDEPHFEFAAAVAATLAPTAAQHCVQECIQVHGGIGFTWEHDTNVYYRRALVLAA
FT                   AFGRRADYPQHIVDTATTTGMRPINIDLDPDTEKLREEIRAEVAALKALPREERTVAIA
FT                   EGGWVVPHLPTPWGRGAGPVEQILIAQEFAAGRVKRPQMGIAAWLIPSIVAFGTDEQKQ
FT                   RFLPPTFRGEMIWCQLFSEPGAGSDLASLTTKATKVDGGWRVTGQKIWTTGAQYSQWGA
FT                   LLARTDPNAPKHNGITYFLLDMNSEGVEVKPLRELTGNAMFNTVFIDDVFIPDELVVGE
FT                   VNRGWEVSRNTLTNERVSIGSSEPPFLATLDGFVEFIRDGHFDQIGQNKAGQLIAEGHA
FT                   AKLLNLRSTLLTLAGGDAMPSAAISKLLSMKTGQGYAEFAVSSFGTDGVLAEPESLEFK
FT                   WVEYLLGSRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(409491..410108)
FT                   /locus_tag="Mmcs_0367"
FT   CDS_pept        complement(409491..410108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0367"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mbo:Mb0281c
FT                   possible transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06488"
FT                   /protein_id="ABG06488.1"
FT                   /translation="MGQVRPYRGVEAPERLAQRRQRFLEAGLDLLGSAEQDLAELTVRA
FT                   ICRRAGVTVRYFYECFTDKDDFVAAVFDWVINGIATTTQAAAAAAPPRAQSRAVMTDII
FT                   RTVSEDPRIGRLLFSSQLSNTVVVRKRAESGALFAMLSGRHASAALRQSENDRIKAAAH
FT                   FVVGGVGQTISAWLAGSFALDPDGLVDQLTAMVDQLADPRLY"
FT   gene            410183..411094
FT                   /locus_tag="Mmcs_0368"
FT   CDS_pept        410183..411094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06489"
FT                   /protein_id="ABG06489.1"
FT                   /translation="MTVSEPLPHVERPVSAPAHPDKLTPPPALARRAASMEDGLMGVAL
FT                   LAGPANVIMQLARPGVGYGVLESRVESGRVDLHPVKRARTTFTYLAVATRGSDAQKAAF
FT                   RRAVNKAHAQVYSTDESPVKYHAFDKDLQLWVAACLYKGAVDVYRLFVGEMDDQAAEEH
FT                   YRDSMTMGTTLQVPPEMWPADRAAFDKYWQESLDKVHIDDTVREYLYPIAASRLRGLKL
FT                   PGPLQRRNEELALLITTGFLPQRFRDEMRLPWDADRQRRFDRLIGVLRTVNHLLPRFIR
FT                   QFPFNVLLKDLDRRIRTGRPLI"
FT   gene            411111..412013
FT                   /locus_tag="Mmcs_0369"
FT   CDS_pept        411111..412013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0369"
FT                   /product="Protein of unknown function Mtu_121"
FT                   /note="TIGRFAM: Protein of unknown function Mtu_121; PFAM:
FT                   O-methyltransferase-like; KEGG: mbo:Mb0289 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06490"
FT                   /db_xref="GOA:Q1BF44"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BF44"
FT                   /protein_id="ABG06490.1"
FT                   /translation="MRHDNDSWDITTSVGSTALFVAASRALEARKPDPLAVDPYAEVFC
FT                   RAAGGDWAGLFDAGADPKPDHVLFSEFGEQFVNFQGARTRYFDAYFAAASDAGVRQVVL
FT                   LAAGLDSRAYRLPWPDGTVVYELDQPRVLEFKREVLAERGEQPVAQRREVAVDLRDDWC
FT                   AALTAAGFDPARPSAWLAEGLLMYLPATAQEALFSGIDALSAPRSWAAVEESVPMPAEV
FT                   FAYKREEERAAGEEGTFFTLVYNERHAPAERWFGERGWAAEPTSLADYLTRVGRPAPVD
FT                   DPEFGAMISAIRLVTATKG"
FT   gene            412209..413993
FT                   /locus_tag="Mmcs_0370"
FT   CDS_pept        412209..413993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0370"
FT                   /product="AAA ATPase, central region"
FT                   /note="PFAM: AAA ATPase, central region; SMART: ATPase;
FT                   KEGG: mpa:MAP3778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06491"
FT                   /protein_id="ABG06491.1"
FT                   /translation="MVSRFATCCRALGLTVNDRQRPADVSAARTGFAALTHIAHDQCDA
FT                   WVGLAAAGDVSARVVEAIWSTRHSAGALQRHLEMAPGALGFHYDSGLYLQFRATDGDDF
FT                   QLAYAAALCDNGAYADADALVGELIERRPGWPQARWLRVAIHHRTQRWSDVVRLLTPVV
FT                   NDPSLDATYAHAARVTLGIALARLGMFAPAMSYLAEPAGPIAVAAVDGGLAKGLTLRAQ
FT                   GEEEDAADALQELYAANPENAEIEAALTDPTFGLVTTTAARIEARSNPWDPETEPSESD
FT                   FVDPGAKDRKAHLLVEAEAELADFIGLEEVKYQVARLKSSVAMSIRRQERGLAVAQRTN
FT                   HLVFAGPPGTGKTTIARVVAKIYCGLGLLRKETVREVHRADLIGQHIGETEAKTNAIID
FT                   AALDGVLFLDEAYALVSTGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRKDLDMFLD
FT                   ANEGLRSRFTRSIDFPSYSPGELVEMAVRMAEKRDSVFEPAAHDDMEKLFAQLAESSSP
FT                   DANGVDRRSLDIAGNGRFVRNLVERSEEEREYRLDHSGDHSAEADDFTDEELMTITVDD
FT                   VRKSAEPLLRGLGLTVSA"
FT   gene            413990..415540
FT                   /locus_tag="Mmcs_0371"
FT   CDS_pept        413990..415540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0371"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mbo:Mb0291 possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06492"
FT                   /protein_id="ABG06492.1"
FT                   /translation="MTTPDDRRSFSSRTPANENPERITYRRGFVTRHQVSGWRFVMRRT
FT                   ASGVALHDTRMLVDPLRTQSRAVLTGALILITGLAGCFVFSLIRPAGSAGTDTVLADRS
FT                   TAALYVRIGEQLHPVLNLTSARLIAGRADNPTTVKTSEIDQFPRGNLVGIPGAPERMVQ
FT                   NDSRDAEWTVCDASSGANAGVTVLGGPVASGGERARPLADDQAVLVSGDAGAWLLWDGR
FT                   RSPVDLANRAVTDALGFGATPTTPRPIAAGLFNAIPEAPPLAAPPIPDAGAPPRFPLPV
FT                   AAPVGAVVAAFEADNTIRYYAVLPDGLQPVPQVLAAILRNTNSYGLNQPPRLGADEVSR
FT                   LPVSQLLDTDAYPADPVTLVDPAADPLTCAHWSKAADAEQSSLGLLSGAALPMPEGMRT
FT                   LDLVGGGNGVTANRVALTSGRGYFVQTVGQEPGSPTAGSLFWVSDTGVRYGIEPGENGQ
FT                   TIAALGLTAAPVPAPWSVLAQFAAGPTLSRDDALLAHDALTRDPNPARLENLTLQENP"
FT   gene            415537..419502
FT                   /locus_tag="Mmcs_0372"
FT   CDS_pept        415537..419502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0372"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: ATPase;
FT                   KEGG: mpa:MAP3780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06493"
FT                   /protein_id="ABG06493.1"
FT                   /translation="MSRLIFEAHRRVPPPATRKGTITIEPPPELPRLVPPSLLRRVLPY
FT                   LIVLLIVGMIVALIATGMRLISPTMLFFPFVLLLAATAMYRGTDNKMRTEEVDAERADY
FT                   LRYLSVVRDNVRAHAAEQRAALEWSHPSPDVLATIPGTRRQWERDPRDADFLVLRAGLH
FT                   DTPLDTTLRVKDTADEIDLEPVSHTTLRGLLDVQRTVRDAPKGIDVTKVSRITVFGEAD
FT                   EVRGALRAWIAQAVTWHDPSVLGVALAAPDVDGDDWSWLKWLPHTDIPGEADGVGPARY
FT                   LTTDIEALRAALAHVLADRAAFPGDPDRALRHLLVIVDDPDADVEDLIRSPGLAGVTVV
FT                   HRIATPPHREQYPNPERPILRIADGRIERWQTGGWAPYVDTADTMGAADARHIARRLSR
FT                   WDSNPSHARSTTTGGSTFTTLLGIPDASALDVASLWAPRSREEELRVPIGVTATGEPLY
FT                   FDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLNVIYADFKGEAGAD
FT                   IFRDFPQVVAVISNMAEKRSLADRFADTLRGEVARREQLLKETGRRVQGSAFNSVTEYE
FT                   NAVAAGHDLPPLPTLFVVADEFTLMLADHPEYANLFDYVARKGRSFRIHILFASQTLDV
FT                   GKIKDIDKNTSYRIGLKVASPSISRQIIGVEDAYHIESGREHKGEGFLVPAPGAVPIKF
FT                   RSTYVDGIYEPPRAERSIVVRALPQPQLFTASRVEPEPDTVIPSSAPEAEAAPPRKLIA
FT                   TIGQQLAQYGPKAPRLWLPPLDEPIRLVEVLQRSAVPTRQWRWPLGEIDKPFEMRRDPL
FT                   VFDATSSAANMVIHGGPKSGKSTALQTFMLSAAALHSPRDVTFYCLDYGGGKLAPMADL
FT                   AHVGSVATPLEPERIRRTFGELEQLLRARQALGARGEGTSGEAYPETFLVIDNLYAFSR
FT                   DNTDTFNTRNPLLARVTELVNSGLAYGIHVVITTPNWLEVPLNMRDGLGLRLELKLHDS
FT                   HDSNVRIVGGLRRPAESVPADQPGRGLTMAAEHFLFATPALDLIPAINARFPEQTAPPV
FT                   RLLPHDLAPEAIGPLYPGPERVVIGQREEDLAPVELDFAQNPLLMVFGDNRSGKTTLLR
FT                   HLIRTVREHSEPDDVAFTVIDRRLQLVDEPLFPDNEYTANIDRITPAMLGLSALIEKRR
FT                   PPAGLTPAELSRWSYQGHTHYLIIDDVDQIPDGPAVNGPYVGQRPWTPLVGLLSQAGDL
FT                   GLRVIVTARATGSAHAVMTAPLLRRLNDLQATALMLSGNPQDSGKLRGHRFSRLPAGRA
FT                   MLLGDTDTPTFLQLVNPLVAESVASAGSTHTNGKDYR"
FT   gene            419502..419810
FT                   /locus_tag="Mmcs_0373"
FT   CDS_pept        419502..419810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0373"
FT                   /product="PE-like protein"
FT                   /note="PFAM: PE-like; KEGG: mbo:Mb0293 PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06494"
FT                   /protein_id="ABG06494.1"
FT                   /translation="MTLRVVPEGLTAASAAVEALTARLASAHAAAAPLIGTVLPPAADA
FT                   VSLQTAAGLSANGGRHEAVAAQGVQELGRSGVGVGQSGASYAAGDAMNASAYMIARG"
FT   gene            419811..421388
FT                   /locus_tag="Mmcs_0374"
FT   CDS_pept        419811..421388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0374"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mbo:Mb0294 PPE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06495"
FT                   /protein_id="ABG06495.1"
FT                   /translation="MVPPIWMALPPEVHSALLSSGPGPGSLLAAAGAWQSLSAEYASAA
FT                   AELTGILGSVQAGAWEGPSAEQYVAAHTPYLAWLAQASANSAATAAQHETAAAAYTTAL
FT                   ATMPTLGELAANHATHAVLLATNFLGINTIPIAVNEADYVRMWIQAATSMSTYQAVAGA
FT                   AVAAAPTTAPAPYLLAPGVGEAGQAMASVQQLGAQAQASESGSALNISDSINQLLEQYL
FT                   QSAPGGQEIIDFLRDPLGNLQTLINDFMTNPSAALVTWGPLLSAVAYQVFTNLVGWPTW
FT                   AMIFASPFLLAALIPLGIAGLVLIIDALKPELTQPPAEQTEPAPAPAPRPDQQVLPVAG
FT                   VPAPGAPATPGTAPAGSSAAAPAAPAPAAAAAAPLVPYAVRGGDPGEGFTPTVRDSTGA
FT                   KAPAGDIPAAAAAAAAASAAERRKRRRRKITEVKGRGYADVYMDYEDDPDEPPIVEPRV
FT                   AASSRGAGAMGFTGTAPGAADARATGLTTLSPDAFGTGPVSPMLPGTWNPDSEPDQPAE
FT                   GQEGGPRT"
FT   gene            complement(421447..422652)
FT                   /locus_tag="Mmcs_0375"
FT   CDS_pept        complement(421447..422652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0375"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533 transposase
FT                   IS116/IS110/IS902; KEGG: mpa:MAP3748c IS1110 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06496"
FT                   /protein_id="ABG06496.1"
FT                   /translation="MTTGQVWAGVDVGKEHHWVCAVDDSGKVVLSRRLVNDEQPIRELV
FT                   AEIDELAERVSWTVDLTTVYAALVLTVLADAGKTVRYLAGRAVWQASATYRGGEAKTDA
FT                   KDARVIADQARMRGQDLPVLHPDDDLISELRMLTGHRADLVADRTRTINRLRQQLVAVC
FT                   PALERAAQPSQDRGWVILLARYQRPKAIRQSGVSRLTKVLTDAGVRNAASIAAAAVAAV
FT                   KTQTMRLPGEEVAAGLIADLAREVIALDDRIKTTDADIEGRFRRHPLAEVITSMPGIGF
FT                   RLGAEFLAAVGDPALIGSADQLAAWAGLAPVSRDSGKRTGRLHTPKRYSRRLRRVMYMS
FT                   ALTAIRCDPDSKAYYQRKRDEGKRPIPATICLARRRTNVLYALIRDNRTWQPDSPPVTA
FT                   AA"
FT   gene            422899..423192
FT                   /locus_tag="Mmcs_0376"
FT   CDS_pept        422899..423192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06497"
FT                   /protein_id="ABG06497.1"
FT                   /translation="MSMLDAHIPQLIASEAAFGAKAALMRSTMAQAEQAAQSSQAFHMG
FT                   ESSAAFQAAHARFIEVSAKINALLDIAQVNLGDAAGTYVAEDAAAATTYTAI"
FT   gene            423222..423509
FT                   /locus_tag="Mmcs_0377"
FT   CDS_pept        423222..423509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06498"
FT                   /protein_id="ABG06498.1"
FT                   /translation="MSQIMYNYPAMLAHAGEMSSYAGAMHAVGADIASEQAALAGAWQG
FT                   DTGMTYQAWQAQWNASLEELVRAYRAMASTHEMNTMSMSARDQAEGAKWG"
FT   gene            423546..424490
FT                   /locus_tag="Mmcs_0378"
FT   CDS_pept        423546..424490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0378"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: mle:ML2530 possible DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06499"
FT                   /protein_id="ABG06499.1"
FT                   /translation="MGPNAVELTAAQAWFVADAVGAGSLPWVLAVTPPYSQEADRAPFT
FT                   AETVASLETLGVLSGDGVVDARVADWVRVVCRAEQWLDLRFVSGRGALLRGVVARRADQ
FT                   TVVALRSRSLITFTRMAIDHPHALVPVLCAGLSGRAPARFAEFTLPAAVGARADEQIRQ
FT                   GTPLAEVLDFLGIPPSARPVVEAAFDTSRTYVEIVAGEHRDGHRVTTQVGVSVVDTTEG
FT                   RVLVSPVRAFDGEWVSTFAPGTPFAIAAAVERLTGSLPSGAWFPDLHLTRDFDTRPRDE
FT                   YDTREPRTRHARHHDTVRQHCDADRAGGRTRRW"
FT   gene            424468..425847
FT                   /locus_tag="Mmcs_0379"
FT   CDS_pept        424468..425847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0379"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mpa:MAP3786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06500"
FT                   /protein_id="ABG06500.1"
FT                   /translation="MAVLAGGDDGGRLTEMALPAGLPLREILPAVQRMARPHDDGDRDD
FT                   PAPQPARLSLAPIGGAPFSLDATLDTVGVVDGDLLALQPVPAGPSAPRIVEDIADAAVI
FT                   FSAAREKRWGPTHIRRAAAAAVVGLILVVTGLSVAHRLVTDDGIGLIVVCAVAVAAVLG
FT                   ALLSRASSPALASTLALSALPAVAAAFALAVPGDFGAAQILLAAAGVTAWSVISLTTGD
FT                   RAVAVFTTTAATGFGVLLTAAAASLWTLSETVLGCVLILTGLLVTVQAAQLSAMWARFP
FT                   LPVIPAPGDPTPSAQPLRVLEDLPRRVQLSQSHQTGFLAAGVVLGVTGSLVLVGQQDVS
FT                   RWAWYVVVAVAAGAVLRARVWDSAPCKAWLLAHPLLLGVVLLVLFAATDRFDAAWWALA
FT                   ATAAVVVVWVIVALNPSIASPETYSLPMRRLVGFAATAVDASLIPVMALLVGLFSWVLN
FT                   R"
FT   gene            425844..427229
FT                   /locus_tag="Mmcs_0380"
FT   CDS_pept        425844..427229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0380"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mpa:MAP3787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06501"
FT                   /protein_id="ABG06501.1"
FT                   /translation="MIRSLALLAVTGAVALLAAPSAAAVTPPQVDPATPPPSGTAGPVQ
FT                   PMAQRGDCVVGGVLAGSDPGAVSPNQLALNLSGAWRHSRGEGQTVAVIDTGVKPGPRLP
FT                   NVEPGGDFLGSTDGLTDCDGHGTLVAGLIAGQPGADGFSGVAPGARIVSIRQNSPRFSP
FT                   VNPGEDPAVSRAAADVASLARAVVRAADLGARVINISVVSCLPAGRSVDQTELGAALRY
FT                   AAREKDAVIVAAAGNDRAGMNTGSACESNPPGDAARPDDPRNWAGVTSVSIPSWWQPYV
FT                   LSVGSLTSTGQPSDFTMSGPWVGIAAPGENITSVSNGPDGGLANGLPNDRDELFPVSGT
FT                   SYAAAYVSGVAALVRSRFPELTAEQVVARLTATAHGGPRSPSNVVGAGSVDPVAALTWR
FT                   VPSATAAAAVASKPIAAPPNPPVPDHTPRTVALIGTAALALTVLAALAWRSGATRPRKD
FT                   EAS"
FT   sig_peptide     425844..425918
FT                   /locus_tag="Mmcs_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.621 at
FT                   residue 25"
FT   gene            427226..428179
FT                   /locus_tag="Mmcs_0381"
FT   CDS_pept        427226..428179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0381"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mbo:Mb0300 probable conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06502"
FT                   /protein_id="ABG06502.1"
FT                   /translation="MTARITLALLFALPAALAYPWQTDTDWWLLGVAIAVVVLLFAWWR
FT                   GLFVTEMVRRRFAILTRNRRGGHRQEPAEHFATVALRVDEAPTGDVPLALLAGYADRYG
FT                   VRAHKVRVVSRDLAGERTTWIALTVGAADNLAALRARSPRLPLRQTTEIAARRLTDHLR
FT                   ELGWTVTPVDETAAPVPHPVRETWRGLRSEHGHVAAYRVTVDDQVSDTLAAVAALLSAE
FT                   TWTAIDIVCGAESPEIVVGCAVRTEDRPKAKAPLPALTPQRGRHRPAAEALHPLADQRL
FT                   EGRPVPVTGDGLHRLRWPVDHPPVTELVEVGTSDPQ"
FT   sig_peptide     427226..427282
FT                   /locus_tag="Mmcs_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.959 at
FT                   residue 19"
FT   gene            complement(428165..429154)
FT                   /locus_tag="Mmcs_0382"
FT   CDS_pept        complement(428165..429154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0382"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   pac:PPA0887 L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06503"
FT                   /protein_id="ABG06503.1"
FT                   /translation="MIGAVTTPPASPEVRSARPKVSIIGAGSVGTAIAYACLIRGSAGT
FT                   LALYDTNSAKVRAEVLDLNHGSQFVPECRVGGSDDIAVTAGSAIVVVTAGAKQHPGQSR
FT                   LDLAAANVAMAQTLTPQLLEHSPDAVVIFVTNPVDVVTYAASSVVDAQPGQIFGTGTVL
FT                   DSSRFRYLVAQRAAIAVGNVHALVIGEHGDSEIPLWSTLSIGGVGADAYRVDGRLVFDE
FT                   PTRTAVATDVVNAAYEIIAGKGATNLAIGLATARVVEAVLGDQHRVLPVSTVQDGAYGI
FT                   TGVALSLPTVVSAGGARRVLEVELSPGELDGLRRSAQTLADVRRSLGI"
FT   gene            429257..431104
FT                   /locus_tag="Mmcs_0383"
FT   CDS_pept        429257..431104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0383"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: cgb:cg3218 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06504"
FT                   /protein_id="ABG06504.1"
FT                   /translation="MSSAHTPVVSRLETADRALEQLDELIERLEKAEDAWSDWLTAVSP
FT                   EHRASATNMVHYWSLRQSDLRDLQRRLAGLGLSSLGRSEPHVEGTLRLVHAAVAAMRHG
FT                   SWHPPGVTAVDANVGDELLREHAVDLFGPAPAERATRIMVTLPSSAATDPDLVRDLIAR
FT                   GMNVARINCAHDDAEAWTAMAGHVRRAAESTGRKCLVAMDLAGPKLRTGPIRPGPRVIK
FT                   LRPTRDALGRVVTPFRLRLTASEEPTGSSESAMAVVPVDEAWLARRRDGDVVGFHDARG
FT                   AKRQLVLSRPDEMAGAVIATGDKTSYLATGTVLHAGAHDPCEVGLLPEREQTLMVQRGD
FT                   ELTLTRDCAPVPADHGGAPRIGCTLPEVFDHARPGEKIRFDDGRIGGEIVAVERDALRV
FT                   RIDRTAPGGSKLGSAKGVNVPDTHLPIAALTDKDVEDLATVVAIADIVQISFVQRPSDI
FT                   TQLHDELHRLGGDHLGVVLKIETRRAFEHLPQLLLTAMRWPRVGVMIARGDLAVEVGYE
FT                   RLAEVQEEVLWLCEAAHLPVIWATQVLESLAKSGLPSRAEISDAAMGERAECVMLNKGP
FT                   HIVDAVVVLDDILRRMNEHHYKKNALLRQLRSWRPDATE"
FT   gene            complement(431111..431518)
FT                   /locus_tag="Mmcs_0384"
FT   CDS_pept        complement(431111..431518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06505"
FT                   /protein_id="ABG06505.1"
FT                   /translation="MSAESQPVSILPESECWRLLDSVALGRLVTCAGGQPEIFPVNFAV
FT                   QDRTVLFRTAAGTKLTSAAISNQVLFEADAHTATEGWSVVVKGVARTVHGDDELEKAAG
FT                   AQLFSWTATTKQHFVRIRPDRVTGRRFGFVA"
FT   gene            complement(431574..432770)
FT                   /locus_tag="Mmcs_0385"
FT   CDS_pept        complement(431574..432770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0301c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06506"
FT                   /protein_id="ABG06506.1"
FT                   /translation="MTQSADPVDPPVPVLDIPGADAGARGLPRQADLTLRQRMIVDSSA
FT                   VADIALRTGVASMVGAAMLPSVVASALRPSTTGADAEHLRFYGELAAAKDPEVSFPAPT
FT                   VPPRISSRPANPVAEWTAHGRVHNIRFRSSFEAVNPALRDRCHGYRRNNVVHAQHWRHE
FT                   DGPRPTLCVIHGFMGSAYLFNGQFLSLPWFYRSGYDVLLYTLPFHGRRAEKYSPYSGYG
FT                   YFANGFAGFAEAMAQAVHDFRSLIDHLEFTGVDRVAVTGISLGGFTSALLACVDDRIQA
FT                   VIPNVPVVTPDRTVDEWFPANKLVALNRRIAGLDPELEAAASRYPSPLNYAPLVPRDRR
FT                   LIITGLGDRLAPPQQAELLWEHWERCAFHWFPGNHLLHVSQPDYLRRMTRFLRDFMFD"
FT   gene            432897..433661
FT                   /locus_tag="Mmcs_0386"
FT   CDS_pept        432897..433661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0386"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: mbo:Mb0302 probable trans-aconitate
FT                   methyltransferase TAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06507"
FT                   /db_xref="GOA:Q1BF27"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BF27"
FT                   /protein_id="ABG06507.1"
FT                   /translation="MWNPEAYLSFADHRGRPFFDLLARVGADAPRRVVDLGCGPGNLTV
FT                   VLRHRWPEAVVEAWDNSPEMVAAARERGVQANLGDVRGWSPQPDTDVVLSNATLQWVPE
FT                   HPELLTRWAGALAAGSWLAMQVPGNFDAPSHQAVRRLADREPWAPLLHDIPFRVGKVVE
FT                   TPADYAALLTDAGCSVDAWETTYIHELTDAHPVLEWITGTALRPVRSRLTDEQWDRFRA
FT                   ELIPLLDEAYPVRADGRTFFPFRRVFVVARTG"
FT   gene            complement(433658..435517)
FT                   /locus_tag="Mmcs_0387"
FT   CDS_pept        complement(433658..435517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0387"
FT                   /product="adenylylsulfate kinase / sulfate
FT                   adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: nfa:nfa24540 putative sulfate
FT                   adenylyltransferase subunit 1; TIGRFAM: Small GTP-binding
FT                   protein domain Sulfate adenylyltransferase, large subunit;
FT                   PFAM: protein synthesis factor, GTP-binding adenylylsulfate
FT                   kinase elongation factor Tu, domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06508"
FT                   /protein_id="ABG06508.1"
FT                   /translation="MGTRQLLRITTAGSVDDGKSTLIGRLLHDTDSLPLDHLEAVTDEE
FT                   GVADLAALSDGLRAEREQGITIDVAYRFFSTANRSYILADTPGHERYTRNMFTGASNAH
FT                   VAVLLVDARAGVLRQTNRHARIAKLLGIKHFVAAVNKIDLVDFDGDRFAEVAAELQTLS
FT                   ARLGGLDITVIPLAAKHGDNVVHRSDRTPWYDGPTLLEYLEGVELVPPQPEPNKLRLPV
FT                   QWVSRPTAEQRRRYTGRLSAGTLSVGDTVVSLPAGTRSTVTVVDTLDDDRPVAVAPLSV
FT                   AIELADDIDVGRGDVFVSGADDATLPVLARELDATVCWFADAPLRAGDRLALKQGTRTV
FT                   RATVQALHSRLDPETLDEFDNPVELVLNDIGSLTLRTSSVVVTDAYADNRDSGAFILID
FT                   ESSNDTVGAGTILEPREVTPGAQTRNDIRWHPSSLDRTHRWTSTGQRGATIWFTGLPAS
FT                   GKSTVAVAVERALVESGQVAYLLDGDNIRHGLSDDLGFAAGDRAENIRRVGHLTRLFAD
FT                   AGVVALASLVSPLKSDREIARTLSDAAKLPFLEVYVSTPVEECEKRDPKGLYARARAGE
FT                   LKGLTGVDAPYEPPDAPDLVLDTTGADIADLVKQVIDLLDSRR"
FT   gene            complement(435517..436437)
FT                   /locus_tag="Mmcs_0388"
FT   CDS_pept        complement(435517..436437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0388"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: fra:Francci3_1341 sulfate adenylyltransferase,
FT                   small subunit; TIGRFAM: Sulfate adenylyltransferase, small
FT                   subunit; PFAM: phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06509"
FT                   /protein_id="ABG06509.1"
FT                   /translation="MTTTDIDALRVDELRLLEAEAVHIIREVVAELERPVLLFSAGKDS
FT                   IVLLRLAEKAFRPSPLPFPVMHVDTGHNFDEVIEFRDRRVTGHGHKLIVASVQESIDRG
FT                   RVPDPGPGASRNRQQTRTLLDALEEGGFDAAFGGARRDEERARAKERILSFRDEFGQWD
FT                   PRAQRPEPWSLYNGRIKKGEQVRVFPLSNWTELDVWRYIQLENLELPSIYFAHRREVFA
FT                   RDGILLAVSQYAQPRDGETSAVEWVRYRTVGDLTITGAVRSEATDIERVIAEISAATVS
FT                   ERGETRADDRTSVAAMEDRKREGYF"
FT   gene            complement(436434..437237)
FT                   /locus_tag="Mmcs_0389"
FT   CDS_pept        complement(436434..437237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06510"
FT                   /protein_id="ABG06510.1"
FT                   /translation="MPSRSTAYLVLASQRSGSTLLVESLRATGVAGEPQEFFQYLPETS
FT                   QAPQPREWFADIEDESILRLLDPLDEGKPDLAPATIWRDYIRTVGRTPNGVWGGKLMWN
FT                   QTPLLLDRAKDLPDRSGDGLLSAIRDVVGSDPVLVHVYRPDVISQAVSFWRAVQTRVWR
FT                   GRPDPNRDARAEYHAGAIAHVVRMLRAQEDGWRNWFAEENVEPIDVPYPVLWRNLTQVV
FT                   ADVLDRLGQDPRLAPAPVLERQADQRSDEWVDRYRADAERDGLPT"
FT   gene            complement(437304..438701)
FT                   /locus_tag="Mmcs_0390"
FT   CDS_pept        complement(437304..438701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0390"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: mbo:Mb0304c probable
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06511"
FT                   /protein_id="ABG06511.1"
FT                   /translation="MTGQPRVTPQDRANVLIVHWHDLGRYLGAYGHPDVQSPRLDRFAA
FT                   ESILFTRAHATAPLCSPSRGSLFTGRYPQSNGLVGLAHHGWEYRAGVRTLPHILSENGW
FT                   HTALFGMQHETSYPPKLGFDEFDVSNSYCEYVVERATGWLLDAPQRPFLLTAGFFETHR
FT                   PYPRDRYEPADATTVALPDYLPEDREVRQDLAEFYGSITVADAAVGQLLDTLAATGLDR
FT                   STWVVFMTDHGPALPRAKSTLYDAGTGIAMIIRPPLDAGIAPGVYDDLFSGVDLLPTLL
FT                   DVLGVDIPGEVEGLSHADNLLGGAEKTREVRTAVYTTKTYHDSFDPIRAIRTKEFSYIE
FT                   NYAQRPLLDLPWDIAESAPGRIVGPRARTPRPARELYDLRTDPTEQHNLLTSENKINAE
FT                   AVATDLALLLDDWRVKTNDVIPSDFAGTRISDRYTETYLRIHRREVTSRSAIAAERGVK
FT                   GERRTAQ"
FT   gene            438791..439213
FT                   /locus_tag="Mmcs_0391"
FT   CDS_pept        438791..439213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0391"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mpa:MAP2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06512"
FT                   /protein_id="ABG06512.1"
FT                   /translation="MDEFSAEVVAFLSEGTRTGKLGYVASDGRPLVAPVWFIVEGNQLV
FT                   FNTDRDTAKGRALRRDPRVVLCVDDERPPFSFVQVQGLASTSEDPDGLLDTATRIGGRY
FT                   MGADRAEEFGRRNGVPGELVVRITPTKVVAVFDLAD"
FT   gene            complement(439238..439720)
FT                   /locus_tag="Mmcs_0392"
FT   CDS_pept        complement(439238..439720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3794c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06513"
FT                   /protein_id="ABG06513.1"
FT                   /translation="MAVFLRKLLRIGRLPDEMRAQSEAEGILHLSEFVPVTRRFTGSIP
FT                   GKRASGSVSGYTGALVLTRERVLATLSTVPGLAGRTIDQRWDTPADGPVGVEIAPDGLH
FT                   FEVDVHRVDPRSHGELSMHYKSDIPDDVLAVLPTRSLRISVPPEWVFRAVGVPYRP"
FT   gene            439768..440427
FT                   /locus_tag="Mmcs_0393"
FT   CDS_pept        439768..440427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0393"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   mbo:Mb0316 probable conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06514"
FT                   /protein_id="ABG06514.1"
FT                   /translation="MSNRRWLIGSAVSAAAVFVLMWIGYAHWAWLFEADLAVLEPLDRF
FT                   GAAHPGWVTGWDIYCTVLGPTVLRLAGVVVIVVSLVRRQYRTALFLVLTVELSGLLLVA
FT                   AKAIADRPRPATALVAAQSTSFPSGHALGVMVCVLAFLAVLSPTLAPAARRWAIALGVV
FT                   LIVTIGVARVVLNVHHPSDVVAGWALGYVYFVMCWLWYPPRVSPAAETPAAPGTAP"
FT   sig_peptide     439768..439848
FT                   /locus_tag="Mmcs_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            complement(440381..441871)
FT                   /locus_tag="Mmcs_0394"
FT   CDS_pept        complement(440381..441871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0394"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related
FT                   diacylglycerol kinase, catalytic region; KEGG:
FT                   fra:Francci3_3059 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06515"
FT                   /protein_id="ABG06515.1"
FT                   /translation="MDLSIRRRGSSLRQIGKGLGSLDREVFEAVAESPSPLLDATMPRL
FT                   TRAADHSKLWFAIAAGLMASGGPRTRRGATRGVLSLAVTSLVANQGAKRIWRRARPSYL
FT                   PVPLARRGRRFPTSNSLPSGHSASAAAFAVGVGLESPPIGLGLALLAGLVGLSRVATGA
FT                   HYPGDVFAGFGLGAAVSVLGGRVVPPTTPTKLPTAEPLRVPTPPRPEGAGVVLVINPAS
FT                   GGGNGARVVDEVRDALPRAEVVELDEGDDLQQVLREAAGRAEVLAVGGGDGTVATAAGI
FT                   AKEAGLPLAVFPGGTFNHFAKDIGCDSVARTVDAIRRGSVACVDLVCLNEEHMVINTAS
FT                   IGAYPQFVQTREKLEHKVGKPVAGLYAMFHTLRRAEPVRIQYDNRTLQTSLFFLGNSTY
FT                   LPSGFAPAQRHRMDDGLLDVRILETGKRFSRVRILTALMLGRLERSPLYHEMRVPEFTF
FT                   TAIDGPTVLACDGEVGTECQTASFTAQYRVLPVFRPLD"
FT   gene            441934..442527
FT                   /locus_tag="Mmcs_0395"
FT   CDS_pept        441934..442527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0395"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: fra:Francci3_2809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06516"
FT                   /protein_id="ABG06516.1"
FT                   /translation="MLDVDVIADPAAAVVALDPVRSRLLAELTEPASAAALATRVGITR
FT                   QKVNYHLRALEQHQLVAVAGERKWGGLKERLLVATASSYVVAPGALGAAAADPARSRDR
FT                   LSASYLIALSARAVQEVGDLWREARAKDKRLATLSLDATVRFRSAADRADFTRELSEAV
FT                   TTLVARYHDDTAPGGRAHRVVLAAYPQPRDQEDA"
FT   gene            442566..443351
FT                   /locus_tag="Mmcs_0396"
FT   CDS_pept        442566..443351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0396"
FT                   /product="Activator of Hsp90 ATPase 1-like protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase homologue 1-like;
FT                   KEGG: fra:Francci3_2808 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06517"
FT                   /protein_id="ABG06517.1"
FT                   /translation="MELLVPGTPEQVWDAMATGPGMSAWFTPTTVEERVGGELHFDFGG
FT                   GATQRGVVTGWEPPRRLTYEEHDWSGIGSPGPLATEITVTGRRGGECVVRMVHSLFTDA
FT                   DDWDDELEGFEGGWPGFFAVLRLYLRDFAGQPAAPVRVMAEYPGEVADGWSRLASALAL
FT                   TGVDVGQRVASPSGAPEFGGVVERVHQTRESRDVMVRLDHPGNGIAVVGMYPMGDAARA
FT                   MVSLYRYGDAAADTAADQRQVWAQWLDGVLGRDPIVSER"
FT   gene            443387..444040
FT                   /locus_tag="Mmcs_0397"
FT   CDS_pept        443387..444040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0397"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mbo:Mb0317 possible conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06518"
FT                   /protein_id="ABG06518.1"
FT                   /translation="MRRLLTLLCAAAVCLVAGAPVAPATAPWFASSVGAATQVISVVGV
FT                   GGSSAKMDVYQRTAVGWQPVAAGIPAFIGAKGMAPQTHDGEMKTPMGVFTLDFAFGTEP
FT                   NPGGGLPYVQVGPDHWWDGDMKSPTYNTMQVCKKEQCRFNTSLSAGTENLDIPQYRHAV
FT                   VMGVNKARVPGNGGAFFVHSTDGGPTAGCVAIDDGTLVEVMRWLRSGALIALSK"
FT   sig_peptide     443387..443494
FT                   /locus_tag="Mmcs_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 36"
FT   gene            complement(444045..444503)
FT                   /locus_tag="Mmcs_0398"
FT   CDS_pept        complement(444045..444503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3797c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06519"
FT                   /protein_id="ABG06519.1"
FT                   /translation="MGDIDEIKSVKYRYLRALDTKDWAAFADTLTEDVEGDYGESLGED
FT                   HRFTDREALVSFMRTSLGPEVITEHRVDHPEIVIEGDEATGTWYLQDRVIAPDFNFMLI
FT                   GAAFYRDRYRRTPEGWKICATGYDRTYDASMSLDNLNFKLKRGRALNL"
FT   gene            444610..445323
FT                   /locus_tag="Mmcs_0399"
FT   CDS_pept        444610..445323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA2585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06520"
FT                   /protein_id="ABG06520.1"
FT                   /translation="MAVVAGPGRFEEAASAALGLALLTLWVGRRRGVPVHALEAFGVAF
FT                   FAVLAVLGLIAPPDTIRWLELWAGEMSNVALALFAVATLLTRRPFTLAYAKDTAPQEYW
FT                   DSPVFLRINYVISAVWASAFLVSAAAGAYADGVLGDNDNFWFSWIVPLAAIIFAGAFTD
FT                   HYPDRATGESTASWARVFDWLPIFVVITGIVGWVSDSTSDTVGIALIVIGSVGSALMRK
FT                   VFPDEPAKIPGPSQS"
FT   gene            complement(445318..446832)
FT                   /locus_tag="Mmcs_0400"
FT   CDS_pept        complement(445318..446832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0400"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase, FAD-binding Rieske [2Fe-2S]
FT                   region FAD dependent oxidoreductase; KEGG: mpa:MAP1672
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06521"
FT                   /protein_id="ABG06521.1"
FT                   /translation="MTSLWLAGRPEQAVAPNPLDETTRSADVVVVGAGLTGLVTAVLLA
FT                   RAGRDVMVLEAFRAGAGATGNTTAKISLLQGTKLSKIVGKHGPGVAKKYVEGNLEGQEW
FT                   LIQRCENHGISVQREDAFTYAQSDTGLPAARAELEACQAAGLDAEWVDGSHGAHVPFPF
FT                   EGGVRLAGQAQFDPMPLLDSLIVELDERGGRLIQGVRVQRVSGTDDGLTLHVRTSEGDE
FT                   FDVDTRQCVLATGIPILDRGGFFARLKPARSYCMAYKVPGTITRGMYLSTDSPTRSVRY
FT                   APTQDGDRLIVGGAGHPVGREKHPSSSVQELDAWAKQHYPGAMQTNYWSAQDYSPADEL
FT                   PYVGPILPGQDKIYVATGFDKWGMTNGAAAALALSSSILGGRMDWADAFASWSPHELSG
FT                   IPKAVQANVEVGINLAKGWITPVTRIADRTPQSGGVVSGPPWALEARSVVDGVEHRVSP
FT                   VCPHLGGIVNWNDSDESWECPLHGSRFAPDGTLLEGPATRDLTRSL"
FT   gene            446915..448699
FT                   /locus_tag="Mmcs_0401"
FT   CDS_pept        446915..448699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0401"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mbo:Mb0320 conserved hypothetical proline and
FT                   threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06522"
FT                   /protein_id="ABG06522.1"
FT                   /translation="MSDPLGLSIGTTNLVAARVGNPPVIRRSTLSLFSDRTPQVGLPAE
FT                   QSGGVVLDGFVERVGDPVPLVAADGTSYRADALLVEALDAMTEAVDAAPSGDIAIAVPA
FT                   HWGTATVYALRNALRTNPVFTSNGAPARLVSDAVASLTALRANPGLPTDGVVALLDFGG
FT                   SGTSITLADAAAGFAPVDETTRFTEFSGDLIDQALLTHVLTGITDAGGVDPAGTAAVGS
FT                   LTRLRERCRDAKERLSAVTAADVAAELPGYHSTIRITRAELEEMLQRPLAGVLAALDAA
FT                   LERTRIGWAGVSAVVTIGGGASIPLITQQLSAHTRVPVITTRQPALDAAVGAALFAAYS
FT                   AAAEAPTGMAAAAPVTAMIDDAPGSATFRALAWSQDDTTSDEPVPYTGDDAYEPYNPFG
FT                   PAPTGARPEVQYLPADEPEDGRRGWHVPQLAFGAAAVVAAIAVGGVAYALTSTSADSTP
FT                   VTEFETTRLPAGAPLPEPSSAPPPPVVTVTTAPPAPAPPPEPGTPLPPPPPVTPVTTTP
FT                   TTTTTTTTTTTTTTTTTTTTTTQPTTTTTQPTTTQPTTTQPTTTQPPVTTTTQPPVTTT
FT                   YVTVPFVPIPIPIQVPNN"
FT   gene            448930..450036
FT                   /locus_tag="Mmcs_0402"
FT   CDS_pept        448930..450036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0402"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: nfa:nfa46030
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06523"
FT                   /protein_id="ABG06523.1"
FT                   /translation="MAITDVAQYAHLSNTDIESLGAELDTIRRDIEESLGARDAAYIRR
FT                   TIAFQRALDVGARLLIAAGSGKTAWIAGTAALAFAKTVENMEIGHNVGHGQWDWMNDPE
FT                   IHSNTWEWDMAGPSSQWRYSHNYLHHVFTNVIDMDEDLGFGVMRVTRDQPWEPRYLLQP
FT                   LRNIALAIGFEWGIALHDIHAAKERAQTPGEKHAQSRLIRKKIARQMVKDYLIFPALSR
FT                   SRWRRTLGANVAANIVRNLWAYVVIFCGHFPDGAEKFTAAVLEQESKPEWYLRQMLGTA
FT                   NFNAGPLMAFASGNLCYQIEHHLFPDLPSNRYAQIAVRVRAQCEKFDLPYTTGSLMRQY
FT                   WQTLRTIHRLALPDGDDGHRGVSATRKR"
FT   gene            450072..450947
FT                   /locus_tag="Mmcs_0403"
FT   CDS_pept        450072..450947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0403"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   fra:Francci3_3776 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06524"
FT                   /protein_id="ABG06524.1"
FT                   /translation="MNDVEYVELHGERVAYRDAGSGEVLLLIHGMAGCSDTWNAVLPRL
FT                   AENYRVIAPDLLGHGRSAKPRTDYSLGAFAAGLRDLLDELGVDRATIVGQSLGGGVAMQ
FT                   FMYQHPQYCRRLILISSGGLGPDVGWVLRLLAAPGAEVLLPVVAPKPVVALGNRLRPVL
FT                   GALGLGSPQAAQTWQSYSSLSDPPTRAAFQRTLRSVVDHRGQSVSALSRLGMHLEVPSL
FT                   VIWGDRDPIIPVAHAYSVQAARPGSALKVLPGVGHYPHVEAPDEVVDAIRQFFLDTAAD
FT                   DPHHHPGAVT"
FT   gene            450992..451894
FT                   /locus_tag="Mmcs_0404"
FT   CDS_pept        450992..451894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0404"
FT                   /product="endoglucanase, family 26; S-layer domain protein"
FT                   /note="KEGG: cac:CAC2556 endoglucanase, family 26; S-layer
FT                   homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06525"
FT                   /protein_id="ABG06525.1"
FT                   /translation="MLKVDPGLGRTSGVDMGAGLQLGLSTPAGVFGLDEVAATGAAVDR
FT                   HVDLVLWYEDFAAPPPVSGVTKVSATGAVPVITWEPWLWRTDVTVAGAETISEIAAGAH
FT                   DDHLFAWAAALTITGEPVHLRFAHEFNGDWYPWTPAHGATPDAYVAAWRHTHDLFRRAG
FT                   ATNVRWMWSPDAIGGGEVPLRAWFPGDDYVDVVGIDGYNWGTTRPWSRWTPPVELFEPA
FT                   VTEIRALTGRPMMIAEVGCAEDGGDKAEWISSFVGWAAAQPDVDAVIWFEHDKETDWRI
FT                   TSTPAATAAMAGALRAVMQ"
FT   gene            451891..453132
FT                   /locus_tag="Mmcs_0405"
FT   CDS_pept        451891..453132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0405"
FT                   /product="serine phosphatase"
FT                   /note="PFAM: GAF Stage II sporulation E; SMART: Protein
FT                   phosphatase 2C-like; KEGG: cef:CE1201 putative regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06526"
FT                   /protein_id="ABG06526.1"
FT                   /translation="MTAETPVSPFALPPEVEDERVRSLAQLHVLDTPPEDRFARITRMA
FT                   RAVFGIPMAAVALVDRDRQWFKQVDGLDIGTNLPRNQTICQATIARSYEQPDNPALIIE
FT                   DAAARPEFAMVPGIGEPGGIRFYAGYPLYGPGGHPVGTFCIYDTEPRSLTEAELTTFTE
FT                   LASWAQRELEHSDDLERAADVQRHLLPRPLGDLPGYSVCAMCLPAYAVGGDFYDHYRVE
FT                   GGAVFTVADVMGKGLGAAILAASVRSALRGASSAFARVERPLAPEDVVDAVALQLSEDL
FT                   SSTDTFVTLFHCQLDSATGTVRFVDAGHGIALVVRADGRVEGLDSAGLPLGVMPGDTWD
FT                   CGEVTLGEGDTLIIASDGVLDLIGDGSDARPALRFVATHPEPADLCARARALVAEKSPL
FT                   DDVTLVAVRREPTA"
FT   gene            453129..455105
FT                   /locus_tag="Mmcs_0406"
FT   CDS_pept        453129..455105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0406"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   cef:CE1202 putative cellulose synthase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06527"
FT                   /protein_id="ABG06527.1"
FT                   /translation="MRHQLPEISPGKYPSPWLRLLILCTALLGINYIVWRWFGSINWAA
FT                   WWIAVPLVIAETYSVIDSLLFAMTMWKMLRRNPPPPPPDDATVDVFITTYNEPIDMVLE
FT                   TAEAAQRIRFPHSTWILDDGDRHDLAEAAAERGIGYITRSSSWTPDKPRHAKAGNLNNA
FT                   LFETHGEFILVLDADQVPEPEILDRTLGYFRDPHMALVQTPQYFHNVPFSDPLGSQAPL
FT                   FYGPIQQGKDGWNAAYFCGSNAVLRREALMRLGIRGYVRAVEEGVRRTLYAARKMIRTA
FT                   RKQPGADQPEVQEALESVLQAVRDARRQLRDKRALADITFDFQQRVDAAARTVVDADIT
FT                   AMRADLEVITALSEHPEATATTVVFDDEALESLAGREWSPLGAIESIGAMIRAVDVGRD
FT                   DEAQPMLPMATISVTEDMATCMRLHALGWRSAYHHEVLARGLAPDDVRTMLTQRLRWAQ
FT                   GTIQVMLRENPFVQKGLSIGQKLMYWATMYSYLAGFAALAYIAAPAIYLIFGIMPVTAY
FT                   SWDFFGRLIPFLVLNQLMFIIISRGTPTWRGQQYSLALFPVWIRACYTAFLNVVFGRPL
FT                   GFAVTPKTRQEATAIPWHLVKWQLAAMAMLVVASIIGIVQLYFGAISVLGVGVNLFWVI
FT                   FDLLILSVVIQAVRFRGHQDEGV"
FT   gene            455105..455446
FT                   /locus_tag="Mmcs_0407"
FT   CDS_pept        455105..455446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0407"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   cef:CE1204 putative anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06528"
FT                   /protein_id="ABG06528.1"
FT                   /translation="MSRYPTRTTDSGVLVIRPEGRLNMVAAPALRKQIHELVDGGSARV
FT                   VVDLSATEFIDSSGLGALISGLKVARQAGGDLRIAAPTRQVTTVLELTNLNRVLSTYDS
FT                   ADGAFDGDA"
FT   gene            455433..455846
FT                   /locus_tag="Mmcs_0408"
FT   CDS_pept        455433..455846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0408"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: cef:CE1205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06529"
FT                   /protein_id="ABG06529.1"
FT                   /translation="MATHDPSVVLETTTGPDTLDAVQRTLDTLWAEHDVDEMVRMHVDL
FT                   AVGEIAANIIEHSGGGDPVRMRMEVSLDPDVVRTTFFDDGHPSPIDLGEVSMPEELSDR
FT                   GRGLAIAHRVLDELSYRRDSDGNHWTLVRSRTP"
FT   gene            455884..456462
FT                   /locus_tag="Mmcs_0409"
FT   CDS_pept        455884..456462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0409"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3711c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06530"
FT                   /protein_id="ABG06530.1"
FT                   /translation="MSVPEKQSGLRERKKLQTRETIRREALRLIKERGYQNTTVEQISA
FT                   AADVSPRTFSRYFPTKEAVLLSDDHIAPIIEAFVDAPADLSVIEAYRHAVARTFGALSE
FT                   EQRAEAIFGQRLMYAIPEARGLIYTEYVRLIELITEALTKRPGQPADTVERRVLAGAIV
FT                   GVLIAASHNTPLPGDPISRFLQVLDDKLK"
FT   gene            complement(456514..456762)
FT                   /locus_tag="Mmcs_0410"
FT   CDS_pept        complement(456514..456762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06531"
FT                   /protein_id="ABG06531.1"
FT                   /translation="MNKLGFATIVASGLTAAFLGLAAPAQAAPAGPGNAQDTINSLEDR
FT                   GYAIRVNHHGMVKPLDESKIVSVRYDNGDRVVYVDVR"
FT   sig_peptide     complement(456679..456762)
FT                   /locus_tag="Mmcs_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            457102..459207
FT                   /locus_tag="Mmcs_0411"
FT   CDS_pept        457102..459207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP0847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06532"
FT                   /protein_id="ABG06532.1"
FT                   /translation="MDASAYIGRVGGLAVALGVGAAVMVGAPGTAFAETGEPTSQTPPD
FT                   DSPKPAAEQDDPGQEQAEERAEEQAEEPDPEALEGLPDDDGDEPVVEEPVVEEPVVEEP
FT                   VVVEDDAEKDAEGADPDVTLPIVDPTTFERESRNRPDSTLQTEKSSEPEGFETLSETAD
FT                   VASFVVDTAHEASEQPAAAARTVLVDNVEEMVQTVLSPAAAAVTAITAPTAARNSAPVI
FT                   NRLLAAFGLGSLRNLPSLPSPAWALSALLALGSRRELERSVATRSVSTSTPTVSLAAAA
FT                   TPYDPAKDYVVTPVSVSGNTVRITNVTGPGGLNNTTTRFGIGGTDLGIMWDNGIKDNPN
FT                   TAVNEHQVLIAFGDTFSNRTPVRTGVWRMNTLFRSTDTVLSNGMYVADGIPHDPGMYSG
FT                   SPMSDPNFSREIIGNYHYGIGPEVTMIPTAAISVPGAGKDGATRQYINYMAVKSWDSPG
FT                   RWTTNYSAIAYSDDNGQNWTVVPQSSVRPAAAGRTILPFVNGDQNFQQGAYVRKYTVDP
FT                   VTGKPLKNAAGQEITDGYIYSYGTPAGRTGTAYVSRVAEADILDKTKYEYWNGTSWTPG
FT                   NPAAAKPILPSTTTTSFFGLIKTTTYPTVSEMSVQYNSYEKKYIMLYGDKNNNIVMRKA
FT                   DSPEGPWSAPITLVTSSKMPGLYAPMIHPWSSTDNVSAADQQYLYWNLSTWDDYQVKLM
FT                   RTDLTKV"
FT   sig_peptide     457102..457203
FT                   /locus_tag="Mmcs_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.991 at
FT                   residue 34"
FT   gene            459239..459715
FT                   /locus_tag="Mmcs_0412"
FT   CDS_pept        459239..459715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06533"
FT                   /protein_id="ABG06533.1"
FT                   /translation="MKRRTLAALAVGAAVLSLPATAVAHAAPPAPQPGAGCAPAVDRAL
FT                   AHTADDTVVQCSAGRWEVYAGPYPSSDRWFSGGDGLDLHGQGMRNPEMLSGPWTGIPQD
FT                   PATRCRAEQTAVVSAGKVGEPQVAEGEPGQPLRFEVLPVMFSIQLTGDCLWQAD"
FT   sig_peptide     459239..459319
FT                   /locus_tag="Mmcs_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.874 at
FT                   residue 27"
FT   gene            459810..461093
FT                   /locus_tag="Mmcs_0413"
FT   CDS_pept        459810..461093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06534"
FT                   /protein_id="ABG06534.1"
FT                   /translation="MDLVLGVSVTSTALRFVLVEGATGDGATVDSGTLAMPVSGDSLDA
FT                   LVGAVSGEGPYAAAPGQRPLAVGVTWTESVTEQAAGLMTALTARGVRNVVALSPAESAA
FT                   ALAAGLGDLAAQTDVAVCVAEPDVALVAVVTADTVHVDQIDRAGAGALARQVRETADST
FT                   AVYPEAVYVLGSADDVDAVVAALAGLVTAPVLSAAEADLALARGAALASAQGSVGVDAP
FT                   LALAQVTADAPRSWLTWRIPALTSVLVAAVVTFVVSLSVALGLELTPQMRSDDAATRQV
FT                   ASASDQAKAAVDAPAPEALPKAAPKPAAPPPPPEAPPAPPPEAVTVVDIAPAAPAPAPE
FT                   VAPVIEPVYAAPEVAPPPAPVYVPPAPPVYVPPAPAYVPPPAPVAPAYTPPQAGYVPPV
FT                   APQQPRLRDRIIERLPIINRFHEPQYPY"
FT   gene            461464..462069
FT                   /locus_tag="Mmcs_0414"
FT   CDS_pept        461464..462069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0414"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mbo:Mb0328 possible conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06535"
FT                   /protein_id="ABG06535.1"
FT                   /translation="MLAAPAAVVLAAGADVHREAQTVAAPAPPPPPQLPPYDLEVVASG
FT                   AVGGPADLKVAPSETVSVANWKVANRASYRALPVGVAPERGLQVKTILAARAISAVFPE
FT                   IQQIGGMRPDALRWHPNGLAIDVMIPNPGSAEGIALGNQIVAYVIKNAERFGMQDAIWR
FT                   GVYYTPNGPRGSGNGHFDHVHITTTGGGYPTGSETYFR"
FT   gene            462210..463064
FT                   /locus_tag="Mmcs_0415"
FT   CDS_pept        462210..463064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06536"
FT                   /protein_id="ABG06536.1"
FT                   /translation="MSSTSRVGISSLFACALLFGSTAVTPDISQAQPGPGGATVLTLAP
FT                   AFNELKSNWLRGELFAAPNVKVKVPYTNIPSATNTHKGADKLNEMLHAYPGPKIVAGHS
FT                   QGAQVADDWLRRYGPTSDIDPATVQFVLTGDLESKYNGCANVPGSGCVAAYGGNNFPDD
FT                   TPYTVKVIARQYDYFADCPNDLSNETAKKNRNASQVVGGKGELNSVHTNYSNIGLNDPG
FT                   NKTFVEGNATYILGAPATYFLPVVTQKWTSNESKVVEDAELRPIVESAYNRPMGAPPAP
FT                   PAP"
FT   sig_peptide     462210..462281
FT                   /locus_tag="Mmcs_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.803 at
FT                   residue 24"
FT   gene            463147..463998
FT                   /locus_tag="Mmcs_0416"
FT   CDS_pept        463147..463998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0416"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: glycoside hydrolase, family 16; KEGG: mbo:Mb0323
FT                   possible beta-1,3-glucanase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06537"
FT                   /protein_id="ABG06537.1"
FT                   /translation="MDRRSAMLMFGVGVAAAALPVAKAGAQPVIGDTPPGPGVPEAGVP
FT                   GLLFSDEFNGPAGAPPNPASWFIVPARETIRNPVEWDKPFNMGRYVTDQEHVFQDGAGN
FT                   LVIRATRGPGANIQEKYASGKVIGNWRGGVGTTWEARIKLNCLTDGAWPAFWLINDNPV
FT                   RGGEVDLVEWYGNRDWPSGTTVHARLDGTQFQTHKHPVDSDWHTWRMTWQPQGMYFWKD
FT                   YQPGMEPFFTVLANSLPEWPFNDPGYTMAPVFNIAVGGSGGREPAGGNYPAEMLIDWIR
FT                   VF"
FT   sig_peptide     463147..463227
FT                   /locus_tag="Mmcs_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.448 at
FT                   residue 27"
FT   gene            complement(464313..464435)
FT                   /locus_tag="Mmcs_0417"
FT   CDS_pept        complement(464313..464435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06538"
FT                   /protein_id="ABG06538.1"
FT                   /translation="MLTVVLVVVLVTTLVDVLGSAVVVGGGVLVSVIVTVSVSV"
FT   gene            complement(464502..464927)
FT                   /locus_tag="Mmcs_0418"
FT   CDS_pept        complement(464502..464927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06539"
FT                   /protein_id="ABG06539.1"
FT                   /translation="MRRLVVRAGAVVGAVVTSGCGLTGSPPSEPSAQAGQITLDGQTRE
FT                   TRSVECSQIEWSLMIDAGAEPGRAHAYLRLGGQEPVVETVSIDDIGPVNGVAGGDLGKA
FT                   EATLDDTIYTITGTVVGPDPANPGQSQTMPFEIKAPC"
FT   sig_peptide     complement(464856..464927)
FT                   /locus_tag="Mmcs_0418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.766) with cleavage site probability 0.486 at
FT                   residue 24"
FT   gene            complement(465006..466031)
FT                   /locus_tag="Mmcs_0419"
FT   CDS_pept        complement(465006..466031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0419"
FT                   /product="PE-PPE-like protein"
FT                   /note="PFAM: PE-PPE-like; KEGG: mbo:Mb2640 PPE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06540"
FT                   /protein_id="ABG06540.1"
FT                   /translation="MLLGNGSRPNGGLMSRFDGAYIPILDVSFIGPTPTTTAGATPGEI
FT                   TTYDIARQYDLFADFPTNPLNILAVANAFAGQLFVHPDYGSVDMSQAVFQGTYGDTAYY
FT                   LIPTYPLPLLMPLTWIPVIGPIAVDMLDPVLRVLVEAGYDRTINPGVPTPANFLYLPDP
FT                   VTLGSSLLHAIPTGLTYGTQDILHLREPGTPPPGVAGQDAYGIGGPSVTLPNQTPPPAP
FT                   PVQTVAAPSTPKVPSATPTTAVPLSDGVNDSVIPSTSPPAPKQHIVDEPIGGSSSNGAV
FT                   KRSASTADDAPADASTQSRPKSSGTTDRPSGAGNSNGKGGSSSSSTGNSNGKGSSSSTG
FT                   D"
FT   gene            complement(466068..466505)
FT                   /locus_tag="Mmcs_0420"
FT   CDS_pept        complement(466068..466505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06541"
FT                   /protein_id="ABG06541.1"
FT                   /translation="MRILARSGLALLVAVGTVLLALVSTVTLVFTLAASTYVIRGTEYG
FT                   VPFCLPFCHGNPTPEELAMPYVDGTVNNPPDGIVVVDYPASFWPFSDGYFVDPTYDDAV
FT                   EQGVNALPPPGQFQDLDGSVIFGYSQGTQVATLYKREFNEY"
FT   sig_peptide     complement(466404..466505)
FT                   /locus_tag="Mmcs_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.665 at
FT                   residue 34"
FT   gene            complement(466715..467242)
FT                   /locus_tag="Mmcs_0421"
FT   CDS_pept        complement(466715..467242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa41140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06542"
FT                   /db_xref="GOA:Q1BEZ2"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEZ2"
FT                   /protein_id="ABG06542.1"
FT                   /translation="MNARSTYPGDVAVTIPEVHPDLTALAPLLGTWSGKGSGEYPTIEP
FT                   FDYTEEITFGHTGKPFLTYVQRTRAADDGRPLHAETGYLRAPTPNNVEWILAHPTGITE
FT                   IQEGPLTADGDTLRMDLISTDIGRSESAKEVMAVGRSMQISGDTLTYTLRMAAVGRPLQ
FT                   HHLSAVLHRVSS"
FT   gene            467328..468728
FT                   /locus_tag="Mmcs_0422"
FT   CDS_pept        467328..468728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0422"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase
FT                   dTDP-4-dehydrorhamnose reductase Male sterility-like; KEGG:
FT                   cef:CE0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06543"
FT                   /protein_id="ABG06543.1"
FT                   /translation="MTAEPSRIVVTGASGNVGTGVLRALASQLPDAEVVGVCRRPPTDG
FT                   EPYERVRWHTVDLSAPSAVADLEPALRGADVVIHLALAVHPVRDEHYLYRANVLGTQAL
FT                   LKAMTAAGVRQLVYASSLGIYAPGSGPPVTEDWPTTGQTTSVYSRHKVMVEQVLDEFEL
FT                   DHPEVTVSRFRPTVVVQREAAWLIKSLYLGPLVPRSVLELLRRRELPVLPVPAPLALQF
FT                   VHADDVGDAVVRMVTQQVRGSFNIAADVLDTAALADLVGARPVSVPPQAVRTLIAALSA
FT                   VRVVALTPGWYDVAFKTPLMDTSKARRTLGWEPARSSAESARELIEGLADGAVGTSAAM
FT                   GWRLRPRRDVRAAVDRAHDVTLVSWGALALLRAAGMRRARVVDAVVVASNLATGTPMAL
FT                   DRILERRADPVALLAPVAVLAALGATLCGGWPAVAVTGALQVLRMSERNQRKAKLVSNA
FT                   EVPAGSRG"
FT   gene            468738..469613
FT                   /locus_tag="Mmcs_0423"
FT   CDS_pept        468738..469613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0423"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR Male
FT                   sterility-like; KEGG: sme:SMb20076 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06544"
FT                   /protein_id="ABG06544.1"
FT                   /translation="MDESAATPEVVVVTGASSGIGEETALRYAGRGARLVLAARTEDAL
FT                   QRVADACRAAGAEAVLVQATDIADAAEVEELFGVAEGHFGRIDIVVQSAAITAFGRFED
FT                   VPAGVFDSIVRTNLIGSANVARSALAHFHKRGRGHLVLIGSLLGTAAAPYQSAYVASKF
FT                   ALNGLVRTLRQENRHLSGIKIHGVYPGPVDTPVYGTASNYFGRAPRVPPTAVKPSSVVS
FT                   AIVRATDRGRSSERQVGVFNRPVIAMYRLAPPVYDVLMGVFLRTFGFTSESTEPTHGNA
FT                   FARDRHPKAD"
FT   gene            complement(469625..470968)
FT                   /locus_tag="Mmcs_0424"
FT   CDS_pept        complement(469625..470968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0424"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: secretory lipase; KEGG: mpa:MAP1286c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06545"
FT                   /protein_id="ABG06545.1"
FT                   /translation="MDDYSATQVRAAHAPHDELRRGERPIPPDHDPFYRAPEGYEHAEP
FT                   GTVLRSRDVEIGFLGLVGQPVKAVQLLYRTTNLHEEPEVAVTTVLVPAQREPDVAYPML
FT                   SYQCAIDAVASRCFPSFAMRRGAGPIGAFTQAEYLLVTAALAEGWAVCVPDHEGCHGMW
FT                   GAPVEPGYRILDGLRAAQQCERLDLSPSAPVGLWGYSGGGLASAWAAELCERYAPELNI
FT                   VGAVLGSPVGDPGSVARRLNGSFFAGLAALMISALTQVFPGAQNVVDEHATDEGKALLE
FT                   KLQTMTTAQAVWQLRNVDIGSYVDMTADELWDLPEVRHIFDETKLGKSTPKPPVLVIQA
FT                   VHDGIISVDDVDALVAEYERIGAAVTYHRDRFCGHLLLHPLSAPMTLRWLRDRFTDRPV
FT                   YEHKTRTVWPTMFNPSTYLGMVKLGVITAKVVLGRSVERQPLSTTDAP"
FT   gene            complement(471085..472338)
FT                   /locus_tag="Mmcs_0425"
FT   CDS_pept        complement(471085..472338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV5485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06546"
FT                   /protein_id="ABG06546.1"
FT                   /translation="MQDHLPPRAVPRSVRVWGPIVLSVALALYVAAYLRWPSLASQVDL
FT                   LVYRFGAERAWDGQDLYSVGLTGNPDTMLFIYTPFSALCFLPLIGLSQPGVLVLGLLVN
FT                   VACMGYIVSRMLSAAGIRTATGLWGLTALLMAPIIWLEPVRLSLQLGQINVLIMAIVVA
FT                   DLLAQPSRRWTGMGIGVAAGIKLTPALFIVFLVATGRRREALVAGLTFVSTIAVGFVLL
FT                   PADSTEFWLQKRFQDVGRISSDPLANTSLAGLLTRFNWVPPWPTVAAGVFAIVAIAIAA
FT                   LAWRRGQRLLSVAIAGMTSAAASPFSWSHHWVWFAPLLVHLGYLGYVHRSRVAALAMWV
FT                   LAAIFGGWFVASRSLPPQAGLMSLRHPGTWDQLLPAAYLFALTIVLICSVCGLWRARQH
FT                   PPAGVDATVESSRQRASI"
FT   gene            complement(472658..473962)
FT                   /locus_tag="Mmcs_0426"
FT   CDS_pept        complement(472658..473962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0426"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mtc:MT2071 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06547"
FT                   /protein_id="ABG06547.1"
FT                   /translation="MYGVMSSNASSGAVALLPKERLEVLFEEVAELAGQRNAIDARLVE
FT                   IAAEIDHDGLGGITGAKSVAHLMAWKTGSSSRNGKTIAAIAHRIAEFPRCVQALRDGRL
FT                   SLDQVGVIAEGAGAGSDEHYAELARSASVTQLRTAIRLEPRPAPEPEKDADGEPKPVPV
FT                   AQASIRKTSDEQYTYWRIALPHVEAAVFDAALRSHHDALIAQWKRDHDTPTDTPAGTPA
FT                   GGRPPMPALADAFAALVEAGWDTEVTRRPHGQRTTVVVHLDLDERIAALHLGPLLSEAD
FT                   RRYLGCDATCEVWFERHGQPIGAGRTTRMISRRLRRALEHRHRTCAVPGCGATRGLHAH
FT                   HIQHWEDGGATDLDNLVLLCPYHHRAHHRGVITITGPADQLPVTDSTGRHLTSGSLARP
FT                   PNQPPPTVAPYRGPSGERADWWWYTPFQPPPPTTN"
FT   gene            474095..475729
FT                   /locus_tag="Mmcs_0427"
FT   CDS_pept        474095..475729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0427"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR Tetratricopeptide
FT                   TPR_4; KEGG: sco:SCO5506 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06548"
FT                   /protein_id="ABG06548.1"
FT                   /translation="MVRDARAEASTAYERHGWEDAYNLLSSADAQDSLAAEDLNRLATA
FT                   AHLTGRFDAAGEAWERAYRAYVEHGHVAEAVRCSFWHALTLMLRGEHARGSGWLVRAQG
FT                   LLEEAGLDSVERGYLRIPVALQALGGGDPSAAYAEFDAIAAVARRFGDPDLRALGQLGR
FT                   GQALVARGEAARGTAIFDEAMLAVTTGEVSAIAAGIVYCAVIISCQQVFDVRRAAEWTA
FT                   TMSRWCAEQQGLKAFRGQCLVHRSQIMQLQGEWSDAMEEVRRACDALSDVPGDPVLGMA
FT                   HYQQAELLRLRGELDRAELAYREASGWGHPVQPGLALLRLAQGRVDDALAAIRRAMAAA
FT                   EGPVERSRVLAAYAEIALAAGDVEAARSAAEQLETIAADFESPYLRAVGEYARGSVLLA
FT                   GGDPAAACTVLRRSWAAWQELDAPYEAARVRLRMAQACRRMNDDDTAAMELDAARRVFE
FT                   QLGAAPALAQVAEVSTNAPAGAPSGLTTRELEVLRLLATGATNREIAHTLVISEKTVAR
FT                   HLGNIFNKLDVSSRTAATAYAYQHDLV"
FT   gene            475966..476802
FT                   /locus_tag="Mmcs_0428"
FT   CDS_pept        475966..476802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0428"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase
FT                   UbiE/COQ5 methyltransferase Methyltransferase type 11
FT                   Methyltransferase type 12; KEGG: nfa:nfa1190 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06549"
FT                   /protein_id="ABG06549.1"
FT                   /translation="MNIHAPSQDLIRDAWDAIAPRFDEFVTPESMQYGAHALRQLHIGR
FT                   GTRFLDVACGSGALSLPAARLGADVVAVDISQAMTERVAARARAQGLSNIWCRVMNGQD
FT                   LDLADDTFDIAASQHGVSLFPDVDAGLAEMVRVTKRGGTVLVIAFGALPKAEFLAFFVA
FT                   AIKAAVPGFAVLPLDPPPLPFQLADRELFRSKLITAGLNDVTVERTAWEMPFRSGAHMC
FT                   TMVTSSNPLGAQLVAGLTAAQRADVEHVLDGILRERSGGQPGAVLYADVNVGVGTK"
FT   gene            476849..477505
FT                   /locus_tag="Mmcs_0429"
FT   CDS_pept        476849..477505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06550"
FT                   /protein_id="ABG06550.1"
FT                   /translation="MRGAQPSTHLVLIRPSGSGTRGSLCHLPERVAPGTAGFPPTTNRV
FT                   YPLVNATGTVLVTDVIGTGAPGDPLSTILTLCRPGEMPVVVEIPGPPVGKGLGADGTVT
FT                   YAASTASGSTFTVLRPGQPAVTISTPGLVSNGPVVGPDGTLYQVTDDRVSGRTNLTIVT
FT                   AAGEVTRLDFAGSSPSLAIDPDGGKVVLVMTTREGGIETRTGYEIAVVTGAASSV"
FT   gene            complement(477516..477589)
FT                   /locus_tag="Mmcs_R0004"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(477516..477589)
FT                   /locus_tag="Mmcs_R0004"
FT                   /product="tRNA-Gly"
FT   gene            477649..478221
FT                   /locus_tag="Mmcs_0430"
FT   CDS_pept        477649..478221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0430"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: Deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mpa:MAP3820 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06551"
FT                   /db_xref="GOA:Q1BEY3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEY3"
FT                   /protein_id="ABG06551.1"
FT                   /translation="MLLSDRDIRAEIDAGRLGIDPFEDSLVQPSSVDVRLDTLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVEPSPGEPFVLHPGEFVLGSTLETCTLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLLRLTSPAEHPYG
FT                   SAKVGSKYQGQRGPTPSRSYQNFIKLS"
FT   gene            478497..480308
FT                   /locus_tag="Mmcs_0431"
FT   CDS_pept        478497..480308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06552"
FT                   /protein_id="ABG06552.1"
FT                   /translation="MKVLVVGSFGSGAPGRHNRYSKLLEGLVDIVLGVSMTPTTVRMVL
FT                   VEGEKADGVTVDHDVFDINAVEGSATSNAADQVVAAVLGTQESAAAGGHHLRSVGVAWS
FT                   DHASAAALRDTLTARGIEDVMLVSEGHAAASLAQAVGRAVGYTATALFFIDRDAATLSV
FT                   VQTDDGSVTKVLSRSLHSTDAMAVLTEMAAAVDAQDSPPQGMFVVGSGVDVSEVKAHLG
FT                   RLLSLPINAPEEPELALARGAALASAHAPDFEASTVGLAYSQDPEEGTTAGSSYAAFGA
FT                   AATQLAPVSSAAAAPPMVFAAPEAVPTPADDENRKPFLLVGSALSSIFVVGVVALVISL
FT                   AVNIRPTADQRPSPAEAAIVPSAQAPRPAPAPEAQPAVAPPAPPAETIKAPVPVVREAP
FT                   APAAPRTVYVEKAPVPAAPPAPAPLPAAPPAPVPAPIPAAPVPAPVPVLPAPVFRPPVV
FT                   LPPPVIRLPRPQLPPIFRDDDEPERPSWPNPWQPKPQTPPKQDDDYWPQRPTVPTVPQA
FT                   PKPVVPQVPQTPYVPSVPQTPYVPSVPQAPSNPYYPPSSSGGGSGSSRGDYGSGSGSGS
FT                   GSGSYDGGGSSGGEDSVWPFPSFGGGD"
FT   gene            480301..480657
FT                   /locus_tag="Mmcs_0432"
FT   CDS_pept        480301..480657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06553"
FT                   /protein_id="ABG06553.1"
FT                   /translation="MTERTVAFPAMSPVYALNLFDVANRDEYLAYARRSPAAVTAHGGR
FT                   VVALGKFRESVTGDIEPRQVLILVEWESKEAFDSYRNDPDLADLHPHREDGSSAYVWHL
FT                   FDRLDDLRPLLKLE"
FT   gene            480657..482000
FT                   /locus_tag="Mmcs_0433"
FT   CDS_pept        480657..482000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0433"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mbo:Mb1912c probable
FT                   cytochrome p450 140 CYP140"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06554"
FT                   /protein_id="ABG06554.1"
FT                   /translation="MVHDSSGATVRQRVRWLALHGFVRGMSRLGMRRGDPQARLIADPT
FT                   VRANPAAFADEHRVKGPLIRGRVGLITFDHAVAHELLRSDDFRVSSLGGELPKPLRRVI
FT                   DRTDTGLLHPIEPPSLLSIEPPDHTRCRKLVSSVFTTRAVTALRDGVETTAVKLLDDLE
FT                   RDATGSGPVDIVARYCSLLPVSVISDVLGVPEADRAQILHYGELGAPSLDIGLSWQQYL
FT                   RVHSGIVGFNAWLVNHLENLRRNPGDDLLSQLISATEDGAGLSERELQATAGLVLAAGF
FT                   ETTVNLLGNGIKMLLDHPDQLAKLRDRPELWPTAVEEILRLDSPVQMSARVAKKDVEVA
FT                   GVPVRAGELIIIHLAGANRDPKVFDDPHRFDIERDNAGKHLSFSGGRHFCLGAALARAE
FT                   GEVGLRTFFDRFPDAKLAGTASRRDTRVLRGWSTLPITLGTARAALGS"
FT   gene            482002..482751
FT                   /locus_tag="Mmcs_0434"
FT   CDS_pept        482002..482751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0434"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   mpa:MAP3826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06555"
FT                   /protein_id="ABG06555.1"
FT                   /translation="MDFRAALLEQTNSFGDLIATGDPETPVTTCGDWTLRQLFRHVGRG
FT                   NRWAAQIVAERRHEPLDPREVRDGRPPEDPDGAIQWLREGARLLIHAVDSVGSGTKVWT
FT                   FLGTRPAGWWIRRRVHEVAVHRADAALALGQPYDLPPDLAADALSEWIELAAVQAGRRG
FT                   LPIERGHTLHLHATDESLGGVGEWMITSTEDGIDWTHEHGKGDVAVRGPVADLLLAVTR
FT                   RRTLADSGLEAFGKTEIWDRWLEQTPF"
FT   gene            482772..483140
FT                   /locus_tag="Mmcs_0435"
FT   CDS_pept        482772..483140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06556"
FT                   /protein_id="ABG06556.1"
FT                   /translation="MTTSEKATVLAWHDALNARDIDTLLELSSDDIEIGDAHGAAQGHA
FT                   ALRDWARALDVNAEPGRLYIRDGVVVVEQQITSVTGETGTAASAFRVVHDKVTSMFRHA
FT                   DLSSALAATELGEEDLTG"
FT   gene            483140..484003
FT                   /locus_tag="Mmcs_0436"
FT   CDS_pept        483140..484003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0436"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: mbo:Mb0341 probable
FT                   glucose-1-phosphate thymidylyltransferase RmlA
FT                   (dTDP-glucose synthase) (dTDP-glucose pyrophosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06557"
FT                   /protein_id="ABG06557.1"
FT                   /translation="MRGIILAGGSGTRLYPITLGASKQLLPVYDKPLIYYPLSTLIMAG
FT                   IRDIQVITTAEDAPAFHRLLGDGAHFGVNLTYAVQDEPDGLAQAFVIGADHIGTDSVAL
FT                   VLGDNIFYGPGLGTGLRRFHDVSGGSIFAYWVANPSAYGVVEFSADGTALSLEEKPATP
FT                   KSHYAVPGLYFYDNDVIEIAKSLKKSARGEYEITEINQRYLDQGRLTVEVLARGTAWLD
FT                   TGTFDSLLDASDYVRTIERRQGLKISVPEEVAWRVGFIDDEQLAARGHSLLKSGYGAYL
FT                   LELLDR"
FT   gene            complement(484004..486094)
FT                   /locus_tag="Mmcs_0437"
FT   CDS_pept        complement(484004..486094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0437"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding; KEGG: dra:DRA0237 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06558"
FT                   /protein_id="ABG06558.1"
FT                   /translation="MTLLDPQAIGAPMARLDGRAKVTGAAPYAFEQRVDDPAYLHPIQS
FT                   TIARGRVAAVDTDAARAIDGVLDVLTVFDAPELADTSDGELSILQDDRVHFRGQIIGGV
FT                   VAETAEIARHAAGLVQVRYTEESHDVELTADHPGLYTPEQVNAGYPSDTDEGDVEAALA
FT                   SAEVTVDQTYSTPIEHNNPMEPHAAIAIWTADGVTMFDSTQGVHAARKALAPLFGLEPD
FT                   QLRVIAPHVGGGFGSKGAPHAHDVLALLAAQRSGGRPVKLALTRQQMFALVGYRTPTIQ
FT                   RIRLGANQDGTLTALAHEVVEQTSAVKEYAEQTAVTSRKMYAAPNRRTAHRLAALDVPV
FT                   PFWFRAPGECPGAYAAEVAMDELAAACGVDPIELRVRNDPEVDPETGNPWSGRHLVECL
FT                   RLGAERFGWSSRDPVPAQRFSGDWYVGLGVASATYPAMQMPGNSARITYADEGRYLVQI
FT                   GAADIGTGTWTTLTQIAADALGCDVAAVDLQIGDSALPEASVAGGSSGINSWGRAIVTA
FT                   ARQFRRDHGDPPAIGATTVAEAPENPESEKFTMQSFGAHFVEARVNRDTGEIRVPRMLG
FT                   VFSIGRAINARTLRSQLIGGMTMGLSMALHEESVRDPRFGHVVTQDFATYHISAHADVA
FT                   DIDAIWLDEADEHANPMGSRGAGEIGIVGSAAAVVNAVYNATGVRVRDLPVTLDKVLSG
FT                   LP"
FT   gene            complement(486091..487083)
FT                   /locus_tag="Mmcs_0438"
FT   CDS_pept        complement(486091..487083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0438"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding CO
FT                   dehydrogenase flavoprotein-like; KEGG: dra:DRA0236
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06559"
FT                   /protein_id="ABG06559.1"
FT                   /translation="MRAFDYHLAESPADAVATLTAHPDAAYLAGGTNLVDHMKLGVATP
FT                   DLLVDVSRLPLDEVTATDDGGVRIGATVRNSDLAAHPVIRSRYPVLSRAMLSAASGQLR
FT                   NSATTAGNLLQRTRCVYFQDVTTPCNKRSPGSGCSAIGGYVRYHAILGASEHCIAVHPS
FT                   DMAVAMSALDGVVVVEGSDGERRIPIDEFYRLPVDEPHRDTVLRHGELITAVELPAPPP
FT                   GAVSEYRKVRDRASFAFALVSVAAELSLSDDRIGSARIAFGGVAHKPWRARRAEEVLTG
FT                   APPTDNTFAAAADAELSAADPQPGNEFKVALARRTLIAELRALTGRGRP"
FT   gene            complement(487094..487615)
FT                   /locus_tag="Mmcs_0439"
FT   CDS_pept        complement(487094..487615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0439"
FT                   /product="(2Fe-2S)-binding protein"
FT                   /note="PFAM: ferredoxin [2Fe-2S]-binding; KEGG: xcb:XC_1385
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06560"
FT                   /protein_id="ABG06560.1"
FT                   /translation="MTQPTGHREVTLEVDGRPHTLHLDNRVTLLDALREHLGVTAPKKG
FT                   CDHGQCGSCTVLRDGRRVTTCLTFAVAADGAHITTAAGLGDGDDLHPVAQAFSDEDGFQ
FT                   CGYCTPGQICSAVGMLDEVKSGAPSFVSDDLEAVPELTDDEIRERMSGNLCRCAAYPNI
FT                   VAAIERASVQ"
FT   gene            complement(487612..488886)
FT                   /locus_tag="Mmcs_0440"
FT   CDS_pept        complement(487612..488886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0440"
FT                   /product="YibE/F-like protein"
FT                   /note="PFAM: YibE/F-like; KEGG: mpa:MAP3829c hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06561"
FT                   /protein_id="ABG06561.1"
FT                   /translation="MSHSHPHSHSLSGPSPLGPLAARIVVGLLALIGVAVAIGAVLLWP
FT                   SQQKADIPLPFQNAEGGAVTTEAGQVRATSLAPCGSPSAGQVLTADPVPTPADGSQCVQ
FT                   VLVAIDSGPNKGANTLLEFSGGPGQPQLAAGDDIRLSRQVSPGGATSYTFYDYARGWPL
FT                   ALLAAAFAVVVVAVARWRGLRALVGIVVAFAVLVVFLLPALRDGASAVPVALVASAVIL
FT                   YAVIYLAHGVSLRTSAALLGTLTSLLLAAVLSWGAIEIAHLTGLSEDQNNEVAAYLGNV
FT                   SITGLLLAGFIIGSLGVLNDVTVTQASTAFELAELEGSSRRAVFVGAMRVGRDHIASTV
FT                   YTLVLAYAGSALPLLLLFSVANRSLVDVLTSESVAIEVARSAVGGIALALSVPLTTGIA
FT                   AVLATPRADNHPRRFAVRPWGIRPP"
FT   gene            complement(488890..490176)
FT                   /locus_tag="Mmcs_0441"
FT   CDS_pept        complement(488890..490176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0441"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mbo:Mb0344c probable aspartate aminotransferase AspC
FT                   (transaminase A) (ASPAT)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06562"
FT                   /protein_id="ABG06562.1"
FT                   /translation="MDDVTMPQTPAERTWHPQGHQPRPRTFTQSSKLQDVLYEIRGPVH
FT                   EHASRLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGIMPARRAV
FT                   FTRYELVDGFPRFDVDDVFLGNGASELIQMVLQALLDNGDQVLIPAPDYPLWTACTSLA
FT                   GGTPVHYLCDETQGWNPDVADIESKITDRTKAIVVINPNNPTGAVYSRETLERIADLAR
FT                   KHQLLLLADEIYDKILYDDAKHISLASVAPDVLTLTFNGLSKAYRVAGYRSGWLVITGP
FT                   KEHASSFIEGISLLANMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWEK
FT                   LNEIPGVSCVKPAGALYAFPRLDPEVYEIHDDELLVLDLLLQEKILVVQGTGFNWPTPD
FT                   HLRIVTLPWARDLANAIERLGNFLVSYRQ"
FT   gene            complement(490259..493399)
FT                   /locus_tag="Mmcs_0442"
FT   CDS_pept        complement(490259..493399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0442"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding protein
FT                   of unknown function DUF224, cysteine-rich region; KEGG:
FT                   mpa:MAP3831c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06563"
FT                   /protein_id="ABG06563.1"
FT                   /translation="MDTQILIRLIVGLLMTGIVIALAAKRVLWLTKLIRSGAPTSEANN
FT                   RKDNLGKRITTQFEEVFGQTRLLRWSIPGIAHFFTMWGFFILASVYLEAYGLLFDHDFH
FT                   IPIIGTWDALGFLQDFFAVAVLLGIITFAIIRIVREPKKHGRDSRFYGSHTGGAWLILF
FT                   MIFNVIWTYALVRGAAADVGNLPYGNGAFFSQFMGWVLSPLGHDVNEWVETIALLLHIA
FT                   VMLVFLLIVLHSKHLHIGLAPINVTFKRLPNGLGPLLPMEYNGEPIDFEDPAEDAVLGR
FT                   GKIEDFTWKGYLDFTTCTECGRCQSQCPAWNTGKPLSPKLVIMNLRDHMFAKAPYILGD
FT                   KESPLENTPEGGLGEELRGEKESEKHSHDHVPESGFERIMGSGPEQATRPLVGTLEQGG
FT                   VIDPDVLWSCTTCGACVEQCPVDIEHIDHIVDMRRYQVMMESEFPGELGVLFKNLETKG
FT                   NPWGQNAKDRTNWIDEVDFDVPVFGKDVESFEGYEYLFWVGCAGAYEDRAKKTTKAVAE
FT                   LLAIAGVKYLVLGEGETCNGDSARRSGNEFLFQQLAAQNVETLNDLFEGVERVDRKVVV
FT                   TCPHCFNTLGREYPQVGGNYTVLHHTQLLNRLVRDKKLVPVTPADGGADITYHDPCYLG
FT                   RHNKVYEAPRELIGASGAKLTEMPRHADRGLCCGAGGARMWMEEHIGKRVNVERTEEAM
FT                   DTASTIATGCPFCRVMITDGVDDVAATRNVEKAEVLDVAQLLLGSLDKSGVTLPEKGTA
FT                   AKEAEERAAVRAEETAAAAPAPEKAPEKEPEAPAEAPAAKASTATESKPAAAAPAKGLG
FT                   IAGGAKRPGAKKTATEKTAAAPAEAKAEAPAAAPAKGLGLAAGAKRPGAKKTATEKTTA
FT                   APEAKAETAGTTEAPAEAKPEPEVKGLGLAAGARRPGAKKAPAKASPNEGAATVVQPPN
FT                   ADPDQAEAGTEAPDTADSDRGLETKPEPEVKGLGIAAGARRPGAKKKPAAPAAAPAKPA
FT                   EPEPQAQPEAQAEPAPEPEPEAPSQPASGNGDARVVGDEPPVKGLGIAKGARRPGKR"
FT   sig_peptide     complement(493328..493399)
FT                   /locus_tag="Mmcs_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.802) with cleavage site probability 0.745 at
FT                   residue 24"
FT   gene            complement(493536..496073)
FT                   /locus_tag="Mmcs_0443"
FT   CDS_pept        complement(493536..496073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0443"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR Sigma-70, region 4
FT                   type 2; KEGG: mbo:Mb0346c possible transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06564"
FT                   /protein_id="ABG06564.1"
FT                   /translation="MASPAPHRPAELPAAAREAVTAIEADPAAPAKVLVTGGIGTGKST
FT                   VLAAVRAALRSAGRPVLSRPRRPDDPAEAAVVVDDAHLLDPGDLDRLTDLVADSGSTVV
FT                   IATQPLAHNAPLRALVTALERENPAVALGSVTAVEVGRAAAATLGAAPAPEVVRLLTAV
FT                   TAGLPFLLRPALAAVGDGAAAVRQAARIALIERLRRLDEPLLDTLLVASLSPELGPDDV
FT                   AAALHIPSDAALAVVDRARASGLLEPAYHHSFLRTVHEGIAQLVGAARHHDIEVSLLCS
FT                   QLELSTLTADLALRMAEHGLRDERLGTALADLAAQTANDPARSARLYRAAADAGATALS
FT                   AQLADALALTGDCATAGRIADELLTSQDPDERAAAVRISASIAMHDGSAAQAFDLFRWL
FT                   GPSPDALLSAAGTVAALAAADGDTARELARTQATGPPTSIARAARSLADGLMLSLDQPY
FT                   PVAAARLGQSLNADAGVVTPDTPAALVTLAALHGGDPVRARSVMGRAVRSGRDDGSGDA
FT                   IFVTYRHRLLLGWTHMQDGQLQAAATALPRPTADLHRRDALWAAALQTAIARRSGDSGA
FT                   MQMHWYSAMEVLAEYSVDLFALLPLGELWVAAARLRQVERLQHTLDEAFALLTALGDPV
FT                   LWSVPLHWAGVHAGILANSPEAVAPHGQALTAASRDGRAQSAFAKALASAGRTWLRVLA
FT                   NHVDVDEVSAAARGLAQFGHTWDATRLAGQAALQTPDGRVSQAMLQIARDLKQSVAGAE
FT                   VLTETTGMDAPTPAAATPAATPARAAPAQLSEREREVAELLLLGMPYRDIGAQLFISAK
FT                   TVEHHVARIRRRLGAESRSEMLSMLRALLAPSG"
FT   gene            complement(496083..497888)
FT                   /locus_tag="Mmcs_0444"
FT   CDS_pept        complement(496083..497888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0444"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mbo:Mb0320 conserved hypothetical proline and
FT                   threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06565"
FT                   /protein_id="ABG06565.1"
FT                   /translation="MTEPLGLSIGMTNLVAARVGRPPVIRRAILTLFADRAPEVGVPSE
FT                   WSANPTEPGLVLSGFVDRVGDPVPLVASDGSAHRGELVLAEALDAMARTVDGGSPIAIA
FT                   VPAHWGPGTVGALRGALRNRPNLAPHWVPAALIPDSTAALAALQAAPGLPDHGVVVLVD
FT                   LGGSGSSISLADAGANLDAVGQTVRYPEFSGDAIDQALLNHVLVGIADAGSADPASTAA
FT                   VGSLARLRDECRQAKERLSADTATAVPVDLPGVQSDIRVTRPELEQLISEPLGGLLNAI
FT                   EDTLQRNQIPVANVTAVATVGGGAAIPLVTQRLSEHLRAPVVTTPESQLNVAAGAALVA
FT                   NQSADADAPTGMAPAADAPTSMGAAAWAAGAAGLAAGAAAADGASSATFRALAWSQDDE
FT                   PAGEPVPYAGADYDPSATGARPPVAFAPDDTGYGAGYGEEPGPLPWYKRPPVLFGAAAA
FT                   AALAALSGLAITLTGTEGDSTPVTETATTFSMEPSPQAPPPPVTTVTIGPDGVATTTVS
FT                   QPPPPPPTTTQQTTTTTQPTTTTTTTTQQTTTTTQPTTTTTRPTTTQPPTTTQPPPTTT
FT                   AAPPPTTVDPPDPPVTTVPVPDDGA"
FT   gene            498136..498660
FT                   /locus_tag="Mmcs_0445"
FT   CDS_pept        498136..498660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbo:Mb0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06566"
FT                   /protein_id="ABG06566.1"
FT                   /translation="MANSLLDFVMSLVRDPDAAARYAADPAAAIADAQLTDVTSVDVDN
FT                   LIPVVTESMPMAAASTGLDPFGAEAAGNVWSSGAATAAFDAFADPAPASAVIDTTSAVI
FT                   DTTDHFDQAADPLTGSDTLVDSLSTQLTDPALDEATPAGTGLDDVWGAALDDVQPADHD
FT                   PGQNPGFDLFD"
FT   gene            498932..499996
FT                   /locus_tag="Mmcs_0446"
FT   CDS_pept        498932..499996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbo:Mb0348 isoniazid inductible gene protein
FT                   IniB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06567"
FT                   /protein_id="ABG06567.1"
FT                   /translation="MNIIDFILDLFRSPAAAASFVVDPDGALRDAGLPNVTAAQLASVA
FT                   ATAAPAGYALGGGDPIVGLQRAVADHHQLASNFASPFSPQTSFAPTTEFASRNDTDLLS
FT                   GNNVPIASPDQAAGANAQNGAFNLGFGDITLGDKTTQTATNGGVVVGGDNDGDIVSGDG
FT                   AVLGDGNTMNNGDILAGSGSNVVVGKDNEVEDNSQTAGGDLIADNDAPVLNDVDTSGGN
FT                   GGGADGGGSLIGIGGGNAAGGDGGNGGGIIITDNDVNAGTQIDGDYGSDNVEDNSVSTS
FT                   VETNTSTSTESKIEDNSSSYESNIGSGNDTAIGSGNETNTSLFSGNDTGFETNTGIDTD
FT                   VASNNDTNTGLDVF"
FT   gene            500092..501951
FT                   /locus_tag="Mmcs_0447"
FT   CDS_pept        500092..501951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT0357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06568"
FT                   /protein_id="ABG06568.1"
FT                   /translation="MTRPNGPRNVADTRKVVTELIEHTTKIAEAQDRGDLVARLARART
FT                   RIGDPQIRVVIAGQLKQGKSLLLNSLLNMPVARVGDDESTVLATVVSYAEQPSARLVVA
FT                   RPDGEEPELVEIPTTDLGKDLRRAPQADGREVLRVEVTVPSPLLKGGLAFVDTPGVGGH
FT                   GQPHLSATLGLLPDADAMLMISDTSQEFTEPEMTFIRQALEICPVAAIVATKTDLYPHW
FT                   RQVVDANAGHLHRAGITTPLIPASSTLRSHAVQLNDKELNEESNFPAIVKFLSEQVLAR
FT                   NTDRVRDQVVNEIRAAAEHLSMAVQSELSALDDPAAGGTLTADLERRKKEAEEALQQTA
FT                   LWQQVLNDGIADLTADVDHDLRQRFRNITFHTERVIDAGDPTLHWAEIGAELEESVATA
FT                   VGDNFVWAYQRAEALAAEVARTFMEAGLDAVRMPAIDAREMGAEFGEFRSLAHLEAKPL
FT                   KIGHKIVTGMRGSYGGVLMFGMLTSFAGLGMFNPLSLGAGFVLGRKAYKEDMENRMLRV
FT                   RSEAKTNVRRFVDDVAFVVGKESRDRLKGIQRQLRDHYREIANQTTRSLNESLQATIAA
FT                   ARLAESERNARTKELQRQLNILRQVIEHAEKLGTPTAAPVAAP"
FT   gene            502038..503546
FT                   /locus_tag="Mmcs_0448"
FT   CDS_pept        502038..503546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0448"
FT                   /product="isoniazid inducible protein IniC"
FT                   /note="KEGG: mbo:Mb0350 isoniazid inductible gene protein
FT                   IniC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06569"
FT                   /protein_id="ABG06569.1"
FT                   /translation="MRAILGGTIAAYRDDPAYRQRPEVHNELERIGARLNQPIRIALAG
FT                   TLKAGKSTLVNALVGEEIAPTDATEATRIVTWFRHGPTPKVTANHRGGRRSNVPIARRS
FT                   SGPADERGLTFDLARLDPDDVLDLDVEWPAAELIDSTIIDTPGTSSLSRDVSERTLRLL
FT                   VPGDGVPRVDAVVFLLRTLNAADIALLKQIGELVGGSSGALGVIGVASRADEIGAGRID
FT                   AMLSAKDVATRFTEEMDRTGICQAVVPVSGLLALTARTLRQSEFVALEKLAGVDPAELA
FT                   KAMLSVDRFVREDSPLPIDAATRAALLDRFGMFGVRISIAVLRAGVKDSVALADELLER
FT                   SGLVALRDVIDQQFAQRSDLLKAHTALLSLRQFVQLNPIYATPYIIADIDPLLADTHAF
FT                   EELRLLSQLRSRTTTLTDDEMASLRRLIGGSGTDAASRLGLQPEDPYDGPRAAFAAAQR
FT                   WRRRAEHPLNDPFTARACRAAVRSAEALVAAYAAKGRSYRDGPA"
FT   gene            503577..505412
FT                   /locus_tag="Mmcs_0449"
FT   CDS_pept        503577..505412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0449"
FT                   /product="conserved hypothetical proline rich protein"
FT                   /note="KEGG: mbo:Mb2287c conserved hypothetical proline
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06570"
FT                   /protein_id="ABG06570.1"
FT                   /translation="MRTSLGVSLGAANLVAVADGRPTIQPAVLTVGGSTITGFVDRVGD
FT                   PVPLVAADGSAHYGGQLAAAAIEALTRAAHPLRRPDVVAVAVPAHWSTAAVAALRAVVP
FT                   HVTVVSDAVAALTALQANPGLPARGVVALCDFGATGASITLADAGEGFRVIGETVRCDD
FT                   FSGDLIDQAVLQHVLADLAAGVPADPSGTSAVASLSALREQSRAAKERLSVHTATALAG
FT                   PHGDIRLTRPELESLLAGPLAGFVDTVLDVLHRNGVVPAQLAAVATVGGGARIPIVTQR
FT                   LSEALRLPVITGPYAQVVAAAGAELIATRGSEQDAVTALAPVFDDAPATEAAIPLAWSA
FT                   ETEDFEAATHYAQPVYDPALARPGIHFDPEPVEDSPDGSAWYRRPGALFAGAACLAALA
FT                   ATGLILTSQTGEADAVQAGSSQITAPVATQPIEQPAPQRAAAPQGAAPAPVVTERVAAA
FT                   APAPAPRAVQPPSRPNPNAPAERRVASKQVAPAPRAPAPAPARVPAPAPAPAPAPSMGL
FT                   PRIPLPEFTLPRPAPPSSTPAPAPAPEPEPQPTQEPQPTQEPEPEPTVAPEPEPTVVPE
FT                   PTVAPEPESTAAPEPSAEAPAEPQPECVPDAETVC"
FT   sig_peptide     503577..503633
FT                   /locus_tag="Mmcs_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.973 at
FT                   residue 19"
FT   gene            complement(505521..506039)
FT                   /locus_tag="Mmcs_0450"
FT   CDS_pept        complement(505521..506039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:C30H6.11 Hypothetical protein C30H6.11"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06571"
FT                   /protein_id="ABG06571.1"
FT                   /translation="MARPPEDPNYSDNEPTQYSNAYSDEPTQYGDYTGAYDQPPPGEPQ
FT                   PWYRKPGALIALGAIAALLVAVIVWLVVQLVSGDDSGESTTTTTTTTTTSEAPSVVPPQ
FT                   TVTESPTETTAPTETTAPPETTTTTPSETTTTTTAPTTTTTSPAATTTVETSTSTVTIT
FT                   VPTLVPPGG"
FT   gene            complement(506571..507500)
FT                   /locus_tag="Mmcs_0451"
FT   CDS_pept        complement(506571..507500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0451"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: tfu:Tfu_1926
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06572"
FT                   /protein_id="ABG06572.1"
FT                   /translation="MDFRVFVEPQQGARYADQLAVARAAEQLGYSAFFRSDHYLAMSGD
FT                   GLPGPTDSWVTLAGIARETSSIRLGTMVTSATFRHPGPLAVSVAQVDEMSGGRVELGLG
FT                   AGWFEAEHKAYAIPFPPLGERFDRLTEQLDILTGMWATPVGETFDYSGTHYTVVDSPAL
FT                   PKPVQAVPPVIIGGQGAKRTPALAAKYAGEFNVPFVPLDTLSTQFDRVRAAVAEAGREP
FT                   DSMVYSAAFVLCAGADDAEIARRADAIGREVDELRSNSPMVGTPAEIVDKLGPFAEAGV
FT                   ERVYLQMLDMADLDHLALVAGQVLPQLR"
FT   gene            complement(507511..508128)
FT                   /locus_tag="Mmcs_0452"
FT   CDS_pept        complement(507511..508128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06573"
FT                   /protein_id="ABG06573.1"
FT                   /translation="MTAAQRERAALVDAMRAKGPDAPTLCAGWKTRDLAAHLYVREHRP
FT                   DATAGIAVPALAKYTEKVQNRAAEGDWDELLDKIAAGPPLYSPFKLLDPVANLAEMFIH
FT                   CEDVRRAQPGWEPRTLDDATVNGLTRTLSLMARLTLAKAPARAALRTPEGKTLVTAGKG
FT                   DPVTVTGRPEELLLFAVGREARVEFEGDPAAVQALRDAPKGL"
FT   gene            508403..509311
FT                   /locus_tag="Mmcs_0453"
FT   CDS_pept        508403..509311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06574"
FT                   /protein_id="ABG06574.1"
FT                   /translation="MPEVQLHHDGYPKYRRMVRFDWSETPVHWVPGDPFSTHMMNVLHL
FT                   LLPEGERHFIKAVLEASSLVDDPELEGSIKPFIQQESWHAWAHQIVLDHLAEQGIDTKP
FT                   YTERLGRSLSMTLGDPPRFLPARLHRWWLYRRLADVAALEHFTAVLGQWVLQNRALDYA
FT                   GADPVMLDLLRWHGAEEVEHRSLVFDVYQNVCGSYWIRAISMLTTAPLFIGWWIAGARY
FT                   LMKNDPTIDQTWRWRDWLRAARQYRLPGPGSLLFTIPVRYLRRGHHPDHEASTEMAVQY
FT                   LEYSPAARAARERAGLAPQTT"
FT   gene            509362..509553
FT                   /locus_tag="Mmcs_0454"
FT   CDS_pept        509362..509553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0454"
FT                   /product="ferredoxin (3Fe-4S)"
FT                   /note="KEGG: cpe:CPE2511 ferredoxin [3Fe-4S]"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06575"
FT                   /protein_id="ABG06575.1"
FT                   /translation="MKVSVDFDTCDGNAVCMSICHEVFELDDDGYLHLLQENPSEELRE
FT                   QVIGAERSCPTQAITVEG"
FT   gene            509557..510759
FT                   /locus_tag="Mmcs_0455"
FT   CDS_pept        509557..510759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0455"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sma:SAV1609 putative ferredoxin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06576"
FT                   /protein_id="ABG06576.1"
FT                   /translation="MPVDRQLEKILVVGTGVAGMRAAETLRLDGYRGELTVVGAERHAP
FT                   YQRPPLSKKLLSGAVHRAGADLAPRMDLEARVLRGASVRELDMSTRTAHLRDGSDDVSV
FT                   PFDGLVVATGAAARQWPDGPVPDGVMALRTVDDCLAIRERLESRPRVVVVGGGFIGAEV
FT                   AATCRSMGLSVTLIEKSSAPMASALGEEMAACWERLHRGNGVELRSGVGVESFAGDDRV
FT                   EAVHLTDGTRLPADLVIIGLGVTPSVDWLSGSDLRLDNGVVCDATGAVEGVTDVVAAGD
FT                   VASWWHPRYERYLRIEHWEHAERQGVAAAHTLLAGPERAQEFDALPYFWTDQYDVKMQM
FT                   LGVPDGYDSVAVVEGGPDRWDFVAAYGRDGRVIAVLSTIPGRVHAYRDAVFGAFPPAPP
FT                   G"
FT   gene            complement(510711..511007)
FT                   /locus_tag="Mmcs_0456"
FT   CDS_pept        complement(510711..511007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06577"
FT                   /protein_id="ABG06577.1"
FT                   /translation="MAALWGRIFPRRRHSMTATPRTFRSTAASWSTSPIPTSAVRNCTT
FT                   GGSGRSAWPSPELPWSRRSESWVSGRVAVSGRRVDLLDYPGGAGGKAPKTASR"
FT   gene            511106..511681
FT                   /locus_tag="Mmcs_0457"
FT   CDS_pept        511106..511681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP1604c LppE"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06578"
FT                   /protein_id="ABG06578.1"
FT                   /translation="MTIMPPLTPCAPLRYGYRSPRLRDTYQRWRDGVCDPMVDRLRGLG
FT                   LAPRRPLTRVAATALALSAVLAGCSEQQPTEPPVSRATVTVNDTAVASLVPRCERQQKY
FT                   LSVRAGNSRGEITGVLDVGGARPVAKWVKIRDLGGFSGDFWEGGVGSIKTVRNDGDTTE
FT                   LGGTAYGVYTARPHELAQTARFSFEVQC"
FT   gene            511675..512151
FT                   /locus_tag="Mmcs_0458"
FT   CDS_pept        511675..512151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0458"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: mpa:MAP1219c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06579"
FT                   /protein_id="ABG06579.1"
FT                   /translation="MLSAGRATGVVERMLRCRPLVRAPILLYRCGLGFMLGDRFLMLEH
FT                   VGRSTGRRRYVVLEVVAHRTRDSYTVASGFGEQAQWLRNVAAQPRVRVSTGRRISVPAT
FT                   ARRLTGPEADDALTDYRSRHPRAWRALRGVLERNLGGRVEPPGTELPVVEVALD"
FT   gene            complement(512159..513574)
FT                   /locus_tag="Mmcs_0459"
FT   CDS_pept        complement(512159..513574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0459"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: nmu:Nmul_A0466 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06580"
FT                   /protein_id="ABG06580.1"
FT                   /translation="MSEQRPAPHIFVLFGATGDLAKRKLFPGLYRLAAAGRLPEEYAII
FT                   GSGRHSPGGDDEFRDSVGDGLRDSVDDIDDRVLSNLLQSLSFQTSDSDDGSDLAEAVRS
FT                   ARTRLGDGAQTLIYLSVPPRAMQPMIGMLGREGLAEGARVVVEKPFGTDLDTARELDAT
FT                   LKDVVDEDQVYRIDHFIGKEAVQNILAVRFANGLIEPAWHRNHLVSVQIDVPEELTIEG
FT                   RGSFYESTGCFRDMISTHLCQVLGFVAMEPPVHLDPVSLRNEKAKVFEAMRPLDPDRVV
FT                   FGQYDGYREEEGVADDSQVETFVALEAFIDTERWQGVPFYLRTGKALGATRRTVTLTFR
FT                   SPPMALFGADDNEHSPNQLVLELTDSPEFQVRLLAKRPGPDLGLMPLDLSLGVADEDSD
FT                   DTPLEAYERLLLDVMRGDQTLFTRADEVDRLWQVCQPVLDAPPPALTYASGSWGPQEAL
FT                   ALPGAAGWRLPDA"
FT   gene            complement(513627..514187)
FT                   /locus_tag="Mmcs_0460"
FT   CDS_pept        complement(513627..514187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0460"
FT                   /product="putative lipoprotein LpqJ"
FT                   /note="KEGG: mbo:Mb0351c probable lipoprotein LpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06581"
FT                   /protein_id="ABG06581.1"
FT                   /translation="MRSKVVMAGVVTVATLLTGCQNDTSGTAVRSPDSLIEPTEPTVPT
FT                   PRPSRTSTPAPPPRTLTPAPPSASAPPSAAEVLAPQNGYVFIQTKSGKTRCQLSTEEVG
FT                   CEAQFTDSPEVGGLPANGVRLSADGQVEWVLGNLGDIPAVTLDYRRYSAVGWTIDASSD
FT                   GTRFTNDRTQRGMFVSVERVQTF"
FT   sig_peptide     complement(514119..514187)
FT                   /locus_tag="Mmcs_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.809) with cleavage site probability 0.405 at
FT                   residue 23"
FT   gene            complement(514197..514940)
FT                   /locus_tag="Mmcs_0461"
FT   CDS_pept        complement(514197..514940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa28310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06582"
FT                   /protein_id="ABG06582.1"
FT                   /translation="METTVDEIAPGVFRLSTYVPEITEHGFTFNQFLLTGDEPFLFHCG
FT                   QRQLFPLVSAAIQRVIPLEKLRWISFGHLEADECGAMNLLLASAPNAQVVHGQLACMLS
FT                   LTDMCDRPPVAATDEPLDTGGHSLRFIATPHVPHNWEAGLWFDDATGTLLAGDLFTHVG
FT                   RCPALTENDCVAPALEAEAFFHATGLCTDLVPTLTTLAELRPTTLAIMHGSSFTGDGEH
FT                   QLRRLADGYTDMMRASLQSLTPQPP"
FT   gene            515156..517024
FT                   /locus_tag="Mmcs_0462"
FT   CDS_pept        515156..517024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0462"
FT                   /product="Chaperone DnaK"
FT                   /note="TIGRFAM: Chaperone DnaK; PFAM: Heat shock protein
FT                   70; KEGG: mpa:MAP3840 70 kD heat shock protein (molecular
FT                   chaperone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06583"
FT                   /db_xref="GOA:Q1BEV1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEV1"
FT                   /protein_id="ABG06583.1"
FT                   /translation="MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTIRSVKRHMGTDWNTEIDGKKYTAQEISARTLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDERVVTWLVDKFKASSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRQPFQSVIKDAGISVGDIDHVVLVGGSTRMPAVSELVKEMTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVFQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEEIDRMIKDAEAHADEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDVLTKVDGAISEAKTALAGTDIGAIKAAMEKLGTESQA
FT                   LGQAIYEATQAEQAAGGGAGGADGSSSSSDDDVVDAEVVDDDRENK"
FT   gene            517021..517668
FT                   /locus_tag="Mmcs_0463"
FT   CDS_pept        517021..517668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0463"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: mpa:MAP3841 GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06584"
FT                   /protein_id="ABG06584.1"
FT                   /translation="MTRPFNSESDPQEPVTVTDKRRIDPVTGEVREPSGPAPSGPAPDA
FT                   APDSFAGETPEEADKAGELLADLQRVQADFANYRKRALRDQQLTADRAKAGVMAQLLPI
FT                   LDDLDRARSHGDLDTGPLKAVADKLVSTLEGLGLTPYGEEGDEFDPALHEAVQHEGEGT
FT                   HPVVGTVMRRGYKVGDQVVRHALVGVVDTVPAGDTAENASAAGREAAESDNQ"
FT   gene            517697..518875
FT                   /locus_tag="Mmcs_0464"
FT   CDS_pept        517697..518875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0464"
FT                   /product="Chaperone DnaJ"
FT                   /note="TIGRFAM: Chaperone DnaJ; PFAM: DnaJ central region
FT                   heat shock protein DnaJ-like chaperone DnaJ-like; KEGG:
FT                   mbo:Mb0360 probable chaperone protein DnaJ1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06585"
FT                   /protein_id="ABG06585.1"
FT                   /translation="MAQREWVEKDFYKELGVSSDASADEIKKAYRKLARDLHPDTNPDP
FT                   SAAERFKAVSEAHSVLSDAAKRKEYDETRRLFAGGGFGRGRFNGGGGGFGGFGGADGGV
FT                   EFNLNDLFDAAGQTGGANIGDLFGGLFGRGASPRPSRPRRGNDLETETELSFLEATKGV
FT                   AMPLRLTSPAPCTNCHGSGARPGTSPKVCPNCNGAGVVNRNQGAFGFSEPCTECKGSGS
FT                   IIEHPCGECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHV
FT                   RPDKVFGRDGDDLTVSVPVSFHELALGTTLSVPTLEGKVGVRVPKGTSDGRILRVRGRG
FT                   VPKRGGGHGDLLVTVKVAVPPNLEGEAAEALEAYAKAERASGFDPRAGWAGA"
FT   gene            518878..519267
FT                   /locus_tag="Mmcs_0465"
FT   CDS_pept        518878..519267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0465"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: mpa:MAP3843
FT                   HspR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06586"
FT                   /protein_id="ABG06586.1"
FT                   /translation="MAAKRNEEARTFLISVAAELAGMHAQTLRTYDRLGLVSPQRTSGG
FT                   GRRYSERDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQSRVKELVREVEELRAN
FT                   QRRDLAVPAKSTALVVWQPRHGRGR"
FT   gene            520127..521443
FT                   /locus_tag="Mmcs_0466"
FT   CDS_pept        520127..521443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2624c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06587"
FT                   /protein_id="ABG06587.1"
FT                   /translation="MASISMERSTVARGVMTRRCRHLTRVAPWLLAVSLALRFVGSIPF
FT                   LDMLFVDLRVYILGGEALTQPGTLYGLTYIDSYGDHLPFIYPPFAALLFYPLHFLPFPV
FT                   VAWIWQLAVVAGLYGLVRISQRMLGGGSHRVAMLWTAAGIWFEPIRTILTCSQVGVFLT
FT                   LAVLYAAYTSRSWLSGLLVGLSAGVKVTPAITGLYFVGMRRWAAVCFSLAAFLATVLVS
FT                   AVIAPQETRQFFGGLFSRVPMPTATCLNQSWRGTVSRIVGYDAGRSLVLLVAIGVTAVL
FT                   ALLAWRELGRGPGGRDALASLLVVQLFGLTASPISWAHHWVWVVPLTIWLLHGPWRGRA
FT                   GARVLGSGWIALMVIGVPTLLSGQQADLSTFSRPWYLAVAAAVYVPMTLVTFAWIIVAS
FT                   RTGTRRTCPPSEPKAESAPSTSAVVFTPAASHAERPTNR"
FT   gene            521440..522726
FT                   /locus_tag="Mmcs_0467"
FT   CDS_pept        521440..522726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2624c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06588"
FT                   /protein_id="ABG06588.1"
FT                   /translation="MTRLPLPIPRSDGAKAAPTVGRYSRPMRAASALKVRPCLARVVAL
FT                   APILLAVSIIARLASTMVYYFFAGDAFFDLHVYVIGGAALNHPGTLYDVVYVDPTKGER
FT                   LPFTYPAFAAMVFYPLHLLPFGLLAFLWQIALIAAIYASIRISQRLIGDGAGGPRVAML
FT                   WTAVAIWLEPVASSVQTGQVGVFLMLAVLYAAYSSRWWLSGLLVGAGAGVKLTPAITGL
FT                   YFVGMRRWAAAAFSAVTFFATVGLAYVALPADAGRYFPDQMTEAGTTLPIGSSWNQSWL
FT                   GGLSRILGYDPGLHPLVIAAVAVTALLAALAWRALGSADGRDRLASLLVVQFLGLMASP
FT                   VSWIHHWVWVIPLIIWLIHGPWRERAGARLLGLGWLALMVISVPSLLSLAQPDIWEISR
FT                   PWYLAWAEMVYIVASLSTLAWIIRTGRRA"
FT   gene            522719..523987
FT                   /locus_tag="Mmcs_0468"
FT   CDS_pept        522719..523987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2624c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06589"
FT                   /protein_id="ABG06589.1"
FT                   /translation="MPESGVPAGRRRLLAPLLLVTSAAALLAVTMANPPDLVDFHVYML
FT                   GGVALDRPDTLYSFAYSDQSPDQPLPFVYPPFAAILFRPLTALPFVVAGVLWQLGILAA
FT                   VYGIVRISQRLLGGGSHRTAMLWTAGLIWLEPVRVALDLGQVGIFLTLAVLYAVCSRRW
FT                   WLSGLLVGLAAGVKLTPAITGLYFLGVRRWTAAAFSAVVFVATIGLSYLVVGDQVRNYF
FT                   TRVMGDTSINPIGIALNQSWRGAISRFLGHDAGGSALVIAAIAGTAVLALFAWAALGAG
FT                   SRPRDRLGSVLVVQLFGLLMSPISWVHHWAWVVPLVLWLLSGPWRNEPGARVLGWGWLA
FT                   LTFVGVPSQLSLLEPSLWEISRPWYLAWAGLAYVVAAVATLGWIVLTGRRNAAPTPPVR
FT                   RRFARVVGTRGKQIACEEHRAGR"
FT   sig_peptide     522719..522817
FT                   /locus_tag="Mmcs_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.598 at
FT                   residue 33"
FT   gene            complement(523984..524886)
FT                   /locus_tag="Mmcs_0469"
FT   CDS_pept        complement(523984..524886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0469"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: mpa:MAP3850c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06590"
FT                   /protein_id="ABG06590.1"
FT                   /translation="MAEHQPVTLSDPSSSVTATYVPAAGMICTSLADGGVEFLGQRRGV
FT                   EAYITSGKTMGIPLLYPWANRLSSSKYAIDGGVVTLTPGVAGVRTDENGVPIHGVLGAY
FT                   PGWVVTERSDNTLVAEVDWTDKPRLLATFPFPHVLTMSVTLADRTLTVDTTVTPSAAAP
FT                   VPLCYGYHPYLQIPDVARAQWQLQSPTMRHLRVDAWGLPTGATEEWAGGTAPLGDRELD
FT                   HGFDQVGDGALFVLAGGDRRVEVTFEKGYPAAQLFAPSADDLVAVEPMAAPTDALRREN
FT                   YRVAAPGEPDTSRFTIRVT"
FT   gene            complement(524934..526100)
FT                   /locus_tag="Mmcs_0470"
FT   CDS_pept        complement(524934..526100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0470"
FT                   /product="Oxidoreductase FAD-binding region"
FT                   /note="PFAM: globin oxidoreductase FAD/NAD(P)-binding
FT                   Oxidoreductase FAD-binding region; KEGG: mpa:MAP3851c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06591"
FT                   /protein_id="ABG06591.1"
FT                   /translation="MGLDDRDALAVLRDAVDPRRGSDPLIADFYTRWFAADLSVRDLFP
FT                   PDMARQRTAFAEAMTWLFGELIAQRAEEPVAFLAQLGRDHRKYGVVQRHYDTMGDALYA
FT                   ALRSGLADQWSDRVAEAAHDAVALATGVMRGAADAEEGPPFCDGTVIEHIRATRDVSVV
FT                   RLKLDQPLAYHPGQYVTVQVPQWPRRWRYFSPAIPADPDGYVEFHIRSVPGGMVSTAIV
FT                   NETRVGDRWRVSNPHGALAVDRDGGDVLMVAGSTGLAPLRTLIMDMTRFGVNPRVHLFF
FT                   GGRFPCDLYDLMTLWQIASTNPWLSVTPVSEYSSDPPWAADYPDPSPPRGLHVRQTGRL
FT                   DEVVTRYGNWGDRQILICGGVAMTEATKAALIAKGAPPERIQHDPLTT"
FT   gene            complement(526117..527118)
FT                   /locus_tag="Mmcs_0471"
FT   CDS_pept        complement(526117..527118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cjk:jk0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06592"
FT                   /protein_id="ABG06592.1"
FT                   /translation="MTTTSSPHTPTRHHEPPPAFRAAGIVIALAAVVAIVALAFALPAA
FT                   KSGPHDVPIGVAGPQAANGRIAAMLDERAPGAFAVTYYPGEDALRDAIADRQVYGGLTV
FT                   GPDGRKLLIASGAGPAVAQVLTQLGTGMAAQTGSTPTIEDVAPLPDTDPRGTGLAASAL
FT                   PITLAGILPAIALVLALRREVWTRLAAAVVFSGVAAWTITALLYYVLGSFDQNFWGVTA
FT                   GLTLGLLACGLPILGFGSLFGRVGLACGAALALLVGNPLSGLNSAPEMLPRGWGEVGQL
FT                   FPQGATATLLRSTAFFGGAGATSAIVVAICWAAAGAVLVALAALRERARTGD"
FT   sig_peptide     complement(526993..527118)
FT                   /locus_tag="Mmcs_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.447 at
FT                   residue 42"
FT   gene            527272..527853
FT                   /locus_tag="Mmcs_0472"
FT   CDS_pept        527272..527853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0472"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sma:SAV4715
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06593"
FT                   /protein_id="ABG06593.1"
FT                   /translation="MSREVVLAAAKNRFATDGYERTTLRAIAKDAHVDPSMVLYLFGSK
FT                   LDLFRESLRLILDPERLVEALSEAGGDVGSRMARVYLQIWESPETGPSMVVMLQSATSN
FT                   SEAHEAFRTFMQTYVLAAVSGVLGGDEHARLRAMLAATTLVGTAVLRYVMKIPPLATIP
FT                   TEDLVALLAPTVTRYLTADAEELGLPAQSV"
FT   gene            complement(527841..528506)
FT                   /locus_tag="Mmcs_0473"
FT   CDS_pept        complement(527841..528506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06594"
FT                   /protein_id="ABG06594.1"
FT                   /translation="MTGSWGTVLTELIPLALVIALSPLSIIPAVLMLQTPRPRPTALAF
FT                   MAGWLIGLGALTAIFVAVSGAIGGFEKPPSWASWLRIVIGAALIVFGLVRFARRHSSSH
FT                   QPKWLRNLTTLGPGRAAGTAAVLTVANPKVLFICVAAGLAIGSAGLGNAVWAAVVYFAA
FT                   IAGCSVAVPILAYAVSGGRLDDPLARLKDWMERNHATLMAVILVVIGLLVLYKGIHTL"
FT   gene            complement(528654..528983)
FT                   /locus_tag="Mmcs_0474"
FT   CDS_pept        complement(528654..528983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06595"
FT                   /protein_id="ABG06595.1"
FT                   /translation="MTEGPGELQVSPAHLRELSDKQNRAAHQIAAATTLTNGVAAEVER
FT                   THGRVCAPAFAAAAAAEEARVKACAAVQSVSEAFAGSLELAQAQYLTTDANARDELDGM
FT                   MHPGR"
FT   gene            complement(529017..529760)
FT                   /locus_tag="Mmcs_0475"
FT   CDS_pept        complement(529017..529760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06596"
FT                   /protein_id="ABG06596.1"
FT                   /translation="MGLFDDYGKVLEKVGSTMSSFDPFGPIGAAGEMLSGVAQTAQLID
FT                   QNGVDALWNLAADSAEMASVAAGMLPLAKQTLIIQGGLKAVLAMQYECGFTNEPERADG
FT                   YSMGAQRFNEVTETLAGATPDQRWTGAASDAYATANERQQLRMKKMVDADLDVRMALSA
FT                   EAGAVETTRRILNNAATMMGNAIAPALAARAGKVRQSAVALDRDSCGRRIGADLRLVHE
FT                   RTGESVREIGSEYRSSHAPLRGSGR"
FT   gene            530147..530677
FT                   /locus_tag="Mmcs_0476"
FT   CDS_pept        530147..530677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06597"
FT                   /protein_id="ABG06597.1"
FT                   /translation="MVVSTSLPNEPSGTLHFQMSEPGGTPMLSITRFAERQHRLEIRDS
FT                   AGGVIGQIRQTSTRGQAFRKARMAVVLESRRQPLACADLTIDPSQNRYANLETPIRGAA
FT                   GAVIATIERQGGYTGRGDDPLVYELRCAQPTGEPLPMLLLVTAFMHSLYDGVVDRGPFG
FT                   AVGRWLSRPTWES"
FT   gene            complement(531122..531559)
FT                   /locus_tag="Mmcs_0477"
FT   CDS_pept        complement(531122..531559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06598"
FT                   /protein_id="ABG06598.1"
FT                   /translation="MLVGYFNALNLESVPLNFNSFADVGLEAKGPRCRRVNGGRARCHP
FT                   ARSSGRSPAGRRRRACRRGSARMPSPGGARAEGGPWAAGSSVCSRRSRYSSRPIATVVP
FT                   RSRSPGRRWVRSAHRRRRICPGGECIYPSSPPGVHRPRAPR"
FT   gene            531584..534130
FT                   /locus_tag="Mmcs_0478"
FT   CDS_pept        531584..534130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0478"
FT                   /product="ATPase AAA-2"
FT                   /note="PFAM: AAA ATPase, central region Clp, N terminal
FT                   ATPase associated with various cellular activities, AAA_5
FT                   ATPase AAA-2; SMART: ATPase; KEGG: mpa:MAP3853
FT                   ATP-dependent Clp protease, ATP-binding subunit ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06599"
FT                   /protein_id="ABG06599.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAASAAGNPQIAPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPSASGASSQPQLSRESLAAVTAAQQLATEIDDE
FT                   YVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPDPEGSYQALEK
FT                   YSTDLTARAREGQLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRGKTVISLDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGDSSMDAGNMIKPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVYVG
FT                   EPSVEDTVGILRGLKERYEVHHGVRITDSALVSAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDDASKERLEKLRGELADYKEKLAE
FT                   LTTRWQNEKNAIDIVRELKEQLEALRGEADRAERDGNLEKAAELRYGRIPEVEKKLDAA
FT                   VPQAEARDDVMLKEEVGPDDIAEVVSAWTGIPAGRMLEGETAKLLRMEDELGKRVVGQR
FT                   RAVQAVSDAVRRTRAGVADPNRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMVRID
FT                   MSEYGEKHSVARLVGAPPGYIGYDQGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGQGRTVDFRNTILILTSNLGAGGTEDMVMAAVRSAFKPEFINRLDDVIVF
FT                   DGLNPEELVSIVDIQLQQLAKRLAQRRLTLEVSLPAKKWLADRGFDPLYGARPLRRLIQ
FT                   QSIGDQLAKMLLAGDVHDGDIVPVNVSPDGESLVLG"
FT   sig_peptide     531584..531655
FT                   /locus_tag="Mmcs_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.572 at
FT                   residue 24"
FT   gene            534335..535201
FT                   /locus_tag="Mmcs_0479"
FT   CDS_pept        534335..535201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06600"
FT                   /protein_id="ABG06600.1"
FT                   /translation="MVPLWFTLSALCFVGAAVLLYVDIDRRRGLGRRRKSWAKSHGFDY
FT                   EHESADILKRWKRGVMSTVGDVTAKNVVLGQIRGEAVFIFDLEDVATVIALHRKVGTNV
FT                   VVDMRLKGIKEPRENDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQHWTLISMPVTSTRAQWDEGLRTVRQFNDLLRVLPPIPQTDSVQAVARRSGSPSRPI
FT                   NPAPHRPPEPPQGRPDVGRPGSAAPARPYAQRPEAGRPDGPPAARPDTARRTPPARNGH
FT                   QSANFQR"
FT   gene            535217..535993
FT                   /locus_tag="Mmcs_0480"
FT   CDS_pept        535217..535993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0480"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP3856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06601"
FT                   /protein_id="ABG06601.1"
FT                   /translation="MPRPVVLITGPTSGLGEGFARRYAADGHDLVLVARDEARLEALAG
FT                   ALRAETGAGVEVLPADLADADDRAKVAERLSSRVRVLVNNAGFGTSGEFWTADYQVLQS
FT                   QLDVNVTAVMQLTHAALPPMLDAHAGTVINVASVSGLLPGRGSTYSASKAWVIAFSEGL
FT                   ANGLGGTGVGVHALCPGFIHTEFHQRAGIEMSGLPSWMWLEVDDVVGDCLTAVAKDRVV
FT                   IVPGVQYKAMTTVSRLVPRHLVRAMTRTVGRGRGRT"
FT   gene            536000..536896
FT                   /locus_tag="Mmcs_0481"
FT   CDS_pept        536000..536896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0388c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06602"
FT                   /protein_id="ABG06602.1"
FT                   /translation="MRALVAVVVTVLLVAVTGCSKAEGRSDTYSAPTAKVGESLAVSGW
FT                   NISVSNLRFEADHVLVDVDASHSGEGESVAPESLRFGLYGALVHPIEANGLGSCQNVDA
FT                   LNVNPMSAPSPDRLSGTVCLGPQRDQSQVRGIYAYSPQDRMAGTTVAYAAAFPVGLLPT
FT                   RDTETGLTLTTTSLDAFRADGAQLNQAALGDPEAFSGNGYMLLGLQIDGLASRYREDSM
FT                   RRGGPLMVVVAPTLPGKGLSYACAAYGASVLVLPEASREAVNMRASLCTQGEINRALLF
FT                   ASVSVVGTHAALWTTGD"
FT   sig_peptide     536000..536068
FT                   /locus_tag="Mmcs_0481"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.770 at
FT                   residue 23"
FT   gene            536889..537533
FT                   /locus_tag="Mmcs_0482"
FT   CDS_pept        536889..537533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0482"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mpa:MAP3859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06603"
FT                   /protein_id="ABG06603.1"
FT                   /translation="MTEAPGPTEWGEAPGVGPWPGDLPDDPRYDPELLRDGDTRNVVDA
FT                   YRYWTREAIIADIDRRRHPLHIAIENFGNDANIGSVVRTANAFAVDTVHIVGRRRWNRR
FT                   GAMVTDRYQRLRHHDSTAELLDFAAEAGLTAVAVDNIPGAVPLEHTDLPRECLLIFGQE
FT                   GPGITEDAKTGARLTVSIAAFGSTRSINAAVAAGIAMHTWIVQHADLGKAW"
FT   gene            complement(537426..539003)
FT                   /locus_tag="Mmcs_0483"
FT   CDS_pept        complement(537426..539003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO1567 putative transmembrane-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06604"
FT                   /protein_id="ABG06604.1"
FT                   /translation="MTRRWLALSVLTLAVLVIGIDGTVLALATPFISSDLHTSATELLW
FT                   IGDIYSFVLASLLITMGSLGDRIGHRRLLLCGATLFAAVSVVTAYAPTAEALIGARALL
FT                   GVAGATLAPATLALIRGIFADARQRSMAVGIWAAAFSAGAALGPMVGGVLLEHFWWGSV
FT                   FLINAPVMAVLVIGGLTLLPEHRNPEPGPWDLPSVGLSMLGILSVVYAIKETAAHGPRL
FT                   SALATAVVGVSALTVFVRRQLRLPSPLIDVRLFGNRAFSGVVGANLLSVLGLSGLVFFL
FT                   SQYFQLVQGYSPLGAGLAELPAAVTATVFGVLAGFAVRRWTQRAVLTTGLALVGVAMAT
FT                   LTTIHPTSPYPHLGIALFVVGVGLGLAFTVASDVILASVPRERAGAAAAVSETAYELGM
FT                   ALGIAVVGSILTGVYRTLVVPPGLSPAAATQARDSLAAATDVAAGLPPAQAGALLDAAR
FT                   ESFSSGLAVASGVGAALMLTSAVTVWVLLRERLPRLAEVGVLNDPGVHGDAGGDGRVDT
FT                   ACGAERGN"
FT   sig_peptide     complement(538917..539003)
FT                   /locus_tag="Mmcs_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.589 at
FT                   residue 29"
FT   gene            complement(539000..539560)
FT                   /locus_tag="Mmcs_0484"
FT   CDS_pept        complement(539000..539560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0484"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sma:SAV6781
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06605"
FT                   /protein_id="ABG06605.1"
FT                   /translation="MRYSRFMVTDRESVLRAAADFLGRRPNATQDEIAAAVGVSRATLH
FT                   RHFAGKPALMAALDDLAIAEMRTAVDAARLSEGSAADALRRLVAACRPVSPYLALLYSQ
FT                   SQDIDGDQSMQGWAESDAAITALFERGQRSGEFRPDLTAAWLTEALYSLVAGAGWCIQV
FT                   GRAAGRDFERMISELLLSGVQNS"
FT   gene            539634..540797
FT                   /locus_tag="Mmcs_0485"
FT   CDS_pept        539634..540797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0485"
FT                   /product="glycoside hydrolase, family 76"
FT                   /note="PFAM: glycoside hydrolase, family 76; KEGG:
FT                   mpa:MAP3860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06606"
FT                   /protein_id="ABG06606.1"
FT                   /translation="MDQLWANRAASAEAAITQRHLRRLWGLPGTQLGVVAWPAAGPHKQ
FT                   FRTWHYWWQAHLLDCLVDAQLREPDPDRQRRITRQIRAHRIRNIGRWTNDYYDDMAWLA
FT                   LALERAGRLAGVARPRALGTLCEQFLNAWVPEDGGGIPWRKQDQFFNAPANGPAGIFLA
FT                   RYDNRLRRAQQMADWIDEVLIDPDTQLVFDGIKGGSLVRAQYTYCQGVVLGLETELAVR
FT                   IGGDDGGGEHALRVHRLVAAVAEHMAPDGVIKGAGGGDGGLFNGILARYLALVATTLPG
FT                   DTADDVAARDTARRIVLASAEAAWGNRQTVGADGGALPLFGAFWERTAELPTAAGRQAE
FT                   SVEGAVNASEIPERDLSVQLSGWMLMEAAHAVSDQPAESADPGPAET"
FT   gene            540794..542635
FT                   /locus_tag="Mmcs_0486"
FT   CDS_pept        540794..542635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0486"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: DSBA oxidoreductase Na+/H+ antiporter NhaA;
FT                   KEGG: sco:SCO0285 sodium/proton antiporter; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06607"
FT                   /db_xref="GOA:Q1BES7"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BES7"
FT                   /protein_id="ABG06607.1"
FT                   /translation="MTEASARTIGPLPSRFSRDPKTPRSTDNAAAALLLAFTVLAILWA
FT                   NSPWAQSYSIFWDTDVAVSFGEYRAELSVKHLVNDGLMAFFFFIVGLEVKSEFVIGELT
FT                   DRSRAAVPVVAAIAGLIVPAVIFLTFNPSGPDAQAWGVVISTDTAFLVGALAVIKPKFP
FT                   ARLRIFLLTLAVVDDVGALGAIALFYTDDLKLAPLAVAALLIAALAMVRRLPSLRGPAY
FT                   AVLGFALWIALYLAHVHPTLAGVAVAVLIPVFTPERRQVEQTVDLVRAFRQSPNPQYAR
FT                   AVTRGLRESISINERLQTAVGPYVSFVVLPIFALANAGVHLDEQTITAAMSSTLTWGIV
FT                   AGLVVGKFVGITAATALMSATGWGQLAPGLSLRRVAGGAALSGIGFTISLFIVDVAIED
FT                   PARQDEARVGVLIASVLAFTLSWALFRITDWISPPEPVGLTLVRPVDPERDHIRGDPDA
FT                   PLVLVEYGDYECPFCGRATGAIDEVRTHFGDDLLYVWRHFPLERAHPRSFDAARASEGA
FT                   AAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQFDQDVRVHASKVLHRVRDDAQ
FT                   DAEVMDLNSTPTFFVNGKRHKGPWDAASLIRALEAGR"
FT   sig_peptide     540794..540946
FT                   /locus_tag="Mmcs_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.858 at
FT                   residue 51"
FT   gene            complement(542641..543546)
FT                   /locus_tag="Mmcs_0487"
FT   CDS_pept        complement(542641..543546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0487"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR LysR,
FT                   substrate-binding; KEGG: mbo:Mb0384 probable
FT                   transcriptional regulatory protein (probably LysR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06608"
FT                   /protein_id="ABG06608.1"
FT                   /translation="MRAAAEELGMSDAGISMHVTQLRKELDDPLFSRTSAGLAFTPGGL
FT                   RLASRAIEILGLQQQTAIEVTEAAHGRRLLRIAASTMFAEHAAPGLIELFSARADDLTV
FT                   ELSVHPTSRFRDLIESRAVDITLGPAPADPGPALVVRPFLKYQIITVAAPETAAGPGMQ
FT                   APAQLREHDWMLGPSAGGVDGEVATMLRNLSIPESRQRIFQSEAAALEEVQRAGGVTLT
FT                   LGFAVSRDLSSRRLVQIKGAGLQTSGEWFASTLTPAARPPASSELMRFITTPRCTQAMI
FT                   RGTGVGVTRFKPKVHVTLWS"
FT   gene            543633..544793
FT                   /locus_tag="Mmcs_0488"
FT   CDS_pept        543633..544793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0488"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mbo:Mb0383c xanthine dehydrogenase accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06609"
FT                   /protein_id="ABG06609.1"
FT                   /translation="MRDVLSALSAVWRTGGTAGLATVVRTFRSAPRQPGAAMVVAPDGT
FT                   VTGSVSGGCVEGAVYELAGDVVGSGTPALQRYGVSDDDAFAVGLTCGGILDVFVEPVSP
FT                   ATFPDLDAVVEDIESHRPVALATVIAHPDAARVGRRLVVRSDEVSGTLGSSRADAAVTD
FT                   DARGLLATGRNEVLTYGPDGQRRGAGMEVFVAAYAPRPRMLVFGAIDFAAAVAQQGSFL
FT                   GYRVTVCDARPVFATAARFPTADEVVVDWPHRYLAAQVAAGDVDARTVICVLTHDPKFD
FT                   VPLLEVALRLPQVAYIGAMGSRRTHDDRLTRLRDAGLTDAELDRLASPIGLDLGARTPE
FT                   ETAVSIAAEIVAVRWGGTGRRLTDTDGRIHHDQGKDSEFSDRLTRY"
FT   gene            544851..545726
FT                   /locus_tag="Mmcs_0489"
FT   CDS_pept        544851..545726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0489"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding CO
FT                   dehydrogenase flavoprotein-like; KEGG: mtc:MT0390 carbon
FT                   monoxide dehydrogenase, medium subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06610"
FT                   /protein_id="ABG06610.1"
FT                   /translation="MQVPGPFEYERATSVDHAIGLLDRLGDGAMIVAGGHSLLPMMKLR
FT                   IANPEYLVDINDLTRELGYITVDARAVRIGAMTRHRQVLESAELAEVCPIFADAERMIA
FT                   DPVVRNRGTLGGSLCQADPAEDLTTVCQTLGAVCVARGPSGQREIPIDEFLEGPYETSL
FT                   SHNEILLEVRIPVRPNTSSAYTKVERRVGDWAVTAAGAMVTLEGDTITAARIGLTAVNP
FT                   DAAALAAVGAALVGRTADEDAFAEAGRQAADACAPDSDMRGSADYKRHLASELTVRNLR
FT                   TAVRRVRERA"
FT   gene            545729..546304
FT                   /locus_tag="Mmcs_0490"
FT   CDS_pept        545729..546304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0490"
FT                   /product="(2Fe-2S)-binding protein"
FT                   /note="PFAM: ferredoxin [2Fe-2S]-binding; KEGG: mbo:Mb0381c
FT                   probable carbon monoxyde dehydrogenase (small chain)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06611"
FT                   /protein_id="ABG06611.1"
FT                   /translation="MQVSMTVNGEQVSADVEPRMLLVHFLRDELRLTGTHWGCDTSNCG
FT                   TCVVSLDGEPVKSCTMLAVMADGHDVRTVEGLEVDGKLDPVQEGFMQCHGLQCGFCTPG
FT                   MMITARALLDRNPHPTEHEIREAISGQICRCTGYTTIVRSVQWAAGHARGRDVESGPSA
FT                   TDFAPQSQTDDTLGPVAGDHLIETGSPS"
FT   gene            546301..548691
FT                   /locus_tag="Mmcs_0491"
FT   CDS_pept        546301..548691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0491"
FT                   /product="carbon monoxide dehydrogenase, large subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: Carbon-monoxide dehydrogenase, large
FT                   subunit; PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding; KEGG: mtc:MT0388 carbon monoxide
FT                   dehydrogenase, large subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06612"
FT                   /protein_id="ABG06612.1"
FT                   /translation="MTAVDERPDAQADNDRKPCGYGRMLRKEDPRFVRGRGNYVDDVTL
FT                   PGMLHLAILRSPYAHARIANIDISAAEAHPKVKAVVTGADLAEKGLAWMPTLSNDVQAV
FT                   LATDKVRFQGQEVAFVVAEDRYSARDGVELIDVDYEPLDPVIDVRRALDPDAAVIRTDL
FT                   DGKTDNHCFDWETGDAAATDAAFAKADVVVKQEMVYPRVHPAPMETCGAVADLDPVSGK
FT                   LTLWSTTQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVGSLLL
FT                   GKPVKWMEDRSENLTSTGFARDYIMVGEIAATSDGKILAVRSNVLADHGAFNGVAAPTK
FT                   YPAGFFGVFTGSYDLEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCLAYE
FT                   MKMDPADLRLRNLLKPDQFPYHSKTGWTYDSGDYETTMRKAMDMIGYEQLRAEQAAKRE
FT                   RGELMGIGMAFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVVRLSVQTQGQGHE
FT                   TTFAQIVAEELGIPPDDIDVVHGDTDQTPFGLGTYGSRSTPVSGAAAALVARKVRDKAK
FT                   IIASGMLEASVADLEWDKGAFHVKGDPAASVTIQDIAMRAHGAGDLPEGIEGGLDAQIC
FT                   YNPENLTYPYGAYFCVVDVDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVDGIG
FT                   MALMEMIAFDEEGNCLGGSLMDYLIPTALEVPELETGHTVTPSPHHPIGAKGIGESATV
FT                   GSPPAVVNAVVDALAPFGIRHADLPLTPSRVWEAMQGRPTPPI"
FT   gene            548694..549464
FT                   /locus_tag="Mmcs_0492"
FT   CDS_pept        548694..549464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0492"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mtc:MT0387 xanthine dehydrogenase accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06613"
FT                   /protein_id="ABG06613.1"
FT                   /translation="MRSADTMHDRAQQLLQTRIPFVRATVVRAQQPTSAHPGDEAILLS
FT                   DGTIEGFIGGECAQSSVRKAALGALQANQSVLLRVLPDGDVHFPDAPGACVVVNPCLSG
FT                   GALEIFLVPQVPAPLVRICGDTPIAEALAQVCAVLGYEVTRSAGEPAGATAVVIASHGG
FT                   PEAEMIRAALDADVGYIGLVASRVRGAAVLEGLHLTAAERARVHTPVGLPIGARTAAEI
FT                   AVSIAAELIAAIRVDAAAPHPAEVGAAEDHHRCH"
FT   gene            549637..550341
FT                   /locus_tag="Mmcs_0493"
FT   CDS_pept        549637..550341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0493"
FT                   /product="putative oxidoreductase"
FT                   /note="KEGG: mbo:Mb0377c possible oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06614"
FT                   /protein_id="ABG06614.1"
FT                   /translation="MCGAPLIRLQCYEGLSAGEALYDWNYQRQLLSIRLAEARGDHITE
FT                   ADLYAEKYLADRPILRCVRHPGPTPPVLLIDEIDRADDEFEALLLEFLGESSVTVPEIG
FT                   TFVAAVPPIAVLTSNRSRDLHDALRRRCLYHWIDYPQPERAVAILRRTVPGATTALIEQ
FT                   AAQFVGAARELDLDKPPGIAETIDWVAALVTLGVAELVESVDTVLAGFSALAKTPDDRA
FT                   VLRDALVDHSWT"
FT   gene            550354..551022
FT                   /locus_tag="Mmcs_0494"
FT   CDS_pept        550354..551022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0494"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mtc:MT0384.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06615"
FT                   /protein_id="ABG06615.1"
FT                   /translation="MKIANEFTVGVPIEQAWDVLTDLEQVIPLMPGAAMTGRDGDDVMG
FT                   KVKVKVGPVTSEFNGKVHFVEQNRAEHRAVIDGRGKEARGTGNAAATVTAQLHPDGDRT
FT                   RVTVDTDLKIVGKLAQFGSGMLQQVSEKLLGQFVESLEAKLAGDATPPAAAQEVATPVA
FT                   GGDGDAPRPQVVPAPPAEAPPIDLLELAGGGAVKKYGPPAVGALLLLVLLLVALRRRRR
FT                   "
FT   gene            551019..552287
FT                   /locus_tag="Mmcs_0495"
FT   CDS_pept        551019..552287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0495"
FT                   /product="VWA containing CoxE-like protein"
FT                   /note="PFAM: VWA containing CoxE-like; SMART: von
FT                   Willebrand factor, type A; KEGG: mtc:MT0384 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06616"
FT                   /protein_id="ABG06616.1"
FT                   /translation="MSAPLLLRGVDLAAFAVALVARLRGGGVVVSASGSAEFVHAMRAL
FT                   RPGRRTELYWAARLTLVNRADDLETFDRVFEAVFADAVLGLDPPAMKHRSADPDPSRPV
FT                   ARPGQGPPEDVDGLPWVTRPTNIRAAAGSEGTITLPDVLPSGMTARADEPFDQFEPEDL
FT                   RLLGQWLEDAAPHWPRRRTLRRRPHPRGDRIDLRRTVRASRGTGWETIRLTRTRRRQRD
FT                   RRIVLVCDVSRSMQAYATVYLHLMRAVMMRRDRLRPEVFAFSTSLTRLTPVLSHRSPEL
FT                   ALARANETVADRYGGTHVGRSIGELVSGPHGAVLRGAVVIIASDGWDSDAPEVLVHALA
FT                   RVRRRAYRVVWLNPRAAHVDYRPLAGSMAAALPFCDEFMPAHSISGLRDLFEVLGESSA
FT                   SGDRPRAVVRGRSRPAARRRMPC"
FT   gene            552281..553135
FT                   /locus_tag="Mmcs_0496"
FT   CDS_pept        552281..553135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0496"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bps:BPSS0938
FT                   family S33 non-peptidase homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06617"
FT                   /protein_id="ABG06617.1"
FT                   /translation="MLSGMDQYRRDGLVFEVRDEGPADGPVVVLLHGFPQRNTSWDAII
FT                   ERLTAQGYRCLAPNQRGYSPGARPRRRRDYRIPELIADVGALIDASGAERVHLVGHDWG
FT                   AAVAWGVAAEMPERLATVVPVSVPHPAAFLKSIPTSRQGLASWYMYFFQLPYVPELLLT
FT                   RRRGALALGALRRTGQSEAAAERDVAAMLDPGALTAGLNWYRAMPFMDPRATGGKITVP
FT                   TMFVWSDRDSALLPKGAYDTARYVSGEYRFEIMSGASHWLPEERADELAALLLEWFAAH
FT                   PIT"
FT   gene            553165..554076
FT                   /locus_tag="Mmcs_0497"
FT   CDS_pept        553165..554076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0059 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06618"
FT                   /protein_id="ABG06618.1"
FT                   /translation="MSESSRPTIEFPARIGVWWASETWSITDAQDVAREIEALGYGSLF
FT                   IPEVTGKECLTQSAAFLSATDRLVIGTGIANIHIRLPSAAETGGRTLGALHPNRFVLGL
FT                   GVSHAPLVEHGMGGTYSKPLATMRGYLEKMAAVSEAIEPGAPRPTRLLAALGPKMIELS
FT                   GTHADGAHPYLVTPEQTRTTRDILGPDKWIVSEQAVAIGGDDADQLRRAHQHLEVYSGL
FT                   PNYRNSWLRQGFDESDLVRGGSDRLARGIVGMGSVDAAAASVTAHLDAGADHVVLQVLG
FT                   DDPMADPRPALRELAAALGLNG"
FT   gene            554153..555562
FT                   /locus_tag="Mmcs_0498"
FT   CDS_pept        554153..555562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0498"
FT                   /product="selenium-binding protein"
FT                   /note="PFAM: selenium-binding protein; KEGG: reu:Reut_B5039
FT                   56kDa selenium binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06619"
FT                   /protein_id="ABG06619.1"
FT                   /translation="MAHPSIDPTFYRTAADAAAAPGEQLAYVVAFDRAAHDHDAMTVVD
FT                   VNPGSERYGRVVGWTEVPGLGDELHHFGWNACSSALKHEGHDMHGLERRYLLVPGLRSS
FT                   RVHVFDTRPDPRNPTLVKTIDASTLSETAGYSRPHTLHCGPDGVFLTCLGGREGDDDGP
FT                   GGIALLDHATFDVLRAWETDRGPQHFHYDAWWHLNQNVLISSEWGSPSMIENGIVPELL
FT                   LGQKYGHAIHFWDLAKGEHRQRLDLGAQHQMVLEVRPSHDPEATWGFVGVVISTDDLSG
FT                   SVWRWFRDGDEWKAEKVITVPAEPADPDILPPALKPFAAVPPLISDIDLSVDDRFLYVS
FT                   CWGTGELKQFDVSDPANPKQVGSVRLGGIVDRAPHPAMPDTPLAGGPQMVEVSRDGKRV
FT                   YFTNSLYGAWDDQFYPDGVGAWMVKLDADPDGGMSIDESFFPHGEEFRGLRVHQIRLQG
FT                   GDASSDSYCYR"
FT   gene            complement(555553..556239)
FT                   /locus_tag="Mmcs_0499"
FT   CDS_pept        complement(555553..556239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0499"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sma:SAV1067 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06620"
FT                   /protein_id="ABG06620.1"
FT                   /translation="MNTENVVALVSGANRGLCRHFAEQLIARGAKVYAGARKPETVDLP
FT                   GAIPVQLDITDPESIRRAAEFAADVNVVINNAGVSTQSTLLDGSLDDIRLEMETHYFGT
FT                   LQVLRAFAPIIERNGGGAVLNVLSVLSWFHPPTSGAYSAAKAAAWALTDAVRTELAPKG
FT                   IHVAALHVGYMDTDMVSYIPADQKSDPGAIAELALDGLFAGENEILGDALTRDVKAALS
FT                   GAPRQR"
FT   gene            556326..557348
FT                   /locus_tag="Mmcs_0500"
FT   CDS_pept        556326..557348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0500"
FT                   /product="nitroalkane oxidase"
FT                   /EC_number="1.7.3.1"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   xft:PD0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06621"
FT                   /protein_id="ABG06621.1"
FT                   /translation="MTSPLSALGVRLPVIAAPMAGGATTTDMVVAAARAGSLGLLAAGY
FT                   KTPDALQAEIATVRAASIPFGVNVFAPNPVPIGIAAYRRYAALIQPEADRFGLTLPPDP
FT                   IDDDDAFGAKVDLLRADPVPIVSFTFGLPASDVIRALQKAGTTVVQTVTSPQEAEAAAA
FT                   AGVDMLAVQASVAGGHSGTFTPDRMDAPVVLTELVRAVVTRVGLPVIAAGGLATPADVT
FT                   AVLHAGAAAAAVGTVLLRADESGASATHRAALADPTRTETVITRAFTGRPARGLRNRFI
FT                   DRFEADAPLGYPAVHHLTSPLRKAAAAGGDADLVHLWAGTGYRHAAEKPTATILTELAS
FT                   "
FT   sig_peptide     556326..556394
FT                   /locus_tag="Mmcs_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.927) with cleavage site probability 0.748 at
FT                   residue 23"
FT   gene            complement(557345..558040)
FT                   /locus_tag="Mmcs_0501"
FT   CDS_pept        complement(557345..558040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0501"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: nfa:nfa53840 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06622"
FT                   /protein_id="ABG06622.1"
FT                   /translation="MTTTHLALMPDFLDPLVLLGYFGGWALVGLLVVIFVESGVLFPVL
FT                   PGDSLLFVAGMLAAGTAAVAESGGEPINFHLWQLLVFIPIAAILGGQVGYWIGRSVGTA
FT                   MFKPNARILKQRYLEEAHLFFEERGPFAIVIARFVPIVRTLAPLTAGAARMSYPVFALF
FT                   NILGAVVWGVGLTLLGYWLGRFEMVQKLLEPIVIAIVIVSVAPMLLEWYKRRKAAKRAG
FT                   IAAPPIEPA"
FT   gene            558128..559141
FT                   /locus_tag="Mmcs_0502"
FT   CDS_pept        558128..559141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0502"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: mpa:MAP1613c putative
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06623"
FT                   /protein_id="ABG06623.1"
FT                   /translation="MATHKAVHVAAAGEPLTLADVETPSPPPGHLRIDVAACGVCGTDH
FT                   GFVNGNFPGLSWPITLGHEIAGTVAELGDGVDEFAVGDRVAVGWFGGNCNKCIPCRRGL
FT                   FMQCVNMQVPSWHYPGGYAESVVVPATAPARIPDGLSFVEAAPMGCAGVTTFNGLRQTR
FT                   ARAGDLVAVLGIGGLGHLGVQFARAMGFETVAIARGAAKEDDARALGAHHYIDSTAGDV
FT                   AAALQKLGGAAVVLATAASSAAMGQTVGGLGPQGELIVVGVTPEQLPISPLDLINSGLS
FT                   VTGHPSGTARDVEETMHFAVLSGVRARVEEKPLAEAAEAYAAMDEGRARYRMVLTM"
FT   gene            559172..560209
FT                   /locus_tag="Mmcs_0503"
FT   CDS_pept        559172..560209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0503"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: mbo:Mb0370c probable fructose-bisphosphate
FT                   aldolase FBA; TIGRFAM: ketose-bisphosphate aldolases
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06624"
FT                   /protein_id="ABG06624.1"
FT                   /translation="MPIATPEVYAEMLDRAKKHSFAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFASGLGVKEMVTGAVALAEFAHVIAEKYPITVALHTDHCPKDKLDT
FT                   YVRPLLAISADRVAAGGNPLFQSHMWDGSAVPIDENLTIAQELLKQAAAAKIVLEVEIG
FT                   VVGGEEDGVEAEINDKLYTTSEDFEKTIDALGAGEHGRYLLAATFGNVHGVYKPGNVKL
FT                   KPEVLAEGQKVAAAKLGLDSDAQPFDFVFHGGSGSLKSEIEDSLRYGVVKMNVDTDTQY
FT                   AFTRPIAAHMFTNYDGVLKIDGEVGNKKVYDPRSYLKKAEAGMAERVIEACRDLHSEGR
FT                   SVTAD"
FT   gene            complement(560206..561039)
FT                   /locus_tag="Mmcs_0504"
FT   CDS_pept        complement(560206..561039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3863c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06625"
FT                   /protein_id="ABG06625.1"
FT                   /translation="MSNPRGPGQGDEPTEPSAAGGPGDQTGPDDATRPSPTADHEPATE
FT                   VIASSSPGADQFEPSEGERRFTAPSGFDAGSTQKIDPPPDPATEVFPRSEGGLPGSGTD
FT                   PFAAQKAAGPQVIPPRGDAPRPPQQGRRSWGWVVAVVLVIAALVAIAILGTILLTRGSG
FT                   STASQEDQVRATIEQFDVAIQNGDLATLRGITCGAKRDSYVNYDDKAWAETHKRVAAAK
FT                   QYPVVASIDQIVVNGDHAEANVTAFMAYAPQTRSTRSFDLEFRDDQWKICQAPSP"
FT   gene            561099..561554
FT                   /locus_tag="Mmcs_0505"
FT   CDS_pept        561099..561554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06626"
FT                   /protein_id="ABG06626.1"
FT                   /translation="MTARRDRHGTMLSMTRMGDLLGPDPVLLPGDPEAEAELEASENPA
FT                   IVAAAHPSASVAWAALAEEALADDKAVTAYAYARTGYHRGLDQLRRNGWKGFGPVPYRH
FT                   EPNRGFLRCVAALARAADTIGETDEYQRCLDLLDDCDPSARAEFGLS"
FT   gene            complement(561580..562476)
FT                   /locus_tag="Mmcs_0506"
FT   CDS_pept        complement(561580..562476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0506"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   mpa:MAP3865c obalt-zinc-cadmium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06627"
FT                   /protein_id="ABG06627.1"
FT                   /translation="MGAGHDHQHGTDTRVSRMLIAAAVLTAFFVLELVTALWIDSIALL
FT                   ADAGHMLTDLVAMFMGLTAVLLARRGSASPARTYGWHRAEVFTAVANAVLLLAMAVFIL
FT                   YEAVERLGDAPDVPGVPMIVVALAGLAANAVVVLLLRSHSKESLAVKGAYMEVVADTVG
FT                   SIGVLIAGIVTVTTSWPYADVVVAVFVALWVLPRAISLARAALRILSESSPAHIDVDEL
FT                   KTALCAVEGVTEVHDLHVWTLVPGKDVVTAHLTSARDSARVLDDARAVLAARGLDHATV
FT                   QVEPPGETDCNCESNDW"
FT   gene            complement(562533..563312)
FT                   /locus_tag="Mmcs_0507"
FT   CDS_pept        complement(562533..563312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0507"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mbo:Mb0366 probable
FT                   conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06628"
FT                   /protein_id="ABG06628.1"
FT                   /translation="MSIRPLRQSVRPSPVFLAVVAITVAGGALAWMAADTVAPLAYAGV
FT                   FVLVIAGWLVSLSLHEFGHAYTAFRFGDRDVEIRGYLTLNPLKYSHPMLSLGLPVLFIA
FT                   LGGIGLPGGAVYLRTSWMTARQKTLVSLAGPSANLVLAVLLLGSTRLLYDPAHGVFWAG
FT                   LAFLGFLQVTAFVLNMLPVPGLDGYGALEPHLSPDTQRALVPVKQWGFFILLILLLAPA
FT                   LNQWFFGAVYWLAELSGVPSALMSIGGQLTRFWSAWL"
FT   sig_peptide     complement(563220..563312)
FT                   /locus_tag="Mmcs_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.938 at
FT                   residue 31"
FT   gene            complement(563344..564072)
FT                   /locus_tag="Mmcs_0508"
FT   CDS_pept        complement(563344..564072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0508"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   sma:SAV6724 putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06629"
FT                   /protein_id="ABG06629.1"
FT                   /translation="MPDDFLLRPLDAPPAYAAVVERVRRAVALGVLLPGDRLPSERALA
FT                   EGLGVSRVTVREALRVLQGERLLITKRGNGGTVVAPTVARLGDDPGGVDYGRRLDEVFE
FT                   LRLAVESMAARLAARRGRPEGLRWLDSCQEALRASSDVHTFRRADSEFHLAVARLSGNS
FT                   MLSQVIEDARAAAFSRLDRQDFAVIYESSIRGHAAVIEAIRNADPDGAAAAMAAHIEEA
FT                   RDEVAAVLSTRESPEVRSAG"
FT   gene            564128..564805
FT                   /locus_tag="Mmcs_0509"
FT   CDS_pept        564128..564805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0509"
FT                   /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
FT                   /note="PFAM: glutamine amidotransferase class-I peptidase
FT                   C26; KEGG: sco:SCO1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06630"
FT                   /protein_id="ABG06630.1"
FT                   /translation="MNSEVTPLIGVCGLSVAARWGLWDQPAVLVAQTYLEAIHRAGGQP
FT                   LILPPSAHADTDLLLHTVDAIVLAGDGDIEAQRDDFELDIAAAALSEAVPVLGVCRGLQ
FT                   ALNVAAGGTVRRRFGHHHTAETTSHTVDVAVDSLLGEAGYAGVREVTSRHRQGLATVGD
FT                   GGKVTAASVPDGAIEAVEWPDHPFALGVHWHPEDPLMHELFRALISAATAPLFNTSTLP
FT                   VQP"
FT   gene            564846..566051
FT                   /locus_tag="Mmcs_0510"
FT   CDS_pept        564846..566051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0510"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gka:GKP30 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06631"
FT                   /protein_id="ABG06631.1"
FT                   /translation="MTIDNISTIAPFGNHLPVRITFGEGSAHRLPDLLRDAGAQRVLVL
FT                   TDQGIEHHNPAVAAVLTTLSTSGLTVSRLDKAPGEPTIEMVDAATARMTSESVDAIVAL
FT                   GGGSVIDTAKAARLCHQQGLTFGEFLDSARTYPAPAVPLIAVPTTAGTGSEVSGGAVVS
FT                   DPQAGRKAGIAHPNMRAQYAVVDPVLTWSMPPVMTANTGIDALAQAMAAVIAKVRTPIG
FT                   DAIALEAVRLMGHSLPAAYRDGADAAARAGMACGSMMAGLAMNISDCAAEHSLGQAIGG
FT                   LSGAPHGLTIGLVLAETLERERHHVPDRMERIADAWGLPADGTADGSRLVGAVRRLLSD
FT                   LQFPVLSDLGLGAEHLDRLTDLALSDYFITMAPQPWDRAEVHQAFARALATRDRGLVTA
FT                   AG"
FT   gene            566059..567705
FT                   /locus_tag="Mmcs_0511"
FT   CDS_pept        566059..567705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0511"
FT                   /product="cyclohexanone monooxygenase"
FT                   /note="KEGG: bja:blr2938 cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06632"
FT                   /protein_id="ABG06632.1"
FT                   /translation="MSAQQDSPDRFDVVIVGAGFAGLYMLHRVRALGLTARIVERGEDV
FT                   GGTWYWNRYPGARCDIESIDYAYSFDETLTREWRWTERYAAQPEILSYIGHVADRFDLR
FT                   DDITFGTTVRRADWDDDTAQWTLVCDTGQVLRATFCVMATGCLSVAKQPEFPGLSQFRG
FT                   RWYHTGRWPHDPVDFTGRRVAVIGTGSSGIQAIPRIAEAAEQLFVLQRTPNYSMPAQNR
FT                   PLAADEFDSAIADFATRRRICQRSDAGVPHPPPTQGTFDVTAEERERRYEEGWQRGGIN
FT                   ALSAAFTDFFTDEDANRMAQEFARNKIRSIVEDAQTAELLCPQHHIGTKRTCVDTGYFQ
FT                   TYNRDNVELVNSRAEPIDQITATGIRLVGGRHLDVDTLVFAIGFDAITGALTDIDIRGT
FT                   GGAALRDEWDDGPRTLLGLQTAGFPNLFMVTGPGSPSVLSNMLVSIEQHVDWIADCLLH
FT                   LRKLGHDRIEATRDAQDRWMEHIGELAAETLYPQANSWYLGANIPGKARTFMPYVAGCG
FT                   EYRRECDEVVASGYSGFLLGRPSPVREGTSA"
FT   gene            567702..569102
FT                   /locus_tag="Mmcs_0512"
FT   CDS_pept        567702..569102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0512"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   sma:SAV6725 putative glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06633"
FT                   /protein_id="ABG06633.1"
FT                   /translation="MIDARTAPTASEVLARLHAEDIATVILGGTDTHGVMRGKRVPISQ
FT                   LPRMLEHGMPMCDVFWVMHVDESDLVARPDGYRGYFPTERQGYPDILAVPDLTTLRIVP
FT                   WHNDTALLLCDWELPADHRPVPIAPRSVLRRVVERADAMGYQPLSALELEFYLLREKAG
FT                   TTHRKRADELVPLQEAPSTYGVVMGSLQEDIGALIRRHMLDYGLPVEACNPETGPGQFE
FT                   ITLRYGNSLKSADDAFLFKSAVKEVAAQNDLLATFMAKPVTDWAGNSCHVHLSLRDIAG
FT                   GGVFFDQDAPDQLSTALRHFAGGILHTMREFTALMAPTPNSYRRFVPYSWAGTTATWGV
FT                   DNRSVGLRVIREGDHGTRVEHRQPGGDANPYLATAAALAGGLHGLLNEIEPRELSTTDI
FT                   YSQPSEDLPVLPATLAEAVDLLADSAAAREWFGDDFVDHYVLMKRAEIAAQSVAVTDWE
FT                   VARYLEAM"
FT   gene            569127..570605
FT                   /locus_tag="Mmcs_0513"
FT   CDS_pept        569127..570605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0513"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   sto:ST0150 hypothetical protein; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06634"
FT                   /protein_id="ABG06634.1"
FT                   /translation="MADSSETRSYGDVGSAPHGELTPEQERGLRRGAINWRQVAVLSVA
FT                   GCGPASVIALNLQFMGQFAGAALVLAFVLVWPGILLLVNTFAEFSKRLPTSGGLYTWNS
FT                   KAWGPNVGFVYGWTFIGAYLVFSAAGFAVFGGWVQEWLQTQFGISVPWWLFTFAALAYV
FT                   CVLAYLGITQSLHAALGLLAFEIIVLLALAAWIFITGPQSGSGFGVAPFQVSSAGALAL
FT                   GGVGLAMTYGVLSHVGIEEGATLGQEVKDPKRQIPRGLWVAAVVVPVFYIVVAYAMVYG
FT                   YGIDDMTAFGEDPAPLQTIAQTYWGQVGLTVIVLATLSSILAFSQTAFLAGARVLYTLG
FT                   REGVLPTRLGAVSRRQTPAVGIAVMGVLSMLLGVPLAFLVGPFNVWGYFGFLISIAFLV
FT                   SYIFTNIGLVRYMLRIGVFHWFRHGVLGALGSLVFLYPLYKTVWPLQTGIYGALPFVYL
FT                   AWIVLGIGLLIYTLRRRPEVMSRIGTSLADDDVS"
FT   gene            complement(570598..571224)
FT                   /locus_tag="Mmcs_0514"
FT   CDS_pept        complement(570598..571224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3867c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06635"
FT                   /protein_id="ABG06635.1"
FT                   /translation="MSARDRAAGGGDGMVVLRFGGHRAPRGLTGLDTVDVTGAPDVDAA
FT                   AAGARRLVVVGSDADLATVLTRLMRTERLGVELAAARGLFPARTALSGTARRVPLIRDD
FT                   AGIALVGSAQWRGTEGALFGEAVVDDTTLFSGEVAGVRIEPTAEMPGLRAAVLSGRGRP
FT                   QRWVAGRAAQLGTTGARVVRDGVEGTREVKRSTFYRHTEGWLRVS"
FT   gene            571296..572591
FT                   /locus_tag="Mmcs_0515"
FT   CDS_pept        571296..572591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0515"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: mpa:MAP3869
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06636"
FT                   /db_xref="GOA:Q1BEP8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEP8"
FT                   /protein_id="ABG06636.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGILTPGVTNVIGNGVVVDPGVLLTELRGLEERGVDTERLLISADAH
FT                   LLMPYHVAIDKVVERYAGSKKIGTTGRGIGPCYQDKIARQGIRVADVLDPAVLAEKIEG
FT                   ALELKNQVLVKIYNRKALEPAEVVENLLEQAEGFKHRIADARLLLNQALERDEIVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGAYLAKTGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLET
FT                   VPICVGYTIDGKRTDEMPMTQSDIARAEPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEELAGAHVSCIGVGPGRDQTIVRRDVLAPS"
FT   gene            572588..573235
FT                   /locus_tag="Mmcs_0516"
FT   CDS_pept        572588..573235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0516"
FT                   /product="thioesterase superfamily"
FT                   /note="PFAM: thioesterase superfamily; KEGG: mpa:MAP3870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06637"
FT                   /protein_id="ABG06637.1"
FT                   /translation="MSSDYGLDPRRVDPEYDRHGGFPVFEAAEPGPGFERFLTAMRRAQ
FT                   DLAVSVNPDPDTWDEAADRVEELVKLLDPYRAGEGVGPANRVPTLPGAGSLLMPPWRVI
FT                   KFESDGVELEVAFSRYHVGGNSAVHGGVLPLMFDSMFGMVIHATGRPISRTAFLHVDYR
FT                   RVTPIDSVLTARGWLREAEGRKAFVNAELLDADGNVLAEANGLMIRLLPGQP"
FT   gene            573344..573988
FT                   /locus_tag="Mmcs_0517"
FT   CDS_pept        573344..573988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06638"
FT                   /protein_id="ABG06638.1"
FT                   /translation="MSTPRAAALAGVVFALLFGAALILIRTSLPEGAEPGSQWIDGGSD
FT                   RLQVAAVLMPFAGIAFLWFIGVIRDGFGRYEDKFFATVFLGSGLLFLAMMFVAAGVGAG
FT                   LESMSGHPAESVSGVALLGQTVLLSISKTYALRMAAVFMMSLATIWLRTGLMPRPLVYV
FT                   TYLVAVALIVAAEVSMWLVLTFPAWVLVVSALIYSREVTPRPPAAPSPDTA"
FT   sig_peptide     573344..573445
FT                   /locus_tag="Mmcs_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.474 at
FT                   residue 34"
FT   gene            complement(574144..575364)
FT                   /locus_tag="Mmcs_0518"
FT   CDS_pept        complement(574144..575364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0518"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: fra:Francci3_1599
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06639"
FT                   /protein_id="ABG06639.1"
FT                   /translation="MTGTTGASTAPPLPPLHMRRTGFDPTDELRDIRESAGVRLTQNAF
FT                   GMDVYLVTRHDDVKAVLADHTRFSNTRPPGFAGAGSPISDAEQARAQAGNLLANDPPEH
FT                   QRLRRMLTPEFTLRRINRLEPRIVAIVDEHLDAMQQSGPPADLVAGFALPIPSLVICEL
FT                   LGVPYADREDFQRRSARQLDLSLPIPERLDLARQAREYMHTLVGRARRTPGDDILGMLV
FT                   REHGDELTDDELVGIAGLLLLAGHETTSNMLGLGVLALLRHPEQLAAVRDDPDAVGPAV
FT                   EELLRWLSIVHSGIPRITTTDVEVAGVLIPKGQLVFVSLPSANRDPSFLDAPETFDIRR
FT                   GAPGHLAFGHGVHHCLGAPLARMEMRIAFPALLRRFPTLTLAEPFEDVEFRSFHFIYGL
FT                   RSLLVGW"
FT   gene            complement(575401..577425)
FT                   /locus_tag="Mmcs_0519"
FT   CDS_pept        complement(575401..577425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0519"
FT                   /product="MMPL"
FT                   /note="PFAM: MMPL; KEGG: mpa:MAP3080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06640"
FT                   /protein_id="ABG06640.1"
FT                   /translation="MAGRFSWVVALLVVLVSGGLMGVLSGGESSSQSPVSVPTDAESAK
FT                   VNALRSEFPGGDQAPAILVVTRTDGAALSPADIAATEAARGRMLDAAQSAPAGPPVIVS
FT                   EDDKAAIATVPLATDLSGFGLNDAVKGLREAAADGLPGDLRAEVTGGPAFGADIANSFS
FT                   GANVTLLAVTAAVVALLLIVTYRSPVLFLVPLLVIGFADRVAAVVGTAIAEAVGMSPDG
FT                   STSGITSVLVFGAGTNYALLLISRYREELGRNGDHREALAVAVRAAGPAILASNATVVL
FT                   ALLTLVFASAPSTRALGVQAAAGLVVAAVFVLLVLPALLRLFGKKLFWPLIPKEGAAPL
FT                   TDSGLWHRIAAGVSRRPAVVAVASIGALAVLCTGLLFTPIGLTQTEQFRVQAESVTGYE
FT                   TLADHFPSGLTDPTRVIGPSDKTAELQRAISETPGVVSADPAGTSPTGLTQWSVVLSAE
FT                   PASDEAFSTVDALRENVRGVDSSALVGGSDAQARDISSAASRDRMVVIPTILAVVLVVL
FT                   YVLLRSALAPLILVAVTVLSALAALGLGGWASVHLFGFPALDDTTPLFAFLFLVALGVD
FT                   YTIFLVTRAREETPDHGTRQGIVRAVSATGAVITSAGIVLAAVFCVLGVLPLIVLTQLG
FT                   IIVGLGILLDTFLVRTVIIPALFTLIGPKIWWPALRASP"
FT   sig_peptide     complement(577345..577425)
FT                   /locus_tag="Mmcs_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.476 at
FT                   residue 27"
FT   gene            577484..577957
FT                   /locus_tag="Mmcs_0520"
FT   CDS_pept        577484..577957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0520"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mpa:MAP3077
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06641"
FT                   /protein_id="ABG06641.1"
FT                   /translation="MADADRAALEALIAADVRALSAESEHIGRVFAARHSLSANDFRAL
FT                   LHIMVAETAGRPLTAGDLRRQMGMSGAAITYLVERMITSGHLRRDSDPADRRKVILRVA
FT                   EHGMGVAGQFFAPLAEHTTRAMVDMPDDDIAVAHRTLTALIDAMAAFRRDLGD"
FT   gene            complement(577969..579570)
FT                   /locus_tag="Mmcs_0521"
FT   CDS_pept        complement(577969..579570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0521"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: sma:SAV3010 putative sodium/proton
FT                   antiporter; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06642"
FT                   /protein_id="ABG06642.1"
FT                   /translation="MSASLLAVLVVAVLLAAVARRADVSAPLALVVAGLAVGLIPGVPD
FT                   IQLDPDLVLYVVLPPLLWSAGLESSYVALRRNVRSIGMLAVGLPLATTFAVGVVAYWAV
FT                   PELTIAAALTLGAIVAPPDAVSATAVGRRLGLPRRLMTLLGGESLLNDATALTAYKVAL
FT                   GLAIGGSASWTGGLWTFALAAVGGVVGGGALGAVIVYVRSRLRDPLVESALGLVAPFGI
FT                   YLLAEEVHGSGVLAVVVAALILGQHSTNASYATRLQDSAVWKAVQLLLESFAFLLIGLQ
FT                   LPKVIEELAGISAAVLVVSSLAVLATVIAVRIVWVYLFAYLPRLVSPALRYREPSPRPA
FT                   QVFVVAWAGMRGVVSLAAAFAVPATTLSGAEFPGRPQLVFLTFVVVVGTLLLHGLTLPW
FT                   LIRRLGVQGDEAHTDAVAAAAAQDRAARAAAERLDELLEQQRTDGTVDDVHERAAEVLR
FT                   GWNTRRRNSAWEQLGRDEADIGESPAAAFRRLRLEMLAAERATLIAERDSGHIDDEVLR
FT                   SVLHGLDLEEATLNRR"
FT   sig_peptide     complement(579502..579570)
FT                   /locus_tag="Mmcs_0521"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.929 at
FT                   residue 23"
FT   gene            579636..579965
FT                   /locus_tag="Mmcs_0522"
FT   CDS_pept        579636..579965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0522"
FT                   /product="Zinc finger, UBP-type"
FT                   /note="SMART: Zinc finger, UBP-type; KEGG: ade:Adeh_0986
FT                   zinc finger, UBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06643"
FT                   /protein_id="ABG06643.1"
FT                   /translation="MRSRARRATGRTQDTAAPRTCEHLASTSPEAVNADPRPNTPGRCE
FT                   DCAELGEATWAHLRMCLTCGHVGCCDSSPHQHATEHFHQTGHPVMRSAEPGESWRWCYI
FT                   DLRVG"
FT   gene            579988..581274
FT                   /locus_tag="Mmcs_0523"
FT   CDS_pept        579988..581274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0523"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase-like,
FT                   ATP-grasp; KEGG: mtc:MT0401 phosphoribosylglycinamide
FT                   formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06644"
FT                   /protein_id="ABG06644.1"
FT                   /translation="MTEPTDADTPVTDPEVAVPQVAPAAPDAPAEPAAPRNTVLLLGAG
FT                   ELSRELALAFQRLGAFVVAVDRYADAPAHGVADRSAVVRLTDTEAVTALIEREKPRYVV
FT                   AQSGAIAADALIAVAERGGVDVFPTPRSTRLGQDREGLRRLASDELGLPTAPFWFAGSA
FT                   EELGTVAQHAGFPLVVKPISGAPGEGQSVLLRAEDVEPAWHRAVAAGRITHNRVMAETV
FT                   VEVDYEVTLLTVRSTGATGPTLTFCEPIGHRPGDGDALESWQPQQMTPAALDAAKSIAA
FT                   RMVNSLGGRGVFAVELLVRGDEVYFSDVRTRLQDTGLVTVRSQRLSQFELHARAILGLA
FT                   VDTIMISPGAAEVRYAGTETSVSEPSGADIAAVVADALATQESDVRLFGRPDETDGRRR
FT                   LGVALATAPDVIIARDRARRVGAALRRLW"
FT   gene            581278..581736
FT                   /locus_tag="Mmcs_0524"
FT   CDS_pept        581278..581736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06645"
FT                   /protein_id="ABG06645.1"
FT                   /translation="MSAESDPDTGRPSDRPTAAPFMIALVIIVLVVIGIWLVNLFEGDE
FT                   PTPEQLIGRVAAAQNDALQREDYRAFQAYTCRAEHATESEVLERQRNSSAEQGARFIDG
FT                   VSDVVVDGDRATATVTYHFDRSEDDKFGVPTTFVQEDGAWKVCSTGSG"
FT   gene            581756..582169
FT                   /locus_tag="Mmcs_0525"
FT   CDS_pept        581756..582169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0525"
FT                   /product="Rhodanese-like protein"
FT                   /note="SMART: Rhodanese-like; KEGG: mbo:Mb0396 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06646"
FT                   /protein_id="ABG06646.1"
FT                   /translation="MSYAGDITPEQAWQLLDDDPNAVLVDVRTDAEWRFVGVPDLSPLS
FT                   RDAVFIEWNRTDGTRNDGFVDDLKAAGITPGERPVVFLCRSGNRSIGAAEAATEAGIGP
FT                   SYNILDGFEGDLDEQKHRGRTGWKAVGLPWKQS"
FT   gene            582166..583404
FT                   /locus_tag="Mmcs_0526"
FT   CDS_pept        582166..583404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0526"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: mbo:Mb0397 O-succinylhomoserine sulfhydrylase;
FT                   TIGRFAM: O-succinylhomoserine sulfhydrylase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06647"
FT                   /protein_id="ABG06647.1"
FT                   /translation="MSSEVPSRTQGADKPSVRRPAELPEGVGQATIGVRGGLLRSGFEE
FT                   TAEALYLTSGYVYASAAEAEKAFTGEIDRYVYSRYGNPTISMFEERLRLIEGAPACFAT
FT                   ATGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVETVFVDGDDLSQWEE
FT                   ALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDV
FT                   VVYSGTKHIDGQGRVLGGAILGSQEYIDGPVQKLMRHTGPAISAFNAWTLLKGLETLAV
FT                   RVDYSNRSAERIAEFLEGHSSVSWVKYPFLESHPQYDLAKRQMRGGGTVVTFELAGGKE
FT                   RAFEVLDKLQIIDISNNLGDAKSLITHPATTTHRAMGPEGRAAIGLGDGVVRVSVGLED
FT                   TDDLIRDLDRALG"
FT   gene            583405..583815
FT                   /locus_tag="Mmcs_0527"
FT   CDS_pept        583405..583815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06648"
FT                   /protein_id="ABG06648.1"
FT                   /translation="MSRRSEAKKARRRKRQAAQNVAWVPEAVVEQLSTIEDAIVADLAA
FT                   FDERITERGWTFDEQESDDDYAIWFYEPSGAEVSDGLPVTSLWLDAAEDGEVVRVVLVG
FT                   TTEQHGFTHDELDQHLDAIESYRNGDPVPDFD"
FT   gene            complement(583903..584766)
FT                   /locus_tag="Mmcs_0528"
FT   CDS_pept        complement(583903..584766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0528"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nfa:nfa21990 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06649"
FT                   /protein_id="ABG06649.1"
FT                   /translation="MDNIRGKTIAITGAARGIGYATAKALLARGARVVIGDRDVALQES
FT                   AVAQLTKLGPVSGYPLDVTDRESFATFLDKARTDGGGHIDVLINNAGVMPIGPFLEQSE
FT                   QAIRSSIEVNLYGVIAGCQLALPDMVARGRGHIINIASLSGVIPVPGQVVYVGAKFGVV
FT                   GLSAALADEVAPHGVHVSVVMPPFTRTELISGTKESGAIKPVEPEDIAAAIVKTLDKPK
FT                   THVSVPPALRFTAQAAQLLGPRGRRWLNKKLGLDNVFLDFDTAKRKSYEDRAQTALGVV
FT                   ESGDRT"
FT   gene            584825..585319
FT                   /locus_tag="Mmcs_0529"
FT   CDS_pept        584825..585319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0529"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mpa:MAP3882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06650"
FT                   /protein_id="ABG06650.1"
FT                   /translation="MIDDLRFVAVDQTDPLAEPLLGELAVEYADRYEGRAGAVLAWLRR
FT                   YPAAEFTPPDGAMLIGLLGDTPVTGGAFRRFGVVDGVPTAELKRIWTDSAHRRRGFGRA
FT                   LLAVLEQEIAARGYRRIYLTTGDRQPEAEALYLATGYQRLAEPLLAEGEVYPVAFAKLL
FT                   Q"
FT   gene            585340..585648
FT                   /locus_tag="Mmcs_0530"
FT   CDS_pept        585340..585648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06651"
FT                   /protein_id="ABG06651.1"
FT                   /translation="MPLAAGVSQAAVGWLILLAAAAIAAGGVMLRAFIGRRADRHLLGR
FT                   LTRRMRGTALARVLFGPVQHDALDPDELDQMILMPTIVVACGLCLTAVFLLGYRILT"
FT   sig_peptide     585340..585414
FT                   /locus_tag="Mmcs_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.902 at
FT                   residue 25"
FT   gene            complement(585645..586373)
FT                   /locus_tag="Mmcs_0531"
FT   CDS_pept        complement(585645..586373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0531"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: mpa:MAP3883c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06652"
FT                   /protein_id="ABG06652.1"
FT                   /translation="MAAALTAVTDRVHLARTDLVNWTLVTDGDGVLLIDAGYPGHRDDV
FT                   VDSVRRLGFGIDDIRAILLTHAHIDHFGSAIWFAETHGVPVYTHADEVGHARRDYLEQV
FT                   SPLAVARHAWRPRWLKWSLTISGKGGTHRGGIPTAQALTDEIAATLPGTPAAVPTPGHT
FT                   GGHCSYVVDGVLVSGDALVTGHPLLSDTRPQLLPDLFNHDQARCVASLAALAALDTEVL
FT                   LPGHGPLWRGPIREAAQAAR"
FT   gene            586437..587447
FT                   /locus_tag="Mmcs_0532"
FT   CDS_pept        586437..587447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0532"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: mpa:MAP3884
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06653"
FT                   /protein_id="ABG06653.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEEHGMDSATVSDHFQPWR
FT                   HEGGHAPFSLAWMTAVGERTKRLQLGTSVLTPTFRYNPAVIAQAFATMACLYPDRIFLG
FT                   VGTGEALNEIATGYEGDWPDFKERFARLRESVRLMRELWLGDRVDFDGEYYRTKGASIY
FT                   DVPEGGVPVYIAAGGPVVAKYAGRAGDGFICTSGKGEELYKDKLLPAVAEGADAAGKNV
FT                   DDVDKMIEIKISYDTDPELALENTRFWAPLSLTAEQKHSIDDPIEMEKAADELPIEQVA
FT                   KRWIVASDPDEAVEKVKDYVGWGLNHLVFHAPGHDQRRFLELFKRDLEPRLRKLG"
FT   gene            complement(587451..589103)
FT                   /locus_tag="Mmcs_0533"
FT   CDS_pept        complement(587451..589103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06654"
FT                   /protein_id="ABG06654.1"
FT                   /translation="MTGCAPRRSWGVALFAVLSALYFTVGAVLVLRFNMFDPDSPSRVA
FT                   NAGYVLMSRQPHLSAIGFVWNPLPSLVEIPVLTLADWWPALKTHGLAGVVQSALFMAGA
FT                   AVMVRRIALDRGVGTVWRWLAVGCFALHPMIVTYGASGMSEAAETFALVWCVRHLMQWA
FT                   HSHRVGDLAWAGIALGVGYLSRYEAVPAACGAALLVAVVAFHRAQRGQRVNSVILNVLI
FT                   VMFPLISSFAIWALTGWVVSGELFATLSSQYGNDSQVAAAMDRASPLAGAASDDWVVIA
FT                   ARLLGMQPFVLIATAGAVAFAVLRRNATALVPVATLGPVLAFAAWGQFTSTTFGWFRFY
FT                   LLAIPLVICVALAFWQPGARRAVTVARSDVRAGRVGAGLLCASLVIGIPVTVTAMSDER
FT                   IGNQQLQFGLKSLTDPQRYPPTEQWYRRLMVNDRALAAYFDRKRLPEGAVLMDTFNTWG
FT                   VWLGSQRPKQFVITSDYDFTATLNRPWDFGVQYLVASNPGISNADALNIRYPTLWHDGA
FT                   GLGTLVHSVYGATGDERFRVYRVTGRPAPPTAG"
FT   gene            complement(589100..591022)
FT                   /locus_tag="Mmcs_0534"
FT   CDS_pept        complement(589100..591022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cef:CE0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06655"
FT                   /protein_id="ABG06655.1"
FT                   /translation="MKVLTRAVTAVAVAGLALGVSGPPVALADPANTVVAGLGAAGQIR
FT                   WESLGVSERLDLIGENQPVDVSIPVPAGVRPGRLTGQVGSVVNVADGRIEVMDGRDSIL
FT                   GSFPVPREAESKPFSVNVSGAEIVDGTATLRFVLRDRGPVADSCSQPPSLSLTQLGNSF
FT                   TGPTPNPRTVSDFLPGYLDEIVIRVGPSPTPAEQQAALTLVAELTRLYRPMPVRIDLDT
FT                   SGAPSAKGAPGRRVIEISEGGKAAMAVKNPGTQAAVLAIGGTGEELTRQVDLFADRRFT
FT                   LAQTDSAATLYATPNRAESTDIKTFAQLGMTGEASVLGTTTLYAGFDVARFAVGPITGA
FT                   RVHLKARYTPVVGGEASILVRSGSTVLATRRLDESGVLDLTGDIPAESVTSNVGMALEL
FT                   RYVPDQECAPMNDRMTFALDPQSTVTVIPGVHNRGGFPVLPMAFTPDFDVAVDSPGHLR
FT                   YAAQAINLMGQQSSETLRPRITTFDAAVGSGTGLLAVGGGTELADAAMPAPVLPGAPNT
FT                   FGISGSPETDVDLSGPLGVVQVFTHNARTVLSITGTGDWALVDDTFNHIRGLPNRWASL
FT                   TGDVVATGAAHQTVNLTVREGGALINEYPGDPWKWWAVLSSAVGVAVAIAAVVIVLMRR
FT                   RRRAR"
FT   sig_peptide     complement(590936..591022)
FT                   /locus_tag="Mmcs_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            complement(591048..592301)
FT                   /locus_tag="Mmcs_0535"
FT   CDS_pept        complement(591048..592301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06656"
FT                   /protein_id="ABG06656.1"
FT                   /translation="MITGVVAFTYLVSTVDRNYLLFKGLRMSSLVTVSAEEARAVPDDD
FT                   LPVYTVLLPVYDEPTIVTNLINGVGRLDYPPDKLEILLLIEEDDIATQEALLGADLQSA
FT                   RIVIVPHSLPKTKPKACNYGMSLPDLRGEYLTIYDAEDIPDPLQLRRAVAAFRRLPVEI
FT                   GCLQARLGYFNERQNLLTRFFSLEYDQWFGVVLPAVENAGCVVPLGGTSNHMSVRVWRQ
FT                   IGGWDEFNVTEDADLGVRLARHGYRTLILDSITLEEANSDVVNWIRQRSRWYKGYLQTM
FT                   LVHLRAPVRLRRELGTKGFLRLINMTGGVPMTSALNVIFWFTLFVWVLGRPDAIGPLFP
FT                   PVTYYVCLLLLLICAPLSVFAGLIVTAALGKPQLWWAALLAPLYWMLQSVAAVKAIYQL
FT                   FARPSFWEKTVHGLSPSA"
FT   gene            complement(592298..593821)
FT                   /locus_tag="Mmcs_0536"
FT   CDS_pept        complement(592298..593821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0536"
FT                   /product="LigA"
FT                   /note="KEGG: ade:Adeh_0244 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06657"
FT                   /protein_id="ABG06657.1"
FT                   /translation="MDRSPVGRRGGRDRRGVRRRVRGRRRRVGGRIAHPAPRGTARSDR
FT                   ADRHGLPDTAAGRGRHRVELDHRPDGGRSRARRDRTSRKPASDPRRALASAGFRCDRLV
FT                   RRPARGAVRRAACRADVAVVDLRGEFRQPASVDPGDRRRRRVGRRGRGTRGRRRGRRRV
FT                   PGLPGGSPIPADARGVGVPGRRDRIHRHGRAASAVARDRAVRRGRAARRRDAAVPPSCC
FT                   TVRPDGVGGASPHFGAVGHRTRRHGRCPRRVEPGHGASGAAAHRRGRLDQRGRVDLLVV
FT                   VRFHQPLRRPGRHVRALPPLGAFGIVGAGRRRHHRPGPCGAGRDRRPDVVPHLTAGELP
FT                   PGPHRIRVARRRADRAHECGCRPRRQEHRLGGDRLGVAGRERLSASHHRRGPVADRWPS
FT                   AARALTGERARRVTAARTVGGPATTGRRRRRRRHRAAGCRRAGGRAQRRRHRPSGGWSD
FT                   DRCMTRPAPCCRRTCRRAACSGHEPWRSSPRYSPRSRRSSGRGLRSSRR"
FT   gene            594117..596231
FT                   /locus_tag="Mmcs_0537"
FT   CDS_pept        594117..596231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0537"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: mbo:Mb0416 probable phosphate
FT                   acetyltransferase PTA (phosphotransacetylase); TIGRFAM:
FT                   phosphate acetyltransferase; PFAM: phosphate acetyl/butaryl
FT                   transferase DRTGG"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06658"
FT                   /protein_id="ABG06658.1"
FT                   /translation="MSLMRQAVRVPDQTDSRVSAIYVASPEGDTGKSTIALGLLDRLTA
FT                   TAPRVGVFRPITRSGPARDYILELLLAHSTAGLTYEDSVGVTYHQLHEDPDSALADIVD
FT                   RFHRVADRCDVVLIVGSDYTDVASPSELSMNARIAANLGAPVVLAVKARGRTPDDVVQV
FT                   VEVCLDEIAAQHAYTAAVVANRCDPDQLTEVREALKRDGAPQVYVLPEEPLLVAPSVAE
FT                   LRDAVDGSMVSGDESLLDREALDVLVAGMTAEHVLERLTEGVTVVTPGDRSDVVLAVVS
FT                   AHAAEGFPSLSSIILNGGLELHPSIAKLVAGLGLRLPIVATGYGTFETASRVAGTRGRV
FT                   TAASVRKIDTALTLMETHVDTAELLSRLAIPIPTVVTPQMFTYQLLDQARSDRKRIVLP
FT                   EGDDDRILKAAGRLLQRGVADLTILGEEGPVRARAAELGVDLAAATVLDPRTSELCDQF
FT                   AEQYAELRRHKGVTVEQAREIIHDVSYFGTMLVHNDMVDGMVSGAAHTTAHTVRPAFEI
FT                   IKTLPDVSTVSSIFLMCLADRVLAYGDCAIVPDPTAEQLADIAISSARTAAQFGIEPRV
FT                   AMLSYSTGTSGTGADVEKVREATDLVHKREPDLLVEGPIQYDAAVEPSVAKTKMPDSPV
FT                   AGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLNKPVNDLSRGALVEDIVNTVA
FT                   ITAIQAQGDR"
FT   gene            596228..597427
FT                   /locus_tag="Mmcs_0538"
FT   CDS_pept        596228..597427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0538"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: mbo:Mb0417 acetate/propionate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06659"
FT                   /db_xref="GOA:Q1BEM5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEM5"
FT                   /protein_id="ABG06659.1"
FT                   /translation="MTRTVLVLNSGSSSLKFQLLEPDSGASLADGIVERIGEDSSSASL
FT                   VCGEREVTHSERVPDHEAALRTAYGLFDEAGAELGSVGLVAVGHRVVHGGPDLYQPTLI
FT                   DDALVDTLESLAPLAPLHNPPAVLGIRGARKAFPDLPHVAVFDTAYFHDLPVAAATYAI
FT                   DRDLSEQWHIRRYGFHGTSHQYVSEQAALFLDVPLSSLSQIVLHLGNGASASAILGGRP
FT                   IDTSMGLTPMEGLVMGTRSGDVDPGVLVYLWRTAGMSVDEIETMLNKRSGVRGLGGEID
FT                   FRVLHQRIESGDESDRENAQLAYDVYIHRLRKYIGAYLALLGSTDVIVFTAGVGENDAA
FT                   VRRDALSGMGRLGIELDEHLNESPSHTARRISAETSPTTVLVIPTNEELAIARACVEVI
FT                   "
FT   gene            597534..598208
FT                   /locus_tag="Mmcs_0539"
FT   CDS_pept        597534..598208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0539"
FT                   /product="asparagine synthase (glutamine-hydrolyzing),
FT                   putative"
FT                   /note="KEGG: dvu:DVUA0073 asparagine synthase
FT                   (glutamine-hydrolyzing), putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06660"
FT                   /protein_id="ABG06660.1"
FT                   /translation="MQVLQAVAANPLQRRIRRDKLTYLGYQKLRSLSRAAEAVREVPGC
FT                   VIECGLALGGSGIMLATELPDRPFHGYDVFAMIPPPGPNDPAKAHDRYEVIASGRSEGL
FT                   GGETYYGYVDDLFDRVSDSFARYGVPTGDRIHLHKGLFEDTLDPQWPVALAHIDCDWYD
FT                   PVKLCLERLTPWLSPGARVILDDYSDYGGAKKATDEHVAAHSGFSVERDAGHRVLVYKP
FT                   RA"
FT   gene            complement(598205..600484)
FT                   /locus_tag="Mmcs_0540"
FT   CDS_pept        complement(598205..600484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0540"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein kinase
FT                   Serine/threonine protein kinase; KEGG: mbo:Mb0418c
FT                   serine/threonine-protein kinase PknG (protein kinase G)
FT                   (StpK G)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06661"
FT                   /protein_id="ABG06661.1"
FT                   /translation="MAASDHDLDPAVDDEPGTQPASLDDLDLDSASTVRPMATQAVFRP
FT                   DFDDSDSISVHTGDTEPQDHATTAIRTLSPVRRLGGGLVEIPRVPAKDPLEALMTNPVV
FT                   AENKRFCWNCGRPVGRSTSDGKALSEGWCPHCGSQYSFLPQLNPGDMVADQYEIKGCIA
FT                   HGGLGWVYLAFDHNVNERPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVKIYNFV
FT                   EHEDKHGNPVGYIVMEYVGGTSLKQARGQRLPVAQAIGYMLEILPALGYLHSLGLTYND
FT                   LKPENIMLTEDQVKLIDLGAVSTINSFGYLYGTPGYQAPEIVRTGPTVQSDIYTVGRTL
FT                   AALTLELRTRKGRYVEGLPEDDPVLAQYDSFGRLLRRAIDPDPRRRFASSEEMSSQLLG
FT                   VLREVVARDTGVPRSGLSTVFSPTRSTFGIDLLVAHTDVYVDGQVHSEKLTAQEIVRAL
FT                   PVPLVDPTDVGAAVLSASVLSEPVQTLDQLRAARHGSLDSEGIDLSESVELPLMEARAL
FT                   LDLGDVAKATRKLDDLATRVGWRWRLVWFRAVAELLSADYESATKHFTEVLDTVPGELA
FT                   PKLALAATAELAGSDLDHAPSRKFYETVWGTDHGIISAGFGLARALSAEGDRNGAVRTL
FT                   DEVPATSRHFTTARLTSAVTLLSGRSSNEITEQQIRDAARRVEALPDTEPRVLQIRALV
FT                   LGTAMDWLVDNSANTNHILGFPFTEYGLQLGVEASLRALARVAPTQAHRYALIDLANSV
FT                   RPMSTF"
FT   gene            complement(600484..601479)
FT                   /locus_tag="Mmcs_0541"
FT   CDS_pept        complement(600484..601479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0541"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mpa:MAP3894c glutamine transport system
FT                   substrate-binding protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06662"
FT                   /protein_id="ABG06662.1"
FT                   /translation="MSARAKNRQRVMKRLLALLSATVLVLAGCGQAASVVPTPGVTLAP
FT                   PTPAGMEELPPEQARLPIPETDDCNRRASLRPFPTRAEADAAVAYIRERGRLIVGLDIG
FT                   SNLFSFRDPITGDITGFDVDIAGEIARDIFGSPAQVDYRILSSADRIVALQNNQVDVVV
FT                   KSMTITCERKKKVGFSTVYLNADQRILAPRDSAITRAADLSGRRVCVVKGTTSLRRVQQ
FT                   ISPPPIIVSTVTWADCLVALQQRQVDAVSTDDAILAGLVAQDPYLHIVGPSMNQEPYGI
FT                   GVNLENTGLVRFVNGTLQRIRNDGTWYALYRKWLTVLGPAPAPPVARYVD"
FT   sig_peptide     complement(601381..601479)
FT                   /locus_tag="Mmcs_0541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.691 at
FT                   residue 33"
FT   gene            complement(601479..602798)
FT                   /locus_tag="Mmcs_0542"
FT   CDS_pept        complement(601479..602798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0542"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mbo:Mb0420c possible conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06663"
FT                   /protein_id="ABG06663.1"
FT                   /translation="MTVELAHPSTEPLASRSPTTPAHPRWFFLWTTPGRILTIGIVLAA
FT                   LAIASAFATSTTINDRQRALTTVLNHTEPLSFAAGELYSRLSVADAAAATAFIAGTEPR
FT                   DVRQRYEQAITDAAVALTRASSGLTDEELVQLLGRINAELAVYTGLVETARTNNRAGNP
FT                   VGSSYLSEASSLMQTKILPDAERLYERTSAQVDQETGASTRIPAPVILVVLATLLFGLF
FT                   ANRWLARRTRRRVNIGFVAGGLAVLIMVLWVGTALTISTTDSRSARGAGAESLKTITTL
FT                   AITAQQARADETLALIRRGDEEVRKQSYYQRIDGMQKKLADYLAREDAIDSTDLVAAED
FT                   LLARWRAADDRINAYIAVGNYQAATQVALGTGEDDSTPAFDKLNDALTKAIEQSRSQLR
FT                   NDILNARRVLSGATAGAAALSVIAAVAVALGLWPRLSEYR"
FT   gene            602907..603431
FT                   /locus_tag="Mmcs_0543"
FT   CDS_pept        602907..603431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0543"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mpa:MAP3896 MutT3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06664"
FT                   /protein_id="ABG06664.1"
FT                   /translation="MGAPYPVRVRGDGDGWVFSEGGGRYWGRHGAAGLLLRAPQSDGSA
FT                   AVLLQHRAPWSHQGGTWGLPGGARDSHETPEQAAVREAHEEAGLSVEQLTVRTTVVTAE
FT                   VVGSGGASWTYTTVIADAPALLHTVPNRESAELRWVAEEDVDSLPLHPGFAASWDRLRT
FT                   VTAAFPLLVSD"
FT   gene            complement(603421..604101)
FT                   /locus_tag="Mmcs_0544"
FT   CDS_pept        complement(603421..604101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0544"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mpa:MAP3897c thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06665"
FT                   /db_xref="GOA:Q1BEL9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEL9"
FT                   /protein_id="ABG06665.1"
FT                   /translation="MREPLDPLGPALAQASLYLCTDARRERGDLAEFADAALAGGVDLI
FT                   QLRDKGSAGERRFGPLEAREELAALEILAEAARRHGALLAVNDRADIALAAGADVLHLG
FT                   QDDLPLPVARRIIGPSPLIGRSTHDSAQVAAAVAEEVDYFCVGPCWPTPTKPGREAPGL
FT                   GLVREVASRATEKPWFAIGGIDEARLPEVLDAGARRIVVVRAITAADDPKAAARRLKDA
FT                   LVSR"
FT   misc_binding    604137..604253
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 66.40; Mmcs_R0005"
FT   gene            604241..605257
FT                   /locus_tag="Mmcs_0545"
FT   CDS_pept        604241..605257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0545"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="TIGRFAM: Glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: mpa:MAP3898 amino acid oxidase
FT                   flavoprotein ThiO, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06666"
FT                   /protein_id="ABG06666.1"
FT                   /translation="MPPDSTLAVIGGGVIGLSVARRAALDGWSVRVHRSPAKGASWVAG
FT                   GMLAPHSEGWPGEHELLRIGLDSLRLWHGGFLEGLPDEVVTARESLVVAVDRADAADLK
FT                   TVGEWLAVQGHPVTFTTAARDIEPLLAQGIRHGFVADTELAVDNRAVVDALEAHCTRLG
FT                   VRWAPPVDDLAAVDDVDLRVLANGVDAPTLWPGLPIRPVKGEVLRLRWRRGCMPAPRRV
FT                   VRARVHGRQVYLVPRADGVVVGATQYEHGRDTAPAVTGVRDLLDDACTVMPALGEYEFA
FT                   ECAAGLRPMTPDGLPLVEWLDERTLVAAGHGRNGFLLAPWTAERVSAELQTTQGART"
FT   gene            605268..605465
FT                   /locus_tag="Mmcs_0546"
FT   CDS_pept        605268..605465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0546"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS; KEGG: mpa:MAP3899 thiamine biosynthesis ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06667"
FT                   /protein_id="ABG06667.1"
FT                   /translation="MRIVVNNEDVHLDEQTTVAQLVARMGFPEKGIAVAVDWSVLPRTE
FT                   WETPLRDGARVEVVTAVQGG"
FT   gene            605458..606219
FT                   /locus_tag="Mmcs_0547"
FT   CDS_pept        605458..606219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0547"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis; KEGG: mpa:MAP3900
FT                   putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06668"
FT                   /protein_id="ABG06668.1"
FT                   /translation="MAEAAKLTIAGREFGSRLILGTGGAANLAVLEQALMASGTELTTV
FT                   AMRRVDAETGTGVLELLNRLGISPLPNTAGCRGAAEAVLTAQLGREALGTDWVKLEVIA
FT                   DERTLLPDAVELVRAAEQLVDDGFTVLPYTNDDPVLARRLEDIGCAAVMPLGSPIGTGL
FT                   GIANPHHIEMIVDAANVPVILDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAA
FT                   AMAAAVTAGHLARHAGRIPKRFWAQASSPAL"
FT   gene            606216..606977
FT                   /locus_tag="Mmcs_0548"
FT   CDS_pept        606216..606977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06669"
FT                   /protein_id="ABG06669.1"
FT                   /translation="MTRYVALGSSMAAGPGIRPSADGAPFRAGRSARNYAHLVAERLGL
FT                   DLTDVTYSGATTANILDEPQHGTPPQFLALDGTETLVTVTIGGNDVGYVPMLMAAGLPR
FT                   VVRWLPPVSTLFDPTARDRALVEVGESLHRVARTVRARAPRARVLFVDYLTLLPPPGEP
FT                   VAPLSDADAALGRRIADTLERLTGRAAADTGCGWIRAAQASRAHHAWSSEPWTTGPGLP
FT                   WPGRPAPLHPNAAGMRAVADLIVDAVESRDD"
FT   sig_peptide     606216..606287
FT                   /locus_tag="Mmcs_0548"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.700 at
FT                   residue 24"
FT   gene            606970..607872
FT                   /locus_tag="Mmcs_0549"
FT   CDS_pept        606970..607872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0549"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   fra:Francci3_4341 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06670"
FT                   /protein_id="ABG06670.1"
FT                   /translation="MIELTGLTKRFGRVRAVDDLTCTVEPGVVTGFLGPNGAGKSTTMR
FT                   MILGLDRPSAGTATVMGRPYREHRHPLRTVGALLDARQVHPNRTARSHLRWIAASNRLP
FT                   DKRVDEVLGMVGLADVAGKPAGAFSLGMSQRLGIAAALLGDPQVLLFDEPVNGLDPEGI
FT                   RWIRTLMRDLAGEGRTVFVSSHLLAEMAQTADRLLVIGRGRLIAATTVGDFVNRAGLDT
FT                   VRVRTPDRDRLCDALTAAGLSTTVEDSAVLVHGASTEQVGELAARTGATLHELSIQRAS
FT                   LEEAYMALTDEAVDFRARR"
FT   gene            607872..608612
FT                   /locus_tag="Mmcs_0550"
FT   CDS_pept        607872..608612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0550"
FT                   /product="putative ABC transporter membrane protein"
FT                   /note="KEGG: nfa:nfa53350 putative ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06671"
FT                   /protein_id="ABG06671.1"
FT                   /translation="MLRAEQIKLRTTRSPLWTLFAVVVVSLGFAVIQASVGSTAVPLAP
FT                   ERAAIGVAGFAVPVLMVLSALTVTGEYRTGMIRTTFLAMPGRTRVLAAKAVVTAVFSGI
FT                   CAVIMVLASALAVRLVGTPAQGAELSFTEFAVWRTAGAIGLYAVLGAVLAVGLGTLIRH
FT                   SAGVIAILLLLPFVIEPLLGSIPRVGARVGPLMPFANVNTFTEVEWVQTFSMWWGPLGA
FT                   LLYFTGVVAVVFVAAAVDINRRDP"
FT   sig_peptide     607872..607994
FT                   /locus_tag="Mmcs_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.373 at
FT                   residue 41"
FT   gene            complement(609387..611138)
FT                   /locus_tag="Mmcs_0551"
FT   CDS_pept        complement(609387..611138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0520 proteophosphoglycan ppg4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06672"
FT                   /protein_id="ABG06672.1"
FT                   /translation="MGLIFWSNSNLRTVFGSPSPGRGSVSVCTTIRTRTARSPGSVTSR
FT                   TTYLASPGRNLLCRITSSFSLRHRYPGSERSASRRHTRSSPSLMMTWTSTSVSFRGGFG
FT                   ENTPQLWSRPVARVRGWSIGASVSLIAESGSDPTTATTTSSATMTLMAMSPARLVLEAD
FT                   SPSCVDIGAYSSHQPSRPTGPPPKRTSTNRETRSSKKCTTRQKRSERNLKKRAIGLGVG
FT                   RSDGFVASTASVESEPSLKSSVESTASSVESTASPRPSAVVSRMSVRSDPSTTSVRSRL
FT                   SAAPSTVSSTPSTAVSRTSLTPSESTASSVESTVSPRPSTVTSTVSVRSVPSTTSVRSR
FT                   LSAAPSTVSSTPSTAESTTSLTPSASEAASSVESTVSPRPSTVTSTVSVRSVPSTTSVR
FT                   SRLSAAPSTVSSTPSTAVSRTSLTPSASEAVSLTSSVESTASNVESTASPSPSAAASTT
FT                   SVRSVRSAASVRSSASSRPSTVVSRVSVTPSTVSSTVSSTPSTRSLISRLPRSSPPPPP
FT                   RSSNPLVPIRDPASGSSADGDSPSDVADEPPSEPGEPSDPSSPSFSPASPPTGASGTIP
FT                   APGVESN"
FT   gene            611184..612182
FT                   /locus_tag="Mmcs_0552"
FT   CDS_pept        611184..612182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bba:Bd2936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06673"
FT                   /protein_id="ABG06673.1"
FT                   /translation="MTADLWSRLRQTGGDSARAWRRFWFSYDSAYPLGFIRIAFGVLMM
FT                   VWTVSLYPGLHDRFGTDGVVPRPPTADFTWSVFRVFPDDDAVFAGWVLLLVASIALTVG
FT                   WHSRLAAVLVFVMVVSFERRNPFVMNAGDVLLRVEALFIALAASGAALSLDQRRRTGSF
FT                   WTAEQRRIWPVRLMQIQVSVIYVSTVVAKLHGETWQDGTAVSYSLRQNDLLFFTTPRWI
FT                   TDNLLVSNVLSWSTLLIELSIGLLVWNRRCRPWVLAAGVVLHLSIFVSMSIGLFSLAMF
FT                   VLYLAFLPSGRAEALGNRLAQRSAARCGRHSGRHSRQRSADMTRDLARSGG"
FT   gene            612219..613724
FT                   /locus_tag="Mmcs_0553"
FT   CDS_pept        612219..613724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0553"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20 protease-associated PA peptidase
FT                   M28; KEGG: mpa:MAP3906 LpqL_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06674"
FT                   /protein_id="ABG06674.1"
FT                   /translation="MVREMLAVLSIVAVTAGLTGCGDDEKGNPVPAPSTQETAPEAKEF
FT                   GAALKDKVTVDAMMGHLDELQKIADAHGGNRALSTPGYDASVDYVANTLRDKGFDVQTP
FT                   DFEVRLPFAEKPQLTVGGRAVEAKALEYTIGTAPQGVEGPLVPARVEDSPGCTASDYDG
FT                   LPVQGAVVLVDRGECPFGVKQAVAAQRGAVALVVVNNVDGEVVSGTLGDDTDVKIPAVS
FT                   VTKAVGGELRDAPGQTTLRLEAGVRTDRTRNVIAQTKTGSTSDVVMVGAHLDSVPEGPG
FT                   INDNGSGVAAILETALQLGVDPDVRNTVRFGFWGAEEQGLLGSMDYVQSLNEEQLKDIS
FT                   LYLNFDMLGSPNPGYFTYDGDQSAPPNPEAGSPRVPEGSAGIERTLMQYLDDAGKPGED
FT                   TSFDGRSDYDGFTLAGIPAGGLFSGAEEEKTPEQAERWGGEADRPFDPNYHKKEDDLTH
FT                   IDRTAMEINGGGVAYAVGLYAQDQRGRNGIPIRDDRTRHPVES"
FT   gene            613724..615163
FT                   /locus_tag="Mmcs_0554"
FT   CDS_pept        613724..615163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0554"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20 protease-associated PA peptidase
FT                   M28; KEGG: mpa:MAP3907 LpqL_2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06675"
FT                   /protein_id="ABG06675.1"
FT                   /translation="MHISRAVTALVAALVAACSSPAPPPDVTGGDLAGKVTVDALYTHL
FT                   EALQDIAERHGGNRAQGTAGFDASVDYVANLLRDSGFDVQTPEFDRYGGTRGGAPRLTV
FT                   NGRAHAVEKASLLVDTGPEGLDAVTLRPGRPAGCSAGDYGAVDVRRSIVVVDDTGCSVV
FT                   VKQDVAVARGAVGVLVVTGSGGGSPPGLFTPGYYRELTVPVGIINSDANAALRRTTAPV
FT                   RLRLDGQPVLVKSRNVLAQTKTGDTRNVVMAGAHLDSVSSGPGINDNATGVAAVLETAL
FT                   QLGSSPRVANAVRFAFWGSEEIGLEGSRAYLRDLDGEQLDDIALYLNFDMLGSTNAGYF
FT                   TYDGDQSAATEPVSVPEGSAGVERLLAGYLNEAGVRPADMPLSDRTDYHSFLAAGVPFG
FT                   GTTTGAAQQKTEVQARLWGGRAGAAFDPNYHTRRDTIDNVDRHALGIMGPAVAFAVGTY
FT                   AHSIKGANGVPPRDRRDRDRP"
FT   sig_peptide     613724..613783
FT                   /locus_tag="Mmcs_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.352 at
FT                   residue 20"
FT   gene            615653..616957
FT                   /locus_tag="Mmcs_0555"
FT   CDS_pept        615653..616957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP1772 cell wall surface anchor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06676"
FT                   /protein_id="ABG06676.1"
FT                   /translation="MQTAVRSYVSAGVALAGVGAIAFSPVVPIPDVEVPAISSSAVELN
FT                   ALVNPIELFVPIFEKAFADTGALGQRVFANPAPILEQILANQVASAQTLGEIAGVFGES
FT                   FQTAFAAAPGLLETAFDQFAAGEITLALNTLFDLALSPVIGPLLDSIFMGDGVLQDLVG
FT                   VLQKPLVNAQNVIGLLGDPDFLLTIGLLPLQTAYALNTAVGGAAEALLAAAEAGDPEGF
FT                   VNAITTGSANVTAAVLDLLLNPGTPPYNYDQGLVAALLSARDMIAQAIGAPAPSPALLA
FT                   TVSSEVTDPALTTITLDVAPASDAIEAPKPAAETDVSAVSLSADAVDATEPATAVAEET
FT                   AAVEAGVDEVVAESEVVTPKKSDPLNELRKGVEGAVNDIRNGFKHAAASLTGKASKPAK
FT                   SESSPASDSGSASESDSGSDSGSGSGSDSTSGDAE"
FT   sig_peptide     615653..615721
FT                   /locus_tag="Mmcs_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.609) with cleavage site probability 0.599 at
FT                   residue 23"
FT   gene            complement(616975..618276)
FT                   /locus_tag="Mmcs_0556"
FT   CDS_pept        complement(616975..618276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0556"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: lxx:Lxx08910
FT                   xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06677"
FT                   /protein_id="ABG06677.1"
FT                   /translation="MIPAKTGRSANWKWKPVEARADADFVVAPDERLSWPRTIGLGAQH
FT                   VVAMFGATFLVPVLTGFPPATTLLFSGVGTILFLIITGNRLPSYLGSSFSVIAPVTAAV
FT                   ASEGTGSALGGIVALGLVLIVIGGVVHLVGTRWLDVTLPPVVTGAIVALIGFNLAPAAK
FT                   TNFEAGPVVATVTLVLLVATLAFFRGMIGRLAIFLAVLIGYLLALAMGDVDTSAIAAAP
FT                   WVGLPDFEAPSFSLAVLPMFLPAVVALIAENIGHVKSVGQMTRTDMDPLIGRALAADGV
FT                   ATTLAGFGGGSATTTYAENIGVMAATRVYSTAAYWVAAVVAIALSLCPKIGAAISATPA
FT                   GVLGGATVVLYGLVGVLGVRIWLTNHVDFSLPVNQMTAAIPLIIGIADFTWQAGELTFT
FT                   GIALGSIAALLVYHGMRLLGLRTSRSAEPSTSTV"
FT   gene            complement(618283..619530)
FT                   /locus_tag="Mmcs_0557"
FT   CDS_pept        complement(618283..619530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0557"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region Amino
FT                   acid transporter, transmembrane; KEGG: sco:SCO4612 amino
FT                   acid transporter; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06678"
FT                   /protein_id="ABG06678.1"
FT                   /translation="MNPPGGPALSRRLGLVDAIVIGLGAMIGAGIFTALAPAAAAAGGG
FT                   LLVGLAVAAVVAYCNATSSARLAARYPESGGTYVYGRERLGPFWGYLAGWGFVAGKTAS
FT                   CAAMALTVGVYVWPGGARLIAVAAVVALTAVNYAGIRKSALLTRLIVAVVLAVLAVVVV
FT                   IVLGFGDPVGDRLDFGADVTVGGALQSAGLLFFAFAGYARIATLGEEVCDPARTIPRAI
FT                   PIALGLTLAVYAVVAVTVLAQLGPAALAGSTAPLADAVRAAGFPGWVPVVGAGAAVAAL
FT                   GSLLALILGVSRTALAMARDRHLPSGLAAVHARHGTPHRAEVAVGVLVAALAATVDLRD
FT                   AIGFSSFAVLMYYAIANASAWTLGARVVPAVGLAGCLLLAFALPWTSVLAGVAVLAVGA
FT                   LAYAVRRARSTGNGAR"
FT   sig_peptide     complement(619405..619530)
FT                   /locus_tag="Mmcs_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.620) with cleavage site probability 0.396 at
FT                   residue 42"
FT   gene            complement(619540..619878)
FT                   /locus_tag="Mmcs_0558"
FT   CDS_pept        complement(619540..619878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06679"
FT                   /protein_id="ABG06679.1"
FT                   /translation="MSARAWYIGIGGAILMAIGLFALRFPVLIDGYDQWGWQVECGSGF
FT                   VANLTQAENAAVDGTDFVASCQNALLTRRLWTIPLIAAGVVAMVAVLLTATVAHEDEDT
FT                   LAGDRETS"
FT   gene            619905..621260
FT                   /locus_tag="Mmcs_0559"
FT   CDS_pept        619905..621260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0559"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP0116
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06680"
FT                   /protein_id="ABG06680.1"
FT                   /translation="MLTLILSPRRHRMTISAVAPSCAVCGISVFGMAPTPPGRGDGVRR
FT                   RPKDRKAQIARASAEAFSSLGYHGVSMDAIASRVGISAAALYRHYTGKYELFRDAVLAL
FT                   GQQLVDATAFVDGEISDDGFGAHITEDPERTLVHLATAVCDAALANRESGGLYRWEARF
FT                   LRGDDQATLDSQIRTVHRRFQQPLRMLRPELDSRQRWTLSTAMISVLGSIVDHRAKLPA
FT                   GQIRPLLAELVVALVPAEFPDLPDDPEPPAPIAAAHRSKYEALLVESMRLFNLKGYRDT
FT                   SMEDIAAATGMPASGIYRYFSGKSDILAGAFRRSADRWSAEMSAILDTTADREEALAKL
FT                   IDGHVARSFSEPELDYVYYTERLNMSPADQQILRNLQRSTVETWADLVVTLRPEWTAGQ
FT                   ARFAVYAALAVTIDLGRLVHYRNSPYTRALVAGLMDLTLLGRYRLRTVLPAK"
FT   sig_peptide     619905..620000
FT                   /locus_tag="Mmcs_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.935 at
FT                   residue 32"
FT   gene            complement(621227..621493)
FT                   /locus_tag="Mmcs_0560"
FT   CDS_pept        complement(621227..621493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa45370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06681"
FT                   /protein_id="ABG06681.1"
FT                   /translation="MPQQDNRAAKLTGLAIAGTGLAHFVRPQVFEPITVAAFPQNTRRH
FT                   IYTNGSLETAIGLALAGRKTRKFGLAGLLGYAVYLAGNTVRKR"
FT   gene            complement(621507..622997)
FT                   /locus_tag="Mmcs_0561"
FT   CDS_pept        complement(621507..622997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0561"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mpa:MAP2018c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06682"
FT                   /protein_id="ABG06682.1"
FT                   /translation="MTSEQYDAVIVGAGFAGIGAAIQLKRMGYANFVILDREDDLGGTW
FT                   YVNHYPGLAVDVPTTTYSYFFEPNPKWSRLFSTGAEIKQYADEVADKYDVRRHIRFNTA
FT                   VEGARWDEEAKLWRVALDGGETLSTRYLITATGFLSQPRTPDIPGITSFEGKVIHTTDW
FT                   DDSFDPSGRRIAIIGTGATAVQLIPELARNAADLTVYQRTPIWVAPKVDIRFSERTKRL
FT                   FARVPLLQRTVRLITDTIYEAMINIGVVHYKVPLFRRLNMSAMDLCKINQFVAIRDKEL
FT                   RRKLTPDYDIGCKRPTFSNSYFRTFTKPHVHLQADGIDHVEADGIVNADGTKTVIDTLV
FT                   LATGFDLWEANFPAIEIIGRGGRNLGKWWRETRFQAYQGVSMPYFPNYLSLASPYAFLG
FT                   LNFFNTMEYQMRLMDRLFSEVHRRGATTFEVTEEANTRYLDRMTEALGSSLWTLGNCAS
FT                   SRSYYFNPSGEPSLLRPMSTRDAIKEASEFPLSDYQIA"
FT   gene            complement(623053..623670)
FT                   /locus_tag="Mmcs_0562"
FT   CDS_pept        complement(623053..623670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06683"
FT                   /protein_id="ABG06683.1"
FT                   /translation="MSMPPGPPPPPPGQPPYGQQPYGQPAYGQPAYGQPYFPPPPPQPY
FT                   AEMRPAGPPPPPKKSKLWLILGLVALTVVVIAIAVVLFVVLVVREGTVTATQVKLGDCL
FT                   SEIPDGSEVRTLKTVDCAEPHAGEVFAVLQMPDGDFPGQDAMVEYANRCAPELASYSPS
FT                   AVTDDTVRLFVLFPTDETWSDGDRAVTCVATLNPPRAGSLKG"
FT   gene            complement(623681..624304)
FT                   /locus_tag="Mmcs_0563"
FT   CDS_pept        complement(623681..624304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3911c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06684"
FT                   /protein_id="ABG06684.1"
FT                   /translation="MNLDDIAGVAHEPAGTPRGVVLLTHGAGGNRDAPLLVRFCDEWAG
FT                   RGWLAVRYNLPYRRRRPKGPPSGSATADRAGVADAVAAARELTDGPVIAGGHSYGGRMT
FT                   SMAVADDGVALDVMTLSSYPLHPPGKPDRARTEHLPRIGVPTVFVHGTADPFGSIDELT
FT                   AAAALVAGPTELVEITGARHDLGSKALDVPKLAVDAALRLLATG"
FT   gene            complement(624291..625139)
FT                   /locus_tag="Mmcs_0564"
FT   CDS_pept        complement(624291..625139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0564"
FT                   /product="Phosphomethylpyrimidine kinase type-2"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: mpa:MAP3912c phosphomethylpyrimidine kinase;
FT                   TIGRFAM: Phosphomethylpyrimidine kinase type-2; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06685"
FT                   /protein_id="ABG06685.1"
FT                   /translation="MTDTRYLPLAPPGQTPARVMTIAGTDSGGGAGIQADSRTFAMLGV
FT                   HGCVAVVAVTVQNSVGVKGFHEIPIDVITGQIEAVVSDIGIQAAKTGMLASSEIITAVA
FT                   ETWRRLRPAPLVVDPVCASMHGDPLLHPSALDALRSELFPLATLVTPNLDEVRLITGID
FT                   VTDAASQRDAARALHALGPQWALVKGGHLRSSAYSPDLLFDGSEFHEFGADRIDTGHDH
FT                   GAGDTLAAATASALAHGYSVPDAVAFAKQWVTECLRAAYPLGHGHGPVSALFRLSADEP
FT                   R"
FT   gene            625315..627078
FT                   /locus_tag="Mmcs_0565"
FT   CDS_pept        625315..627078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0565"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mpa:MAP2081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06686"
FT                   /protein_id="ABG06686.1"
FT                   /translation="MCSAASARRCAPSDTKRTRLQMTTELTGRRRIATDRDHPLYKWVV
FT                   LSNTTLGMLLATVNSSIVLISLPAIFRGIGLNPLQPANVTYLLWLLMGYMVVTAVLVVL
FT                   FGRLGDMFGRVRIYNLGFVIFTLCALALSFQPFDLDAGAWWLIGWRVVQGVGGAMLIAS
FT                   SAAILTDAFPAHQRGMALGVNMVAAVAGSFLGLVIGGALSEWHWQAIFWVGVPIGVLGT
FT                   VWAMRSLREVGERSPGRLDWAGAVTLGLGLTVLLTGITYSIQPYGGSPTGWGNPWVLGA
FT                   IAFGVLALVAFCVIELRVDQPLVDILLFRITAFGMGNLAGLMSSVGRGGLQFMLIIWLQ
FT                   GIWLPLRGYDFEATPLWAAIYMLPLTFGFLVAGPLSGWLSDRYGARPFTVGGMLLMCAT
FT                   FVALVLIPVDFDYWLFATLIFLNGVGGGVFTSPNSAAIMSSVPASARGAASGVRATFFN
FT                   AGGSLSIGIFFSLMIVGLANTLPGAMSAGLQAQGVSAAVADEVAGTPPVGSLFAAFLGY
FT                   NPIGELLEPSHALQQPGVNAEVLTGQTFFPHLIIEPFHTGLVVVFVAAAVMMLIGAVAS
FT                   LFNAGRYAEQT"
FT   gene            627123..629882
FT                   /locus_tag="Mmcs_0566"
FT   CDS_pept        627123..629882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0566"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: sma:SAV2033
FT                   putative LuxR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06687"
FT                   /protein_id="ABG06687.1"
FT                   /translation="MPLQLISRDAELSAVDDLLSAVPTGTCVLVLEGDVGIGKSTVWRA
FT                   GIERARTRGFRVLAAHPVSSESVAAYSSLAELLADVDTEVLDHLPAPQRVAIDRVLSRA
FT                   DDTGPGTDQRAVAAAVRSVLERLAHDSPVLVAIDDLQWLDPPTAAVLASVARRSAGAIG
FT                   FLVTVRSGAGDHTETLLEPSRPERLHRARVHPMTVGGLHAMISHQLGRSLTRPRMDWVY
FT                   EVSAGNPLYALELARALDRDATGVGPLPATLADLVRTRISGLPDHTREVLLATACIASP
FT                   TVDLVARAVGDNVEWTVAALEEAERHGVVEITGYKVTFSHPLLARGVYAEASADERRWM
FT                   HRRLADIVESPESRARHRALSSDGADEQTVKALDEAAESVHLRGAPATAAELLDMARAR
FT                   GGDTPERTLRAAACHFEAGDAARARVLLEHALSEIPPGELRARALQLLGLVRLYANSSS
FT                   EAVPMLEQAIAEPGVNPDRRVHMLVMLAFIEFNAGRADRAVQRAEEAVTQAMTLHRPDL
FT                   ITQAKPIRALLRFLLGEGFDEAELDGVFDFDEPEGLPLAAQPRTLHALLMLWTDRLDEA
FT                   ADQFNAIAQRCIERGDESERAFVDFHLGQVNVWRADLAAAERVAEDSVERALQSHGDLP
FT                   LFVALIVRVMVSAHFGREDQTRRFAAQARTVGERCESSRLGVWLTTSLGFLELSLGDHR
FT                   AAVDVLSPAVEGWSSAATGIPAPTELVTAPFLPDAAEALIGIGRLDEAERLVEALEANG
FT                   TRLDRPWMLALGARCRALLLAARGDLTAAVRAGERALTEHGRLSMPFELARTQLVVGRL
FT                   QHRRRQYDAATATVSTALAAFERIGAELWARQARAELDALTGRQTAAGLAESERRFADL
FT                   AVQGMTNREIAATLYVSEKTVEANLSRVYRRLGIRSRGELARVLNAES"
FT   gene            complement(629892..630695)
FT                   /locus_tag="Mmcs_0567"
FT   CDS_pept        complement(629892..630695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0567"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III
FT                   exodeoxyribonuclease III (xth); PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: mpa:MAP3916c
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06688"
FT                   /protein_id="ABG06688.1"
FT                   /translation="MRLATWNVNSIRARVDRVTDWLERADVDVLAMQETKCNDEQFPTM
FT                   PFAALGYDVVHCGFNQWNGVAIASRVGLDDVAVGFDGQPTWGDKPDIEAAAEARALGAT
FT                   CAGVRVWSLYVPNGRFVGSPHYAYKLEWLAALRKTAHGWLTENPALPIAMVGDWNIAPT
FT                   DDDVWSVEAYQDSTHVTPPERQAFTEIVDAGYADVVRPFTPGPGVYTYWDYTRLAFQKR
FT                   RGMRIDFILGSPAFADRVTHAEIVREERKGKGASDHAPVLVDLRD"
FT   gene            complement(630699..631637)
FT                   /locus_tag="Mmcs_0568"
FT   CDS_pept        complement(630699..631637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0568"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mtc:MT0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06689"
FT                   /protein_id="ABG06689.1"
FT                   /translation="MDAGRGSRSVRPLSRPVPELPRAGTRVSLRYRLPAGSVPPLNDVV
FT                   GHLLERDPVVRVRTKTGESVTISPADVVTVRVLTDVPVKSSQIRAVEHAAALAWPGLHR
FT                   EWVDGWLLRASDGYTHRGNSAVPLDINANAATVPAIRDWYARRGLTPWLAVPDRLVQLP
FT                   LRDVHLESIVMVRALPAEAAAEVTVTPQPDPAWLAVYEREVPIEVLTAVVDGQVAFGRI
FT                   DDAAVGRAAVTPARDGTRWVGLSAVRVAEDRRRRGHARALCAALLQWGARGGATHAYVQ
FT                   VLADNHGAIALYESMGFTAQHRERYVDASKL"
FT   gene            complement(631598..632191)
FT                   /locus_tag="Mmcs_0569"
FT   CDS_pept        complement(631598..632191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0569"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="PFAM: formylmethionine deformylase; KEGG:
FT                   mpa:MAP3918c putative polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06690"
FT                   /db_xref="GOA:Q1BEJ4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEJ4"
FT                   /protein_id="ABG06690.1"
FT                   /translation="MAVVPIRIVGDPVLRTETTPIPVGDDGSLPAEVADLIRDLYETMD
FT                   AANGVGLAANQIGVSQRVFVYDCPDSRGRAGRRRGVVINPVLETSDIPETMPDPDDDEE
FT                   GCLSVPGEQFPTGRADWARVTGLDADGSPITVEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRHARAAKRAVKHNGWGVPGLSWTPGEDPDPFGH"
FT   gene            632329..632637
FT                   /locus_tag="Mmcs_0570"
FT   CDS_pept        632329..632637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06691"
FT                   /protein_id="ABG06691.1"
FT                   /translation="MDGAMAQTEQSGDDSDLPAGLTRREFDILAFERQWWKYAGSKEDA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   gene            632663..633124
FT                   /locus_tag="Mmcs_0571"
FT   CDS_pept        632663..633124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0571"
FT                   /product="putative tuberculin related peptide"
FT                   /note="KEGG: mbo:Mb0439 putative tuberculin related
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06692"
FT                   /protein_id="ABG06692.1"
FT                   /translation="MMNQRESSGLPLRAIVMVLLFLGIVFLLVGFQALRSDDSSADETT
FT                   VATTTSSTPSPKPAPEADARPEVRVFNISDVAGAAEGVATRLRDEGWNVTETGNLTLEG
FT                   VTATTVYFGEAPGEREAADEVGRLLEAPVEPRVPPLAEQPPGVVVAVTG"
FT   gene            633174..633860
FT                   /locus_tag="Mmcs_0572"
FT   CDS_pept        633174..633860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0572"
FT                   /product="superoxide dismutase, copper/zinc binding
FT                   protein"
FT                   /note="PFAM: superoxide dismutase, copper/zinc binding;
FT                   KEGG: mbo:Mb0440 probable periplasmic superoxide dismutase
FT                   [Cu-Zn] SodC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06693"
FT                   /protein_id="ABG06693.1"
FT                   /translation="MFAVPALALSACSPNEPVSSEPGTTPSVWTGSPSPSAAPGQGEEG
FT                   GSGSEGQGEGGQKLTAELKSPDGTTVANAEFDFSGGYATVTVQTVASGQLEPGFHGMHV
FT                   HQVGKCEPNSVAPSGGAPGNFNSAGGHFQTEGKTGHPASGDLTSLQVREDGSAMVVTTT
FT                   DAFTAEDLTGGEGTAIIIHEKADNFANIPPEKYNQVNGTPGPDQATMATGDAGGRVACG
FT                   VIRSGQ"
FT   gene            633838..634968
FT                   /locus_tag="Mmcs_0573"
FT   CDS_pept        633838..634968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0573"
FT                   /product="Enzymatic protein of unknown function"
FT                   /note="TIGRFAM: Enzymatic protein of unknown function;
FT                   PFAM: glutamate--cysteine ligase, GCS2; KEGG: mtc:MT0448
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06694"
FT                   /db_xref="GOA:Q1BEJ0"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEJ0"
FT                   /protein_id="ABG06694.1"
FT                   /translation="MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVIA
FT                   EIGETPHVHKELLRNTVEVVTGICENTGEAMADLHDTLKVVRRIVRDRGMELFCAGTHP
FT                   FANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGISSAHKVMPIISSLLNQYPH
FT                   LLALSASSPYWDGSDTGYASNRAMMFQQLPTAGLPFQFQSWPEFERFVHDQKKTGIIDH
FT                   MNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALTHCLVVDLDRRLDAGEQLPVMP
FT                   PWHVQENKWRAARYGLDAEIILDADSNERLVTEDLDDLLTRLQPVARSLDCADELAGVA
FT                   EIYRHGASYQRQRRVAEEHDGDLLAVVDALVAELEL"
FT   gene            635065..635403
FT                   /locus_tag="Mmcs_0574"
FT   CDS_pept        635065..635403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06695"
FT                   /protein_id="ABG06695.1"
FT                   /translation="MADPDQVAMNTTAPSTTTTSPSPTTRARVPDPTPSAPRSPGVPAP
FT                   GGLAATTCGEYVDMDEATQRQVIEAIGEQNELVALNPELWITMASAMCTFADPATLVSD
FT                   AVVGGGFN"
FT   gene            635422..636033
FT                   /locus_tag="Mmcs_0575"
FT   CDS_pept        635422..636033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0575"
FT                   /product="peptidase S16, lon-like protein"
FT                   /note="PFAM: peptidase S16, lon-like; KEGG: mbo:Mb0442
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06696"
FT                   /protein_id="ABG06696.1"
FT                   /translation="MFPLEVTMLPGEELPLRIFEPRYVALVQDCLAMTDPAFGVVLIEA
FT                   GREVGGGDRRSTVGALARIVDYADLGVGRFRLRCLMGERIRVRQWLDDAPYPRADIEVW
FT                   EDEPGAVDSAAVFDVEDRVVALYERIAAARGSEFGGRSAVLGPEESDVVKRLYGLAARV
FT                   PMGQADKYAVLSAPTVSARLSALSEAVDTVTAMVEFQLSE"
FT   gene            complement(636087..637091)
FT                   /locus_tag="Mmcs_0576"
FT   CDS_pept        complement(636087..637091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06697"
FT                   /protein_id="ABG06697.1"
FT                   /translation="MTTARTYNQEHVPRRRDGRRRISIYWTWSYPWEAQRNPAEVYNRF
FT                   STMTEVRNALWPSYETTEYDDAHFLQGIAGTLELFHRSTLAFQELAGEVTGHPVAVFQR
FT                   IDQAGYLLPIDERILADTDTLMVFGLDHILSEQEATADEIAAIKQWLQREGTCLLLAPH
FT                   HDVGFTDDFDQRAAEFAHHGDPLVPRQQRFGQYTRSLMKALDVPVHNTWGLRPAVVERT
FT                   REIAPLNGFRDLDTARLLDNVTTFNFHPHLPHYELTAPESDTLRVLGRQRVDPHRPHPF
FT                   TDGGNTEFNALIWMPPTGHRSGDVVLIDSTHFTTLFGGTDSLRNLWHNLATMR"
FT   gene            complement(637088..638431)
FT                   /locus_tag="Mmcs_0577"
FT   CDS_pept        complement(637088..638431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0577"
FT                   /product="Dyp-type peroxidase"
FT                   /note="TIGRFAM: Dyp-type peroxidase; KEGG: mpa:MAP0388
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06698"
FT                   /protein_id="ABG06698.1"
FT                   /translation="MTFTLTELELDDIQHILLTRTPAITGRYEFLTFDTPAGGRAWVTA
FT                   LLDKVQSAADVRAAMDTSDRWVTLAFTWQGLRALGVPDTSLATFPDAFREGMAARARIL
FT                   GDTGAAAPEHWLGGLAGDDLHAIAILFSRTDEQYRASVANHDALLDSLAGVRSLSHLDL
FT                   NATPPFNYAHDHFGFRDRLSQPVIKGSGEEPTPGSGAPLAPGEFILGYPDENGPVADSL
FT                   QPEALARNGSYMAYRRLEEHVGLFRDYLRANSKDAGEEELLAAKFMGRWRSGAPLVLAP
FT                   DQDDPELGADPMRNNDFNYKKMDPFGYACPLGSHARRLNPRDTAHYMNRRRMIRRGATY
FT                   GPALPEGAPDDGVERGIAAFIICADLVRQFEFAQNVWINDKTFHELDNEHDPIAGTQDN
FT                   TLDFTVPKRPIRRVHKGIPAFTTLRGGAYFFLPGLRGLRYLATLGDTS"
FT   gene            complement(638428..638832)
FT                   /locus_tag="Mmcs_0578"
FT   CDS_pept        complement(638428..638832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06699"
FT                   /protein_id="ABG06699.1"
FT                   /translation="MGTSDPLVTVTRYIEAFNRGDAAVMALMFDTEGVILDGMAPHVWL
FT                   GPSAVQDWYRDVLVEGEHHGASDYAVTLGEPLHHNVTGDRAYLAIPARMTFRVRGTPVT
FT                   QTGAFFTVALRQVAEGWRITAWAWTKGTQQ"
FT   gene            complement(638838..639398)
FT                   /locus_tag="Mmcs_0579"
FT   CDS_pept        complement(638838..639398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06700"
FT                   /protein_id="ABG06700.1"
FT                   /translation="MSADNQHWSKPAAMAIPREGYFELEQGRYGPVYPRTPACYGFSII
FT                   AKVKEGREEAVRAYGKTIEETIAASPDALAPLRLHYLRWQLFDVGSGLHFQYQGIFDTD
FT                   FDKYTEDAVQLFSATGITTVFTNLEGFPEDWKENPESFVNFVREHQVPSFLEYGEYPYV
FT                   TADEIKKALRLKAAFSDMLDQMQ"
FT   gene            complement(639696..640424)
FT                   /locus_tag="Mmcs_0580"
FT   CDS_pept        complement(639696..640424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0580"
FT                   /product="Protein of unknown function Mtu_121"
FT                   /note="TIGRFAM: Protein of unknown function Mtu_121; PFAM:
FT                   O-methyltransferase-like; KEGG: mpa:MAP4078 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06701"
FT                   /db_xref="GOA:Q1BEI3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEI3"
FT                   /protein_id="ABG06701.1"
FT                   /translation="MSALAVALARQSESHADCPLFNDPYAQVFIDAALSRGCQLPSDET
FT                   SERINGIANYASSRTKWFDEYFIAAGAHGLEQMVIVAAGLDARAWRLPWVAGTTLFEID
FT                   HPGVLKFKNEALHEHGESPSVSRYVPVPADLSDGWSERLRDAGFDVSEPTAWAVEGLLP
FT                   YVADGPHLLFDRIHEISPAGSRLAVEAVGTGVADWLSTQGWQVTMIGAQELMTRYGRCG
FT                   DHSDTDAGMDTVFVNATRTR"
FT   gene            complement(640432..640761)
FT                   /locus_tag="Mmcs_0581"
FT   CDS_pept        complement(640432..640761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0581"
FT                   /product="multisubunit sodium/proton antiporter, MrpG
FT                   subunit"
FT                   /note="TIGRFAM: Na+/H+ antiporter subunit; KEGG:
FT                   nfa:nfa52950 putative cation antiporter subunit; TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06702"
FT                   /protein_id="ABG06702.1"
FT                   /translation="MLGGSTLALTAAIGVVRFPDTLSRMHAATKPQVLGLLLVLAGAAI
FT                   RLRGNIDVGMLILAGLFTIITAPVIANRVGQLAYHEQNIRDDLLTRDEMLEVAAEGEHR
FT                   GHDDS"
FT   gene            complement(640791..641078)
FT                   /locus_tag="Mmcs_0582"
FT   CDS_pept        complement(640791..641078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0582"
FT                   /product="multisubunit sodium/proton antiporter, MrpF
FT                   subunit"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: nfa:nfa52940 putative cation antiporter subunit;
FT                   TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06703"
FT                   /protein_id="ABG06703.1"
FT                   /translation="MNTVWIIAGVMLSTAAAATMFRLLAGPSTLDRLVALDTLVAVTMC
FT                   AIGTWAAFSLNTTVTYSLTALALISFVGSVSVARFRVPDVHRPDRTRRIS"
FT   sig_peptide     complement(641001..641078)
FT                   /locus_tag="Mmcs_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.991 at
FT                   residue 26"
FT   gene            complement(641110..641679)
FT                   /locus_tag="Mmcs_0583"
FT   CDS_pept        complement(641110..641679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0583"
FT                   /product="multisubunit sodium/proton antiporter, MrpE
FT                   subunit"
FT                   /note="PFAM: cation antiporter; KEGG: nfa:nfa52930 putative
FT                   cation antiporter subunit; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06704"
FT                   /protein_id="ABG06704.1"
FT                   /translation="MKVIEGTRWSPRRLALRAWVLCWLTLVWVLLWGTLSAANVVSGLA
FT                   VALMITLLLPLPPVPVEGRVHLLSLLRLVATVAYYLVVSSVQVAWLAVKPGPPPLTAVL
FT                   RAHFAVKSDLVLALAVNIVNLTPGTIALEIDQTRRVVYVHVIDVGSDRALSRFYRQIGQ
FT                   FERLLIAAFERESDWRPSTEKEADPE"
FT   sig_peptide     complement(641566..641679)
FT                   /locus_tag="Mmcs_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.828) with cleavage site probability 0.635 at
FT                   residue 38"
FT   gene            complement(641676..643283)
FT                   /locus_tag="Mmcs_0584"
FT   CDS_pept        complement(641676..643283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0584"
FT                   /product="multisubunit sodium/proton antiporter, MrpD
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: nfa:nfa52920 putative cation antiporter NADH
FT                   dehydrogenase subunit; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06705"
FT                   /protein_id="ABG06705.1"
FT                   /translation="MSLSSVLTPLPVLIPTIAAALTLFAGRRPVLQRVIAQLALVAVVV
FT                   VCAALVYLTDRDGTLALHVGGWGQSVPGMGPLGITLVVDRLSALMLMVSSIVLLAVVAY
FT                   AIGQGIRDGDGRQPVSIFLPTYLVLSAGVCTAFLAGDLFNLYVGFEVLLSASFVLLTIG
FT                   ASAERVRAGISYVMVSMVSSLIFLLGIGLVYAATGTLNMAELAVRLDDVSEGTRMALFA
FT                   VLMVAFGIKAAVFPLSTWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRAHSLLFPGGGL
FT                   DQVLLWAALLTMVVGILGAIAQSDIKRLLSFTLVSHIGYMVFGIALSNDIGMAGAIYYV
FT                   AHHIVVQTTLFLVVGLIERQAGASTMTRLGGLAAASPLLAFVFVVPALNLGGIPPFSGF
FT                   IGKVALLEAGAANGTPLAWALVAGGVVTSLLTLYVVARVWTKAFWRSREDAPEGHLSST
FT                   APAALLDDTAESDDIQFVDRDHVGRMPAGMLVPTGLLIAVGLALTVAAGPIFAYSGRAA
FT                   DEVIQRDHYITAVVGERP"
FT   sig_peptide     complement(643221..643283)
FT                   /locus_tag="Mmcs_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.895) with cleavage site probability 0.544 at
FT                   residue 21"
FT   gene            complement(643280..643753)
FT                   /locus_tag="Mmcs_0585"
FT   CDS_pept        complement(643280..643753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0585"
FT                   /product="multisubunit sodium/proton antiporter, MrpC
FT                   subunit"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: nfa:nfa52910 putative cation antiporter membrane
FT                   subunit; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06706"
FT                   /protein_id="ABG06706.1"
FT                   /translation="MTTFLVPLILIGGLTSVGVYLLLERNLTRMLLGLLLIGNAINLLI
FT                   LTVAGPSGNPPVRGRTKAGETTTADPLAQGMILTAIVISMGIAAFVLALTYRSYRLTTA
FT                   EDVGNDPEDTRVSSMAAKEAAALDEDRPPEPDLAIDTDLPDELDALPGREGSR"
FT   gene            complement(643750..646650)
FT                   /locus_tag="Mmcs_0586"
FT   CDS_pept        complement(643750..646650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0586"
FT                   /product="multisubunit sodium/proton antiporter, MrpA
FT                   subunit / multisubunit sodium/proton antiporter, MrpB
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I)
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   nfa:nfa52900 putative cation antiporter NADH dehydrogenase
FT                   subunit; TC 2.A.63.1; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06707"
FT                   /protein_id="ABG06707.1"
FT                   /translation="MLAILCAHAIATALAPLMVARWGRIAFYPLAVVPLVSLVWVALNW
FT                   PEPGGAQTVNLVWLPELSMDITLRFDTLAAIMSVLILGIGALVLFYCGTYFHHRDGHIE
FT                   KRLPSFAAEMVAFAGSMFGLVISDNMLILYVFWETTTVLSFLLVGHYAERATSRRAATQ
FT                   ALLVTTFGGLAMLVGIIILGNLAGTYLLSELVAAPPGGVAAGVGVALILVGALSKSAIV
FT                   PLHFWLPGAMAAPTPVSAYLHAAAMVKAGVFLVARMTPGFADSPVWRPMIIILGLATML
FT                   LAGWRAVREYDLKLILAFGTVSQLGLITIMVGTGGRDMMLAGLAMLVAHAMFKASLFMV
FT                   VGVIDHSTGTRDIRRLAWLGDRSRPMLIIAVGATASMAALPPFLGFVAKEADFETVLHS
FT                   AALGPAAPWVLAGIALGSVFTTIYSLRFLWGAFSRKGLHEPSLRVREMHRPSAAFLAAP
FT                   AVLAAAGLVSGLWPAPLDAVLGDYADTVPGGSDYHLALWHGLNLPLLLSAVVIATGVTA
FT                   FFERSKLRRARVAYLPLGNADHVYDALIRGLDMVSVRLTATTQRGSIPATQSVILCTLV
FT                   VVPAAALALGARDRPDFALWDSPWQVVVGLLMLAAAVGAAVMRNRLAAVLLIGVTGYGC
FT                   GAIFALHGAPDLALTQFLVETLVLVIFVLVLRTLPAEAEKAHIRHKRLPRALLSLAVGA
FT                   TVTSLAVYAMAARTGVGIAELIPDAAYYRGQGANAVNVLLVDIRAWDTMGEISVLLVAA
FT                   TGVASLVFRNRRFGTAPRVSDAGQPDIGRIGNFATSPAVGEITWLRGSELRDPRHRSLV
FT                   LEVATRVIFPLIMVLSAYFFFAGHNTPGGGFAGGLTAGLALVLRYLAGGRYELGETLPL
FT                   DAGKILGVGLALSAGTAVTSLFLGAPVLSSAVIEFDLPVLGTVKLVTALFFDLGVYLIV
FT                   VGLVLDVLRSLGAQVDVEMSQPNPGSGGSAAKVGAR"
FT   gene            complement(646761..648074)
FT                   /locus_tag="Mmcs_0587"
FT   CDS_pept        complement(646761..648074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0587"
FT                   /product="possible tyrosine transporter P-protein"
FT                   /note="PFAM: Arsenical pump membrane protein Citrate
FT                   transporter; KEGG: nfa:nfa7840 putative transporter; TC
FT                   2.A.45.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06708"
FT                   /protein_id="ABG06708.1"
FT                   /translation="MSAAPAVSFSPAPVLALAIFVVAFWFIATERADKVKTVLVAAGLM
FT                   ALLGLIPGEQVFYSEHAGIDWNVIFLLLGMMVIVGVVKQTGLFDFLAIWAAKRSQGKPF
FT                   RLMVMLMLITAFASPVLDNVTIILLIAPVTLVICDRLRIAPQPYLIAEVLASNIGGAAT
FT                   LIGDPPNIIIGSRAGLTFNDFLVHMAPIVLVIFALFVASTRVLFRKDLRANDIRMDEVM
FT                   ALQERRAIRDPRLLVRSLVVLNLVIVGFALHSVLHVAPSVVALLGAGVMLLVTDIDVGE
FT                   VLPEVEWPTLVFFMGLFVMVAGLTHTGVIDALGSVAESAFGDNWFGAATALLFGSSIVG
FT                   AFVDNIPYTATMTPVVESMVTQTPDVATGQALWWAFALGACFSGNGTAIAASANVVAIG
FT                   IAARAGHPISFWRFTRYGIVVTLLSTTLAWGYVWLRYF"
FT   gene            complement(648093..648797)
FT                   /locus_tag="Mmcs_0588"
FT   CDS_pept        complement(648093..648797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0588"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS; KEGG: mpa:MAP2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06709"
FT                   /protein_id="ABG06709.1"
FT                   /translation="MRTGHPRRRTAGLRLRRRQRRACQGTGAGTRRGRRCRGDPAQPPH
FT                   RRPGPVAGTPRRCADRRTGIMTITTATGWTARLNEVAMQAHEIAVSPPTVRMDDPVSKA
FT                   VQLMVVNRLPGLVVVDDADHPIAVLPGTQVLRLTIPETYRDDPALVRTVDEIHADLFWH
FT                   GPGRLTVGDCLPSPVAKPATVAPDATLLEVATVMATKRSPLIAIVDGAGRLTGAVTLER
FT                   LLTSLAVAGPGD"
FT   gene            648884..649981
FT                   /locus_tag="Mmcs_0589"
FT   CDS_pept        648884..649981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0589"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase, dimerisation and
FT                   phosphoacceptor region; KEGG: nfa:nfa7820 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06710"
FT                   /protein_id="ABG06710.1"
FT                   /translation="MVHLHVRQETRGPPSGLTPISGGRCRVWTSSGRDATLVGMNRART
FT                   PAAALFRRVFLINGLIFTLGTLVLAVSPASVSSRIRLTEIPVLVVGLAVILSANALLLR
FT                   SSLAPLDRLTASMRRVDPPRRSDRVDDRGSGDLHHLIESFNAMLDRLETERTTASASAL
FT                   AAQENERQRIARELHDEIGQTLTVALLTLKRAVDRAPAEIRGELEETQETVRASLDEVR
FT                   GIARRLRPDALEDLGLQSALNALCNEFAQATGLPVVKHIALPAARLAPDVELVCYRIAQ
FT                   ESLTNVARHADARKVWVDLHVADDQVTLRIADDGAGGAGDAGEGAGISGMRERALLVNA
FT                   TLTIASPPGEGTEVRLTIPYRDGSR"
FT   gene            649981..650628
FT                   /locus_tag="Mmcs_0590"
FT   CDS_pept        649981..650628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0590"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR response regulator
FT                   receiver Sigma-70, region 4 type 2; KEGG: nfa:nfa7810
FT                   putative two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06711"
FT                   /protein_id="ABG06711.1"
FT                   /translation="MPARILLADDHALVRSGLRLIIDAEPDLQVVAEAADGHEALEALE
FT                   RTPTDLAILDIAMPRMTGLQAAREISRMHPHVRILILSMHDNEQYFFEALKAGASGYVL
FT                   KSVADRDLLAACRATLRGEPFLYAGAVTALIRDYLHRARSGDELPDTILTPREEEVLKL
FT                   VAEGYSTREIAATLSISAKTVDRHRANILAKLGLRDRLALTRYAIRAGLIEP"
FT   gene            complement(650588..651055)
FT                   /locus_tag="Mmcs_0591"
FT   CDS_pept        complement(650588..651055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0591"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   tfu:Tfu_2119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06712"
FT                   /protein_id="ABG06712.1"
FT                   /translation="MTVPTTVRVGDDDRTRTANLLGLALAQGYLDMPDYEQRLQAAFAA
FT                   QTNTELHSLTADLPVATLRRNDPARRAERRRAARRGVRWHLAGYLAMVVIVLTVWLAVG
FT                   LAAGAWYFWPIWPILGAGIGVLGHALPVRYVGGSPCGRLTARSVPPGWRIG"
FT   gene            complement(651149..653374)
FT                   /locus_tag="Mmcs_0592"
FT   CDS_pept        complement(651149..653374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0592"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: mpa:MAP3928c putative cell division protein
FT                   ftsH homolog; PFAM: AAA ATPase, central region; SMART:
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06713"
FT                   /protein_id="ABG06713.1"
FT                   /translation="MTEAGLSEREPNLSHLRLTARLNTAALDSRRGVVRLHPEVIAALG
FT                   IREWDAVSLTGARTTAAVVGIAPPGTPTGTALLDDVTLSNAGLPENSSVIVAPVTVYGA
FT                   RSVTVSGSRLATNSISPATLRQALLGKVMTVGDTVSLLPRDLGPGTSTSSATTALASSV
FT                   GITWTSELLTVTSVDPPGTVSIQPNSSVTWGDGPAPKAASAGPTDGAAVGEATVTTPSV
FT                   DRPAVSFDDLKGSHAQAGRLTEWLKLSLDEPSLLETLGATAHLGVLVSGPAGVGKATLV
FT                   RTVCAQRRLVELDGPEVGALHAEDRLNRVSSAVSTVRDGGGVLLISDIDALLPATPEPV
FT                   GTLILTELRTAVATPGVAFVATSARPDGVDARLRDPDLCDRELGLSLPDAATRKELLEV
FT                   LLRSVPAQELHLDEIAGRTPGFVIADLCALVREAALRAAARASADGAPPQLTQADLTGA
FT                   LTVIRPLSRSATEEVSVGSVTLADVGDMTETKQALTEAVLWPLQHPDTFERLGIEPPRG
FT                   VLLYGPPGCGKTFVVRALASSGRLSVHAVKGAELMDKWVGASEKAVRELFRRARDSAPS
FT                   LVFLDEIDALAPRRGQSFDSGVTDRVVASLLTELDGIEPMCNVVVLGATNRPDLIDPAL
FT                   LRPGRLERLVFVEPPDAEARREILRTAGKSVPLADDVDLDTLAAGLDGYSAADCVALLR
FT                   EAAMTAMRRSIDAADVTAADVEAARQTVRPSLDPLQVDTLRAFAENR"
FT   gene            complement(653376..654242)
FT                   /locus_tag="Mmcs_0593"
FT   CDS_pept        complement(653376..654242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0593"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: mpa:MAP3929c CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06714"
FT                   /protein_id="ABG06714.1"
FT                   /translation="MIQPRSIPKRVVSLRMLPSAMTVAAICLGLSSVKFALDGRPTEAM
FT                   AFLAVAAILDALDGRIARMLKATSKMGEEIDSLADAVNFGVAPAFIVYGTLLSQSRIGW
FT                   IVVLLYAVCIVLRLARFNAMLAEDLPAYTKEFFVGMPAPAGAIGAIGPLAAKMQFGDGW
FT                   WTSEIAVVIWMVGVSLLVVSTIPMRKIHTFSVPPNMVAPLLALLAIGVTASILYGYLVI
FT                   LVIILAYVIHIPFAVRTERWLAAHPETWDDKPRQRRAIRRASRREIRRTQPHRRSVARL
FT                   GLRKPGR"
FT   gene            complement(654239..654997)
FT                   /locus_tag="Mmcs_0594"
FT   CDS_pept        complement(654239..654997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0594"
FT                   /product="Phosphatidylserine decarboxylase-related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: mpa:MAP3930c phosphatidylserine decarboxylase;
FT                   TIGRFAM: Phosphatidylserine decarboxylase-related protein;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06715"
FT                   /db_xref="GOA:Q1BEG9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEG9"
FT                   /protein_id="ABG06715.1"
FT                   /translation="MGPELACPTPHARRIQPMARRPSTDDLRSGPERFMALVKTTVPPV
FT                   HPAGLPFIGAGLALAAAGRRNRWVRGAGLVAAGANAAFFRHPPRVPPTRPGVVVAPADG
FT                   LICLVEDAEPPAELNLPARPVPRVSIFLSIFDAHVQRIPISGEVVAVEHRPGLFGSAEL
FT                   AAASEDNERNSVVIRTDTGAQVIAVQIAGLVARRIVCDLTTGDKVTIGDTYGLIRYGSR
FT                   LDTYLPEGTDIQVLPGQRAVGGETILAELP"
FT   gene            complement(654982..656178)
FT                   /locus_tag="Mmcs_0595"
FT   CDS_pept        complement(654982..656178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0595"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="PFAM: molybdopterin binding domain MoeA-like, domain
FT                   I and II MoeA-like, domain IV; KEGG: mpa:MAP3932c
FT                   molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06716"
FT                   /protein_id="ABG06716.1"
FT                   /translation="MRTVEEHQRVVAGLIERRPPVRLPIAATLGLTLAEDIVAPLSLPG
FT                   FDNSAMDGYAVVAEDVADATEDRPVYLPVAEDIPAGRTDPLVLQPGTAHRIMTGAPLPR
FT                   GATAVVPVEATNAATDTVAIRSAAKAGQHVRTAGEDVTAGTTVLRAGVALTPAALGLAA
FT                   ALGLGELSVIAPQRVLVMSTGTELVAPGIPLLPGQIYESNAVMLAAAVREAGGEVVAST
FT                   MTGDDVDAFRATLDRYAGQADLIVTTGGVSAGAYEVVKDTLGSSEVEFAKVAMQPGMPQ
FT                   GAGRVGETPVITLPGNPVSALVSFEVFLRAPLRAAMGADRPERPRRSAVLTEDLTSPRG
FT                   KRQFRRGVFDQHTGEVTSYGPPASHHLRWLASANCLLEIPEDVSELPAGSRVEVWDLS"
FT   gene            complement(656181..657101)
FT                   /locus_tag="Mmcs_0596"
FT   CDS_pept        complement(656181..657101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0596"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mbo:Mb0447c short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06717"
FT                   /protein_id="ABG06717.1"
FT                   /translation="MSANTKWTAADVPDQEGRVAVITGANTGIGYEAAAVLAAKGAHVV
FT                   LAVRNTDKGGAAAERIRSALPHADVTVRELDLTSLDSIREAADGLRADYPRIDLLINNA
FT                   GVMMTEKGATKDGFELQLGTNHLGHFALTGQLLDNLLPVEGSRVVTVSSNAHRWGRVNF
FT                   DDLQSERSYNRVTAYGQSKLANLLFTYELNRRLSAKGAPTIAVAAHPGTSSTELTRNLW
FT                   PVARRPVELVWGLVAQTPEMGALPTLRAATDPDVRGGQYYGPDGIGEQRGHPKLVQSNA
FT                   RSYDEAAQRRLWSVSEELTGVTFPV"
FT   gene            657156..657653
FT                   /locus_tag="Mmcs_0597"
FT   CDS_pept        657156..657653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0597"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mbo:Mb1259c
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06718"
FT                   /protein_id="ABG06718.1"
FT                   /translation="MEYAPLVLADPEHRPSAKAPLLWAASAALPWLVLVVAQVAWWVTD
FT                   PASGWLHAVAAAGTVLGIVLFVGVVPVWRYRVHRWAVDARAVYTRTGWLTQERRIAPIS
FT                   RVQTVDTQRGPLDRMFGLSSVTVTTASSAGAVRIVALDAPVAERIVAQLTDIAALGEQD
FT                   AT"
FT   gene            657686..659110
FT                   /locus_tag="Mmcs_0598"
FT   CDS_pept        657686..659110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0598"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mbo:Mb1258c
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06719"
FT                   /protein_id="ABG06719.1"
FT                   /translation="MSPRMLLVHPVHEVLRQVPVLIGSVVLGSATGNPWWAVAALVGTV
FT                   GVGIARWFTTTYRIDAEEVQLRAGVLQRRVLSVPRNRIRSVSTDARLLHRVLGLAVLRV
FT                   STGQEARGDDAFALDAVEAAQVPHLRAELLAESLTIAADPEHRGRVLARWQPAWLRYSP
FT                   LSFTGLAMIAAAAGLLYQAGAGVLLRDSSLAEGGRGVAERFGVAATVAVVVLAVLVGSV
FT                   VLSVLRSLVTYGNLLLWRDGEVLHLEHGLLRRQEHTYDMRRLRGGTLREPLLVRAFGGA
FT                   RLDAVMTGVGGEGEASLLLPPCPAATARAVLSDLIADEEEVAGPLRSHGVAAARRRWTR
FT                   ALAVPVAMGVALVVATVFTAPPIWLWAVWAVLAVCCALLAADRVRSLGHRAGHGWLVAR
FT                   TGSLERRRDCIAGPGIIGWTVQQTFFQRRSGVATLIAATAAGEKAYRVVDVPADAAWSI
FT                   VAAASPWVRDVPWARD"
FT   gene            659156..659971
FT                   /locus_tag="Mmcs_0599"
FT   CDS_pept        659156..659971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0599"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase-like hydrolase; KEGG:
FT                   mbo:Mb1257c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06720"
FT                   /protein_id="ABG06720.1"
FT                   /translation="MAIGGVLFDIDGVLVTSWRPIDGAAEALRVLSDHQIARSYLTNTT
FT                   TKTRRQIADLLVDAGMAVTADEVITAAVLTAEYVRDRYPGARCFLVNSGRIGEDMPGVD
FT                   LVYAGEFGPDHVPETPDVVLLGGAGPEYDHLTLSWVYDWMARGVPVVAMHRSTSWNTAD
FT                   GLRIDTGMYLIGMEETSGRKATAVGKPAPEGFLAAAGRLGVDPEEMYIVGDDLNNDVLA
FT                   GQVVGMTGVLVRTGKFRQDTLDRWAADEFAMQPNHVIDSVADLPGLLGL"
FT   gene            660085..661467
FT                   /locus_tag="Mmcs_0600"
FT   CDS_pept        660085..661467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0481c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06721"
FT                   /protein_id="ABG06721.1"
FT                   /translation="MPRTGAHAVVCGASMAGLLAARVLTEHYDRVTVVERDRLVDEPVA
FT                   RRGVPQSCQPHALLARCAQILDELFPGYLDELVAAGAHRWDDGDMSKFDISFGGHVMLQ
FT                   NAMMPKPESLVQHYASRPMLEHHVWRRVRELPRVDILDGHHVDRLLGSGPRVTGVRLSH
FT                   KCGATIDLDADLIVDASGRGSRTPALLAELGYQRPEVDELVIRVAYASMPVRIPPDALR
FT                   QNLIVRMFEPGRPRGFVMFRCERDVWLVAAGTLGPIRPPTTPAELLDFGEGIAPAYALA
FT                   AARAAEPLAGVRVHQYPSNRWRRYDKLKRFPAGFVVLGDAFCSFNPIYGQGMTVAAIEA
FT                   TILRDCLRAGDADLPRRFHRAAAKTIRIAWQTAVGSDLALPEVQGRPSLSMRLTNAYTD
FT                   RVLRAAETDPVVSRDFLRVVGMVAPPAQLVHPATLARVARGQRRRATPVGDGAPVLTAA
FT                   GR"
FT   sig_peptide     660085..660147
FT                   /locus_tag="Mmcs_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.749) with cleavage site probability 0.278 at
FT                   residue 21"
FT   gene            complement(661448..662536)
FT                   /locus_tag="Mmcs_0601"
FT   CDS_pept        complement(661448..662536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0601"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG:
FT                   bur:Bcep18194_B1407 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06722"
FT                   /protein_id="ABG06722.1"
FT                   /translation="MVTLDEFSRLVSAIHDAAVTPDRWVDTMTDVRHSLGAITGAMLIA
FT                   DDVGRAADRASLPPDAHRTYREYYHRIDYVLEAVERGPVGLIHSGRQLIEQDERSEFNV
FT                   DWIRPNHMDDGMFVRLTGNDHPACFIVANPRRDESFVTTERAELVTALVPHFQQALRTE
FT                   KHLAELRRDAGDLAGAIDSMRQAVLVTGVNGIVLHSNAACDALIHRADGLTVRSGRLCA
FT                   FRSDVDCAVQRALADALGMNEAGARFGTSVLCPRPSGDRAYVAHAFPFPNREGEPRAIV
FT                   VIVDPDHRPQPPKDMLRNLFGLTNGEADVALRVANGQGLAPISDELSVSLATVKTHLQH
FT                   VFDKTDTHRQAELVRLLTALLP"
FT   gene            complement(662669..664351)
FT                   /locus_tag="Mmcs_0602"
FT   CDS_pept        complement(662669..664351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0602"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit
FT                   DEAD/DEAH box helicase-like; KEGG: mpa:MAP2985 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06723"
FT                   /protein_id="ABG06723.1"
FT                   /translation="MRAYAAPDTQALRGWQRRALVRYLGAKPRDFLAVATPGAGKTTFA
FT                   LRIAGELLADGTVERVTVVVPTEHLKIQWAQAAARSGIALDPKFSNSSAQTSSEYHGVV
FT                   VTYAQVASHPTRHRVRTENYRTLVIFDEIHHGGDAKTWGDAMREAFSDATRRLSLTGTP
FT                   FRSDDSPIPFVNYVPDAEGLLRSESDHTYGYADALADGVVRPVIFLAYSGEARWRSSAG
FT                   EEHAARLGEPLNAEQTARAWRTVLDANGEWIPAVLKAADTRLRQLRAGGMPDAGAMIIA
FT                   TDQTAARQYAALLTKMTGEAPTLVLSDDPGSSARIAEYSAGDTPWLVAVRMVSEGVDVP
FT                   RLAVGVYATSASTPLFFAQAIGRFVRSRRPGETASIFVPSVPTLLDLASQMEAQRDHVL
FT                   GKPHRESMGDEELVERRRSEPTEEDRGFESLGASAELDQVIFDGASFGTATPAGSEEEA
FT                   DYLGIPGLLDADQMRDLLRRRQEEQLTRRTASGEPPPVTPYGQLRELRQELNTLVSLAH
FT                   HRLNKPHGWIHNELRRICGGPPVAAATSDQLQARIAAVRTLKA"
FT   gene            664541..667087
FT                   /locus_tag="Mmcs_0603"
FT   CDS_pept        664541..667087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0603"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; KEGG: dra:DRA0188
FT                   excinuclease ABC, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06724"
FT                   /protein_id="ABG06724.1"
FT                   /translation="MTATSDARDDEHDPCVRVFGTRVHNLKGVDVAAPRDALVAFTGIS
FT                   GSGKSSLAFGTIYAEAQRRYFESVAPYARRLLLPTGAPKVDDITGLPPAVALQQRRGTA
FT                   TSRSTVGTVTTLSNLLRMLFSRAGTYPRGATERLDSDAFSPNTAVGACPECHGLGRIHQ
FT                   VTEQTLVPDPSLTIREGAVAAWPGAWQGQNLRDILITLGYDIDRPWHKLPKRQRNWILF
FT                   TDEQPTVEIDPSQHPVTADYYYNGTFSSAERHVRHTLANSQSATMRRRVLQYVDTVECG
FT                   MCGGSGLRPEALKVTFAGRTIADYVAMPLAGLAEALRPVAARTDAAAAYESTASGEFTE
FT                   VATMIATDLVARLQVLIDLGLGYLTLNRRTPTVSPGELQRLRLATQLRAGLFGVLYVLD
FT                   EPSAGLHPADAEPLLEVLDRLRRAGNSVFVVEHDMDVVRRADWIVDVGPGAGELGGQVL
FT                   YSGPVPGLAEIGESVTGRYLFDSAPTATRTPRPPSGWLRMGGISSHNLRDLDVDLPLGV
FT                   FAAVTGVSGSGKSTLVVKVLGDVVNRHLGRAVNQPDADAADGEDPDAEIVDLDHDASVG
FT                   VSVEGVEAITRLVAVDQRPIGRTPRSTLATYTGLFDAVRREFAATSAARRRGWTAGRFS
FT                   FNVAEGRCPTCQGEGFVSVELLFLPGTYATCPTCHGARYNEATLGVRYRGRTIAEVLAM
FT                   TVDEAREFFADIAGASRSLATLHEVGLGYLRLGQPATELSGGEAQRIKLASELQRPKRG
FT                   HTLYVLDEPTTGLHPADVDLLDAQLHRLVDAGNTVVVAEHDMRMVAGSDWVVDLGPGAG
FT                   ADGGQVVAAGTPAEVSRVDRSRTAPYLAARLGHSTK"
FT   gene            complement(667072..667569)
FT                   /locus_tag="Mmcs_0604"
FT   CDS_pept        complement(667072..667569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0604"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG: mpa:MAP3934c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06725"
FT                   /protein_id="ABG06725.1"
FT                   /translation="MSLVVPPYPPPRYTEDEPAVSAWVRRGDEPPDYDAFGLVRYHYLA
FT                   DQKATGGDYGLYRVEIAPRGGGPGPHYHRAMSEAFFVLSGSIKLYDGTEWSDGNPNDFL
FT                   YVPPGGIHGFRNESDEPASILMLFAPGAPREHYFEGLAHLGELTDDERREWFVENDNYF
FT                   VE"
FT   gene            complement(667581..668483)
FT                   /locus_tag="Mmcs_0605"
FT   CDS_pept        complement(667581..668483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0605"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mbo:Mb0069 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06726"
FT                   /protein_id="ABG06726.1"
FT                   /translation="MTKWTTADIPSQSGRTAVVTGANTGLGLETAKALAARGAHVVLAV
FT                   RDTEKGKRAADEITAAHPEAAVGVQSLDLGSLRSVRTAAEALKADFPRIDLLINNAGVM
FT                   YPPKQTTEDGFELTFGTNHLGHFALTGLLLENVLAAPNSRVVTVSSQGHRIRAAIHFDD
FT                   LQWERSYSRVGAYGQSKLSNLLFTYELQRRLDTRDAIAVAAHPGVSNTELMRHLHLPPV
FT                   FNPLVGVLTQSPTMGALPTLRAATDPTVRGGQYFGPSGLGEIRGYPELVTSSAQSRDVD
FT                   LARRLWTVSEELTGVAFPL"
FT   gene            668581..669165
FT                   /locus_tag="Mmcs_0606"
FT   CDS_pept        668581..669165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0606"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mbo:Mb0068c
FT                   possible transcriptional regulatory protein (possibly
FT                   TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06727"
FT                   /protein_id="ABG06727.1"
FT                   /translation="MARDAAGARPLRADAARNRDRVLRVAYETFAADGLTVPVDEIARR
FT                   AGVGPGTIYRHFPTKEALYTAVVEHRLYEMIERGWELLASGDPGEALFDFLRAIAVEWG
FT                   AADRVLIDGLAGWGLDVHTVAPEADAAARALLAELLAAGQRAGTVRADLTAPELKSILV
FT                   GLQAIGAYDAAVAARATAVVADGLRPPPSRH"
FT   gene            669240..670970
FT                   /locus_tag="Mmcs_0607"
FT   CDS_pept        669240..670970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0607"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: mpa:MAP3936 60 kDa chaperonin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06728"
FT                   /db_xref="GOA:Q1BEF6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEF6"
FT                   /protein_id="ABG06728.1"
FT                   /translation="MRRGSAPAGHTQAVRRGHWTRPTRTCIRYRRKHFAMAKTIAYDEE
FT                   ARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPYEKIG
FT                   AELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTE
FT                   TLLKSAKEVETKEQIAATAGISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLEL
FT                   TEGMRFDKGYISGYFVTDAERQEAVLEDPYILLVSSKISTVKDLLPLLEKVIQSGKPLL
FT                   IIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVISEEVGL
FT                   SLETADISLLGQARKVVITKDETTIVEGAGDAEAIQGRVAQIRAEIENSDSDYDREKLQ
FT                   ERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALLQAAPS
FT                   LEELNLTGDEATGANIVRVALEAPLKQIAFNGGLEPGVVAEKVRNSAAGTGLNAATGEY
FT                   EDLLAAGVADPVKVTRSALQNAASIAALFLTTEAVVADKPEKSAAPAGDPTGGMGGMDF
FT                   "
FT   gene            671160..672032
FT                   /locus_tag="Mmcs_0608"
FT   CDS_pept        671160..672032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb3585c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06729"
FT                   /protein_id="ABG06729.1"
FT                   /translation="MHHVNGPFLAREALDDGLLTFRELRRFHRADFPGVWMLRGSDLSM
FT                   DQLAHAAWLWSGRKAVVAGLAASALHGAKWIEPGAPVELVHTNRRPPTGIVVRTETLAP
FT                   EEMQRVGTLPVTSACRTVFDLGRRLRLGDGVQRIDALLNATDVKIADVEAVIARHPGVR
FT                   GLRQLRETLALVDGGAESPYESLTRLVLVQAGFPPPQTQIRVCDENGYVFARVDMGWPE
FT                   YLVGVDFEGAQHWTDPKQRSGDVVRYTRLAEMGWIDVRLTSGILHTRRQWFLDQVGAAL
FT                   ESRRCPKTW"
FT   gene            complement(672103..673824)
FT                   /locus_tag="Mmcs_0609"
FT   CDS_pept        complement(672103..673824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0609"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: D-aminoacylase-like Amidohydrolase 3; KEGG:
FT                   mpa:MAP3940c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06730"
FT                   /protein_id="ABG06730.1"
FT                   /translation="MTFELVIRNGTIVDGLGGEPYAGDVAVSGGAIAAVGAVTERGDRE
FT                   IDATGLLVTPGFVDLHTHYDGQAIWSDRMTPSSAHGVTTAVMGNCGVGFAPCRPQDHDV
FT                   LVDVMAGVEDIPGVVMVDGLPWDWETFPEYLDAVDSRSRDIDVAAYLPHSPLRVYTMGQ
FT                   RGADREPATGEDLARMRALAKEAVEAGALGFASSRFALHKTSSGSPIPTYDAAQAEIAA
FT                   IAAGVADGGGGLLQFVPDIPAGGYETVLRQVFEVAADVGLPVTFSLLTGNTGDPVWPQA
FT                   MNLVEKFNAAGGSITAQMFPRPIGMVIGLEVSGNPFIMYPSYQEIADLPLAERVAEMRK
FT                   PEVRERILNDTPSAPGHPLMFMVQAWNWIFPLGENPDYEPAASTSIAARAAARGVSPLE
FT                   EAYDRLLDEDGHAMMLVALGNYENNSLDTVGELMHRDDVVLGLGDGGAHYGMICDASFP
FT                   TFMLTHWTRDRATGRLSVAEAVRELTSVPAGVAGLADRGRIAVGYKADLNVIDHAALHL
FT                   HKPVVVHDLPAGGKRLDQTADGYVATVVSGVVIAERGVPTAARPGKLVRGRQPAPA"
FT   gene            673847..674236
FT                   /locus_tag="Mmcs_0610"
FT   CDS_pept        673847..674236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0610"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpa:MAP3941 GloA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06731"
FT                   /protein_id="ABG06731.1"
FT                   /translation="MIDHFGINCADLDRSKEFYDKVLGVLGYTRQMDFGVAVGYGTEGH
FT                   PDFWIADMSEGNVAGPNREIHVGFAAKDAESVQAFYRTALALGAEPLHEPRLWPEYHEN
FT                   YYGAFVRDPDGNNVEAVFHGGGPRA"
FT   gene            674260..674778
FT                   /locus_tag="Mmcs_0611"
FT   CDS_pept        674260..674778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06732"
FT                   /protein_id="ABG06732.1"
FT                   /translation="MPDSDAAAARELLRDSFTRLIEHVEDLTDELTDEVALYRPTATAN
FT                   SIAWLLWHSARVQDAQVCDIAGTEQVWTREGYVDQFALDLPRDDTGYGHSPDDVGKVRV
FT                   SADLLAGYYSAVHKMTLAYIASVTPEDLGQIVDRRWDPPVTASARLVSIIDDCAQHLGQ
FT                   AAYVQGISR"
FT   gene            674779..675318
FT                   /locus_tag="Mmcs_0612"
FT   CDS_pept        674779..675318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0612"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   nfa:nfa24800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06733"
FT                   /protein_id="ABG06733.1"
FT                   /translation="MRSALHWWPVVAVAMMFALGLLVGRGSTPLDSRLLEIDIPDRLLV
FT                   FVQAPAQVAVLGAAVAYALWRKRWRLAAVTALCPPVAVVSAQLLKRVFGRTRDGELAYP
FT                   SGHITALVVVAGMVVLVAGGRLWAVAAAAVAVVVGMVLVGMSFHYFTDTVGALLLGSAW
FT                   VAVAARLVARTPSRAT"
FT   gene            675372..676889
FT                   /locus_tag="Mmcs_0613"
FT   CDS_pept        675372..676889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0613"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: nfa:nfa3930
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06734"
FT                   /protein_id="ABG06734.1"
FT                   /translation="MTATPEVDARDSSTIRNPATGAVAGQVRWTDPADVTRIAAGLRAA
FT                   QTDWEARGAKGRAKVLARYAVWLGEHRAEIEDLLIKETGKSAVDAAQEVPLILMITSYY
FT                   VRTMEKALAPDSRPAALPFLSIKKITVHYRPRPVVGIIAPWNYPVANALMDAIGALAAG
FT                   CAVLLKPSERTPLTAELLLRGWQDSGAPEVLALAQGAREVSEAVIDNSDFIQFTGSSAT
FT                   GAKVMERAARRLTPVSLELGGKDPMIVLEDADVELAAHAAVWGAMFNAGQTCVSVERVY
FT                   VLESVYDQFVDAVVRDVKNLKMGAGEGNDFGALIDDGQVSVTERHVEDAIAKGAKALTG
FT                   GERRNGPGSFYEPTVLVDVDHSMACMTEETFGPTLPIMKVKSVEEAVRLANDSPYGLSA
FT                   AVFSKDVDRAKAVALQLDCGGVNVNDVISNLMCTTAPMGGWKTSGIGARFGGPEGLRKY
FT                   CRVETVVAPRTNVGAGGNYYNNSPKALKRMNTMMTKLALIRPRRMAK"
FT   gene            676907..677776
FT                   /locus_tag="Mmcs_0614"
FT   CDS_pept        676907..677776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06735"
FT                   /protein_id="ABG06735.1"
FT                   /translation="MRFVLTALLWLLTTVLLAAAVPAVWAQQNLVSEQGYTEFAESAAT
FT                   DTRLRDAMADELTTQIVALAADRGYGLNEMLVHQVTSAYTGNAGFPGQFAQANRIAHRW
FT                   MFSDGVPQANADDQWLIDIAPMLSDPSLAATLGNLDLDVPDSLMVPVTVPSPELRPGRL
FT                   QAVATWGPWVSIGLAVLTAVFALLTLASSRRRGKGLAALGVSALLVGAAGWAGLEVANG
FT                   YIDDALNRTEGNFRRIADEMVRHAEDSLHHWLNLTLAAGGALVAVGVVVSLLGGLGRPP
FT                   ERSGIDRV"
FT   sig_peptide     676907..676987
FT                   /locus_tag="Mmcs_0614"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            complement(677756..678658)
FT                   /locus_tag="Mmcs_0615"
FT   CDS_pept        complement(677756..678658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0615"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mpa:MAP3949c EchA2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06736"
FT                   /protein_id="ABG06736.1"
FT                   /translation="MTEFETLLYRTDTDAAVATITLNRPDQLNTIVPPMPDEIESAIGL
FT                   AERDPQVKVIVLRGAGRAFSGGYDFGGGFAHWDESMNSDGRWDPGKDFAFVTGRATSPT
FT                   GKFMSIWRASKPVIAQVHGWCVGGASDYALCADIVIASDDAVIGTPYARMWGAYLTGMW
FT                   LYRLSLAKVKWHSLTGEPLTGVEAAAVELINESVPFERLEARVAEVAGRLARIPLSQLQ
FT                   AQKLIVNQAYENMGLASTQTLGGILDGLMRNTPEALEFIATAESHGVRAAVERRDGPWG
FT                   DYSQAPPHRRPDPSHSIDP"
FT   gene            678701..679924
FT                   /locus_tag="Mmcs_0616"
FT   CDS_pept        678701..679924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0616"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: nfa:nfa43600 cytochrome
FT                   P450 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06737"
FT                   /protein_id="ABG06737.1"
FT                   /translation="MGASGRRLTGARAAATLADLGPASTAARAVRRMQQLREQFGAGPV
FT                   ELVLPGRRMVVVLDPDDVRRVLAGAPEPFHPANREERKSLEWSQRRDLDDAALDSGAEM
FT                   HRLAGAFGDVIAAEARELTDEVTARGTMDANQFMAAWWRIVRRIALGDRARDDDEITDA
FT                   LLRLRRARNWSFLSMPHYRTRARFLERLYDYVEDPQIGTLAAAVPASGAVDPVGPLPQW
FT                   LFAFDAAGIAQLRALAVLATHPAAMARAIEDAAEPDRLRLRPFLRACVLESVRLWPTTP
FT                   TILRETTEKGAGLMIVTPAFHRDPKLLPFANDFVPDIWLDGRARSYPQLVPFSAGPAEC
FT                   PGRNLALFTTSTLLANLLSALDFRISSMPHLSPDEPLPVTLNQHGLEFAVVTAPRWRHH
FT                   RAGSAVRS"
FT   gene            complement(679872..680726)
FT                   /locus_tag="Mmcs_0617"
FT   CDS_pept        complement(679872..680726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0617"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:bll2711 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06738"
FT                   /protein_id="ABG06738.1"
FT                   /translation="MSTDFDRRERKAFDLTGKVVVVVGAGQSPGPGMGNGRAISLLAAR
FT                   HGAEVVAVDLNPAAVKETVEMILAEGGKAYAIEADVAEKDDCRRIFDTAMATSGRVDGM
FT                   VYSVATNPPFDIETNSMTVENFNRGINVNMLGCYYCNLYAAQCMERNDGDSTGSIVNLS
FT                   SIASVKNELGLNIGIMPYALGKSGLNQITELTAVQYAAAGIRANTLMLGPIDSVLAKND
FT                   SQSLFGLDAEEATQRHNEVVKLKMGRGSVWESAYAAVYLLADESRFMTGQQIRLDGGAT
FT                   LVR"
FT   gene            complement(680716..680922)
FT                   /locus_tag="Mmcs_0618"
FT   CDS_pept        complement(680716..680922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0618"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding; KEGG:
FT                   chy:CHY_1120 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06739"
FT                   /protein_id="ABG06739.1"
FT                   /translation="MRVTVDDDLCRGHGVCAAVCPSVFVITDGGYAEATADGIPPDLEA
FT                   SVREAVDGCPEHAIHIKEENHVN"
FT   gene            complement(680919..682190)
FT                   /locus_tag="Mmcs_0619"
FT   CDS_pept        complement(680919..682190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0619"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP0727
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06740"
FT                   /protein_id="ABG06740.1"
FT                   /translation="MTTLESLDFFHDETLIDDPYPVLNQMREAGPVLREPVHGVMIVTG
FT                   YDEALAVLGDPETFSSCNSVTGPIPGFPVPLEGLDGAEVSALIDAHREELPFSDQLPSF
FT                   DPPKHTAHRSLLSRLITPKRLKENEEFMWTLADRVLDPFLAQGGGEFIRQVAGKFALLV
FT                   VADLLGVPEEDHAELTARLTGDMALGSTDDTVMEHAPLEYLYTRFTDYIDDRRKAPRDD
FT                   IMTGMALATFPDGSTPEVIDVVRVAANLFSAGQETTVRLLSTALQLVAENAELQAALRD
FT                   SPDKISNFNEECLRFESPIKGDFRLARATTTLGGVEIPAGTTLMVHLGAANRDPRHFDN
FT                   PNVFDPDRPNARRHIGFGRGVHSCIGAPLARAEGRVLLERLLARTTAITIDEAAHGPAG
FT                   ARRYAYVPTYVLRGLTDLHVKVTR"
FT   gene            682303..682884
FT                   /locus_tag="Mmcs_0620"
FT   CDS_pept        682303..682884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0620"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP0770c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06741"
FT                   /protein_id="ABG06741.1"
FT                   /translation="MSSQTIAHGGPTRQRLIDVAIELFKQHSVAGTSLQMISDELGLTK
FT                   SAIYHHFRTRDELLSAVMEPLIAEVTALVEAAEARTGVRARADHLLCGYAALAAAHRDL
FT                   IPLLTGDPGVVALLRIRADWGAVVERQMAVFAAVEPGLGGQVKAAVVMSGIASAAGADY
FT                   GDADDAELRDQLIAAGRRALGLRAPHGRSR"
FT   gene            complement(682892..684367)
FT                   /locus_tag="Mmcs_0621"
FT   CDS_pept        complement(682892..684367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0621"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mtu:Rv3776 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06742"
FT                   /protein_id="ABG06742.1"
FT                   /translation="MFDTVFAGLEESALLAAIEQSAREEAQAGARKLAAIAQLVHLTVT
FT                   CDEECDGWVYDSWAAAASEIGAVLNIGHKRASGQMRIAVALRDRLPKVAALYLQGRLSA
FT                   RLISEISWRTRLVDDEQVLGLLDAALAEAALRWGPLSEARLARALDAVIHRYDRDAVIR
FT                   AKDTVKTRDFHIGSVDDPDELVLVWGQLLGCDAAALSARIAALLKGICDNDPRSVGERR
FT                   SCAVGAIVQGHDHLPCRCGSPACAAAAPEKSNVVISVIADPAAVEAAQKLIAAEDEHHA
FT                   AKDEPEPVPCPQDSGVALLPGVKLLPIVALAEAIRGGAAIKPLWLPGPDPEPHYRPSAT
FT                   LAAFVRARDLFCRFPGCDVPAERCDIDHVVPWPYGPTHASNLNCKCRTHHLGKTFWDGW
FT                   HDEQSPDGTVTWTTPTGKRHTTVPGSRLFFPEWDTTTAELPPLAQPPPDPGRTAKMPKR
FT                   RRTRAADNAARVKAEREHNAAQRNSRAERPPPF"
FT   gene            complement(684463..685743)
FT                   /locus_tag="Mmcs_0622"
FT   CDS_pept        complement(684463..685743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0622"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: cgb:cg2914
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06743"
FT                   /protein_id="ABG06743.1"
FT                   /translation="MVAVNEPIDPLVRLAISQWPDNAPRGAVSTFCAEYGISRKSFYEL
FT                   RKRVKTEGPAAVLEPMTRRPKSSPSKLSDEVKEQALAVRAALEATGLDHGPISVHDKMH
FT                   AMGLERVPSTASLARVFREAGVARLEPKKKPRSAWRRFVYPAPNACWQLDATEYVLSGG
FT                   RRCVIFQLIDDHSRYALASHVALSETAKEAIAVVDKAIAAHGVPQRLLSDNGIALNPSR
FT                   RGHVGQLVAHLAALGVEAITGKPYKPTTQGKNERFHQTLFRYLDKQPIAESLAELQCHV
FT                   DAFDGIYNTERPHQGLPGRVTPRTAWEATAKAPAPRPKPDPPSFDHAVVRPHRPAPTPA
FT                   DLPHGTSVKTLNTAGAFVLAGVTYKVDGRRSLEQVLVVIDGDKITAADLDGEVLIEHTR
FT                   PAPGITYVGNGRPRGPHPKTTQTSPKS"
FT   gene            complement(685874..687865)
FT                   /locus_tag="Mmcs_0623"
FT   CDS_pept        complement(685874..687865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0623"
FT                   /product="Prolyl oligopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site region peptidase S9A, prolyl oligopeptidase-like
FT                   beta-propeller; KEGG: mbo:Mb0466c probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06744"
FT                   /protein_id="ABG06744.1"
FT                   /translation="MTVDDAHLWLEDITGDDALDWVRRHNEPTLADLGGERFEQMRAEA
FT                   LEVLDTDARIPYVRRRGEYLYNFWRDAANPRGLWRRTTLESYRTEEPDWEVVIDVDALA
FT                   RADDENWVWAGADVIDPDHTRALISLSRGGADAAIVREFDMVSMEFVDGGFELPEAKTA
FT                   ITWEDEDTVLVGTDFGEGALTESGYPRLVKRWRRGTPLTEAETVYSGEPADVIVTASVD
FT                   RTPGFERTVVRRAVDFFNDEVYELRAGELSRIDAPTDATVSAHRDWLLIELRSDWDGYR
FT                   AGSLLAAKYDEYLDGTRALQVVFEPDEHTCLHHYAWTKDRLVVVTLADVASRVEVYTPG
FT                   EWTAQPVPGLPDNTNTVIVAADDLGDEIFLDSSGFDTPSRLLQGAAGGELTEIKRAPSF
FT                   FDAADLKVDQHFATSADGTKIPYFVVGHRHQQAPGPTLLGGYGGFEVARTPGYDGVLGR
FT                   LWLSRGGTYVLANIRGGGEYGPTWHTQAMREGRHLVGEDFAAVAADLVERGITTVDRLG
FT                   AQGGSNGGLLMGIMLTQYPELFGALVCSVPLLDMRRFHLLLAGASWVAEYGNPDDPDDW
FT                   EFISKYSPYQNISAERRYPPVLITTSTRDDRVHPGHARKMTAALEDAGQPVQYYENIEG
FT                   GHGGAADNSQAAFRAALIYEFLWRKLGG"
FT   gene            complement(687890..689791)
FT                   /locus_tag="Mmcs_0624"
FT   CDS_pept        complement(687890..689791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa29480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06745"
FT                   /protein_id="ABG06745.1"
FT                   /translation="MPVCNGVQPLCSRRRRCALGHMTQTLADPREPTTDLTPQQRVDAW
FT                   LADFEAALAVRDIERVVAKFATDSFWRDLVAFTWNIKTLEGRDGIADMLTARLTETDPA
FT                   RFRTREAPTVDGDVTTAFIEFETGVGRGVGHLRLRGDECWTLLTTMQEIKGHEERKGPS
FT                   RVLGAVHGSDPDPRSWAEKRAEEDAALGRTVQPYALVIGGGQGGIALGARLRQLGVPAI
FT                   VVDRHERPGDQWRKRYKSLCLHDPVWYDHLPYLPFPQNWPVFAPKDKIGDWLEFYTRVM
FT                   EVPYWSKTTCLSAVFNPGSDGAPDTWTVEVDRDGERLTLRPTQLILATGMSGKPSVPTL
FT                   PGQDVFRGEQHHSSAHPGPDRYVGKRAVVIGSNNSAHDICKALVENGVDTTMVQRSSTH
FT                   IVKSDSLMDLGLGDLYSERALAAGMTTEKADLTFASLPYRIMHEFQTPIYDAIRERDKD
FT                   FYERLTAAGFELDWGDDGSGLFMKYLRRGSGYYIDVGACDLVADGTIKLAHGQVSHLTE
FT                   DTVVLADGTELPADVVVYATGYGSMNGWAADLIGQDVADKVGKVWGLGSSTTKDPGPWE
FT                   GEQRNMWKPTQQENLWFHGGNLHQSRHYSLYLALQLKARFEGIPTPVYGLQEVHHLS"
FT   gene            689800..690657
FT                   /locus_tag="Mmcs_0625"
FT   CDS_pept        689800..690657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0625"
FT                   /product="Insect alcohol dehydrogenase family"
FT                   /note="TIGRFAM: Insect alcohol dehydrogenase family; PFAM:
FT                   NAD-dependent epimerase/dehydratase short-chain
FT                   dehydrogenase/reductase SDR; KEGG: nfa:nfa30760 putative
FT                   short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06746"
FT                   /protein_id="ABG06746.1"
FT                   /translation="MQLFRGVVAVTYNWGMATQIPAPLSGKVALVTGAGRGIGRGIAVE
FT                   LARQGADIALVDVSEAGLPDAAAEISEIGSKTTTFVADVRDRDAVFAAVDHAAAALGGF
FT                   DVMVNNAGIALVGPIAEVTAEDLARLWAINVDGVLWGIQAAAAKFKELGNHAEGKVSKI
FT                   INASSIAGHEGFAMLGPYSATKFAVRALTQAAAKEYAADGITVNAYCPGVVGTDMWVEI
FT                   DKRFAELTGAAEGETFEKFSETIALGRPETPQDVAGFVAYLAGPGADYMTGQAGLIDGG
FT                   MVYR"
FT   gene            690698..692014
FT                   /locus_tag="Mmcs_0626"
FT   CDS_pept        690698..692014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0626"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF; KEGG: sco:SCO6105 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06747"
FT                   /protein_id="ABG06747.1"
FT                   /translation="MMPRPPVPEPAVAAGEDPRQYARLMSAVYDATMAGGRAPARPRKV
FT                   IEDSWRRLMARGIEPDTLPDPEVEGATLEEMRHASGLMSVLEDLSRGLESLIVEGDNIL
FT                   VVADARGRVLWRAGSRAVLGSADRLGFIEGAHWGENAVGTNAIGTALMSNAAVQVFSAE
FT                   HFSRSHHPWTCAGAPIKDPRTGHVIGVVDVSGPAATVHPTTVALVDAVARLAESHLREQ
FT                   HNRTLNSLRMVAAPILARIGSPALAVDPDGWVAAVDSLPPHNRIALPREVTPGRLLVPA
FT                   LGLCDVDPLPGGWLVRLAGDREADSGSQVALDLRNPEAPVLKMVGQAGGWRRDLSLRHA
FT                   EILLALAVQRQGRSAPELAADLYGDASRVVTVRAEVSRMRKQFIGLLAAQPYRITDTVH
FT                   LDVQYPADRMRLLPTSTAPVVRAARIGPPNSQPHQGGNA"
FT   gene            692011..693534
FT                   /locus_tag="Mmcs_0627"
FT   CDS_pept        692011..693534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0627"
FT                   /product="Aldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mpa:MAP3952
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06748"
FT                   /protein_id="ABG06748.1"
FT                   /translation="MTVYARPGAADALMAFESRYGNFIGGEWVAPAGGEYFENLTPVTG
FT                   QTFCEIPRSTEADIDKALDAAHGAATAWGKTSPGERAQILIKIADRLEANLESLALAES
FT                   WDNGKPIRETLNADIPLAIDHFRYFAGAIRAQEGALSQIDEDTVAYHFHEPLGVVGQII
FT                   PWNFPILMATWKLAPALAAGNAVVLKPAEQTPASILYLMSLIADLLPAGVVNVVNGFGV
FT                   EAGKPLASSNRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFSDVMAAND
FT                   DYQDKALEGFTMFALNQGEVCTCPSRSLVQADIYDEFLELAAIRTKAVRQGDPLDTETM
FT                   IGSQASNDQLEKVLSYIEIGKDEGARVVTGGERAELGGDLNGGFYVQPTIFEGKNSMRV
FT                   FQEEIFGPVVAVTSFKDYDDAISMANDTLYGLGAGVWSRDGNTAYRAGRDIKAGRVWTN
FT                   CYHMYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSNKAQGFF"
FT   gene            693535..694029
FT                   /locus_tag="Mmcs_0628"
FT   CDS_pept        693535..694029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0628"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   mbo:Mb0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06749"
FT                   /protein_id="ABG06749.1"
FT                   /translation="MTPPRALITQAAADLLTRLQGRHGALMFHQSGGCCDGSSPMCYPD
FT                   GDFIVGDRDVLLAVLDVGADGVPVWISGPQFDTWKHTQLVIDVVPGRGGGFSLEAPEGM
FT                   RFLSRARAFTDAENAELAQDPPVTGARYADGDRPAGRAPVVARAEDACPIPGRRAARVQ
FT                   G"
FT   gene            694026..694337
FT                   /locus_tag="Mmcs_0629"
FT   CDS_pept        694026..694337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06750"
FT                   /protein_id="ABG06750.1"
FT                   /translation="MRAPGGVIVEYVIPLPRAWLLTSAMLVGAAIGLVAAVTSTLLITA
FT                   TVRPDLVIALVVGVPGAVGVVTILCSARRWVTTLGAFILAIGPGWLGTLALIEVVNGG"
FT   gene            694330..694872
FT                   /locus_tag="Mmcs_0630"
FT   CDS_pept        694330..694872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06751"
FT                   /protein_id="ABG06751.1"
FT                   /translation="MADNGNEHPTGEHTSPYLPTFDTGGFSQPDPVTPLAARPEPTLTL
FT                   DREPDPLAYEALDFEPDSEPMVVPPAQPVVLPGSYQFLKRWVFALVLSAVWVVAAAVGA
FT                   GLYYWWVGDLDPDKTWPVYVVLVYLLGCTVAGLIVAMVARKPVVTALAIALMSAPPAST
FT                   AGAAALYGAYVFGWIAH"
FT   gene            694904..696304
FT                   /locus_tag="Mmcs_0631"
FT   CDS_pept        694904..696304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0631"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: Dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide oxidoreductase
FT                   glucose-inhibited division protein A pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region
FT                   HI0933-like protein; KEGG: mbo:Mb0471 dihydrolipoamide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06752"
FT                   /protein_id="ABG06752.1"
FT                   /translation="MTHYDVVVLGAGPGGYVAAIRAAQLGLNTAIVEPKYWGGVCLNVG
FT                   CIPSKALLRNAELAHIFTKEAKTFGISGEATFDYGAAFDRSRKVAEGRVAGVHFLMKKN
FT                   KITEVHGYGKFTDDHTIEVDLNEGGTETLTFDNAIISTGASTKLVPNTSLSENVVTYEE
FT                   QIMERELPGSIVIAGAGAIGMEFGYVMKNYGVDVTIVEFLPRALPNEDAEVSKEIEKQF
FT                   KKLGVKIMTGTKVESIKDEGGDGSVTVTVSKDGKSQELKTDKVLQAIGFAPNVEGYGLD
FT                   KAGVELTDRKAIGIDDYMRTNKPHIYAIGDVTGKLQLAHVAEAMGVVAAETIAGAETLP
FT                   LGDYRMMPRATFCQPQVASFGLTEEQAREEGYDVKVAKFPFTANGKAHGMGAPGGFVKL
FT                   IADAKYGELIGGHLIGHDVSELLPELTLAQKWDLTANELARNVHTHPTLSEALQEAFHG
FT                   LAGHMINF"
FT   gene            696301..696570
FT                   /locus_tag="Mmcs_0632"
FT   CDS_pept        696301..696570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0632"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: mle:ML2388 possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06753"
FT                   /protein_id="ABG06753.1"
FT                   /translation="MRNEIVAGVGGFVIGHILWLIAITLATNTSDVSTWVLVVAALSFV
FT                   VGAALGYLGWRRFQRKEHVWSSFVWGLAVSPVLFSIVVLGVTYL"
FT   gene            complement(696575..697111)
FT                   /locus_tag="Mmcs_0633"
FT   CDS_pept        complement(696575..697111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0633"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mpa:MAP3958c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06754"
FT                   /protein_id="ABG06754.1"
FT                   /translation="MTRIAPGGFRELGPLNWAIAKAGARAIRAPRFSLFNVLGQHRLLF
FT                   LAFLPYSGVLLGRLGKLSRQDAELVILRVGHLRECEYELQQHRRLARSRGVGADLQARI
FT                   FEGPDAEGLTDRQRVLVTATDEFVVTRGVSPQTWSVLARHLTKPQLIEFCLLAAHYDGL
FT                   AATISTLQVPLDFPD"
FT   gene            complement(697108..698535)
FT                   /locus_tag="Mmcs_0634"
FT   CDS_pept        complement(697108..698535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0634"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif protein of unknown
FT                   function DUF955; KEGG: mpa:MAP3959c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06755"
FT                   /protein_id="ABG06755.1"
FT                   /translation="MAKTFVGSRVRQLRNERGYSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVAMDRELGVEVDVSEIADMVAAHPTL
FT                   ARAMVNLHRRYRLTTTQLAAATEDRYSDGTGSSSGSGSISMPHEEVRDYFYQRQNYLHE
FT                   LDSAAEDLTVRMRMHRGDLAGELSNRLSTVHGVHIVRRIDLGETVLHRFEPGTKTLEMS
FT                   THLSVGQQVFKMAAELAYLEFGDLIDKMVDEGMFTSDESRTLARLGLANYFAAATVLPY
FT                   RQFHDVAENFRYDVERLSAFYQVSYETIGHRLSTLQRPSMRGVPFSFVRVDRAGNMSKR
FT                   QSATGFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYMWVARTVERRASRYGQ
FT                   PGKTFAIGLGCELRHAHRLVYSEGLDLSGENATPIGAGCRVCERDNCPQRAFPALGRAL
FT                   DLDEHRSTVSPYLVKQS"
FT   gene            698655..699470
FT                   /locus_tag="Mmcs_0635"
FT   CDS_pept        698655..699470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0635"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase; KEGG: mpa:MAP3960
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06756"
FT                   /protein_id="ABG06756.1"
FT                   /translation="MSGTTTGTGLSKTMMPVPDPHPDVFDTGWPLRVADVDRTGRLKFD
FT                   AATRHIQDIGSDHLRELGYEKTHPLWIVRRTMIDLIRPIEFQDMLRLRRWCSGTSNRWC
FT                   EMRVRIDGRKGGLMESEAFWININRETQGPARISDDFIAGLQRTTDVNRLRWKAYLSAG
FT                   SRDDAEEIREYPVRVSDIDIFDHMNNSVYWSVVEDYLYNHPELLTAPLRVTIEHDLPVA
FT                   LGDKLEIISHVHPPGSTDKFGADLTDRTVRTLTYVVGDETKAVACIFPL"
FT   gene            699737..701023
FT                   /locus_tag="Mmcs_0636"
FT   CDS_pept        699737..701023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0636"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mpa:MAP3961 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06757"
FT                   /protein_id="ABG06757.1"
FT                   /translation="MSTVGKPKSPEEIQKDWDTNPRWKGITRDYSPADVVALQGSVVEE
FT                   QTLARRGAEVLWNQLHDMEFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGH
FT                   TYPDQSLYPANSVPQVVRRINNALLRADEIARVEGDTSVENWLVPIVADGEAGFGGALN
FT                   VYELQKAMIAAGVAGSHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVP
FT                   TVVIARTDAEAATLITSDVDERDQPFITGERTKEGFYRVKNGIEPCIARAKAYAPYSDL
FT                   IWMETGTPDLELARKFAEGVQAEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELGAMG
FT                   FKFQFITLAGFHALNYSMFDLAYGYARNQMTAYVELQEREFAAEERGYTATKHQREVGA
FT                   GYFDRIATTVDPTSSTTALTGSTEEGQFH"
FT   gene            701114..701974
FT                   /locus_tag="Mmcs_0637"
FT   CDS_pept        701114..701974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0637"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase-like
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   mpa:MAP3962 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06758"
FT                   /protein_id="ABG06758.1"
FT                   /translation="MSNPIERVGVIGAGQMGAGIAEVSARAGVEVLVFETTDALVTAGR
FT                   NRITKSLERGVSAGKVTDREKSAALGKLSFTTDLADMADRQLVIEAIIEDVAIKAKVFA
FT                   ELDKVITDPDAVLASNTSSIPIMKLAAATQNSGRVLGLHFFNPVPVLPLVELVSTLTTT
FT                   DAAIARTEAFASDVLGKQVVRCSDRSGFVVNALLVPYLLSAIRMVEAGFATVEDVDKAV
FT                   VAGLSHPMGPLRLSDLIGLDTMKLIADAMFDELKDAHYAPPPLLLRMVEAGQLGKKSGQ
FT                   GFYSY"
FT   gene            complement(702018..702872)
FT                   /locus_tag="Mmcs_0638"
FT   CDS_pept        complement(702018..702872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0638"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP1247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06759"
FT                   /protein_id="ABG06759.1"
FT                   /translation="MGAALIIATEALESGELTRRDLRRRYTMVYRNVYIRNGLQLTAED
FT                   RARAAWLWSGRRATLTGHCAAALLGSRWIPPDAPVEIAHTRRPAARGMIARCNTFHDNE
FT                   VCVVDGIRCTTVARTAYDLGRRLTEQMGVVRIDALLNATGVAPSTVAAVAARHPGARGI
FT                   RRLRKTLTLVDAGAESPQETRLRLLIIRSGLPRPVTQIPVHNELGRVVRRIDMGWPDAM
FT                   VGIEYDGEQHFTNPDDYAADIERLEFLAARGWLIVRVSATQLRYRRAEIIDRVTAARRA
FT                   HGC"
FT   gene            complement(703006..703872)
FT                   /locus_tag="Mmcs_0639"
FT   CDS_pept        complement(703006..703872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0639"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   nfa:nfa52170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06760"
FT                   /protein_id="ABG06760.1"
FT                   /translation="MSREPELPALWSHDPHVHLRFRTGDKVGDIETDATPGFIGSKSDA
FT                   PVLQAERSMRLGELQEKLYANSRAGDTRSVLLILQGMDTAGKGGIVKHVVGAANPQGVK
FT                   YTSFGKPTAEELAHHYLWRIRKALPTPGHIGVFDRSHYEDVLVVRVHNLVPPDVWGARY
FT                   DEINAFEREIVDSGTSIVKVAMFVSLQEQKRRLAERLERPDKYWKYNPADIDERLLWPQ
FT                   YEQAYQAVLDRTSTDYAPWHVVPCDRKWYSRLAITELLIEALKRLNMSWPPPDFDVKAE
FT                   KKRLANA"
FT   gene            complement(703869..704576)
FT                   /locus_tag="Mmcs_0640"
FT   CDS_pept        complement(703869..704576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0640"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mle:ML2457
FT                   possible TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06761"
FT                   /protein_id="ABG06761.1"
FT                   /translation="MAQQTPPLAVKTDGRKRRWHQHKVERRNELVDGTLEAIRRRGSNV
FT                   SMDEIAAEIGVSKTVLYRYFVDKNDLTTAVMMRFAQTTLIPNMAAALMSNLDGYDLTRE
FT                   IIKVYVETVANEPEPYRFVMANNSASKSKAVADSERIIARMLAVMLRRRMAQAGMDTGG
FT                   VEPWAYHIVGGVQLATHSWMSHPRMSADELIDYLTMLSWSALCGIVEVGGSLEKFRSEP
FT                   HPSPILPPQLMEQ"
FT   gene            704669..705991
FT                   /locus_tag="Mmcs_0641"
FT   CDS_pept        704669..705991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0641"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   mpa:MAP3966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06762"
FT                   /protein_id="ABG06762.1"
FT                   /translation="MMEPVVSTQQSERPSFAEAIAGADSAADAERRRGLRRMKTVALGF
FT                   LLGATVIFLVCTWAQSQGAAAPWIGYVRAAAEAGMVGALADWFAVTALFKHPLGIPIPH
FT                   TAIIKRKKDQLGEGLGEFIRENFLSRENVETKLRSAEVAGRLGKWLSDRSHAERVATEA
FT                   SNVLRVLVEMLRDEDVQQVLDRMIVKRIAEPQWGPPVGRVLSQLLQEGRQEALIQLLAD
FT                   RAFEWSLNAGEVIERVIERDSPTWSPRWVDHLVGDRIHRELMDFTDKVRRNPDHELRRS
FT                   ATKFLFEFADDLQNDDATIQRAENVKEQIMARDEVARAAETAWSAAKRIIFESVDDPSS
FT                   TLRARIADSVMRIGESLRDDAELRDKVDNWIIRGAQHVVGEYGAEITTIVTDTIERWDA
FT                   DEASSRIELHVGRDLQFIRINGTVVGSLAGLVIYSIAQLLF"
FT   gene            706087..706572
FT                   /locus_tag="Mmcs_0642"
FT   CDS_pept        706087..706572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0642"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif; KEGG: mpa:MAP3967
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06763"
FT                   /protein_id="ABG06763.1"
FT                   /translation="MSQDENLAAVVTNAAQDIGSFIRSQREAAQVSVRQLAEKAGVSNP
FT                   YLSQIERGLRKPSADVLNQIAKALRVSAEVLYVRAGILEPSEAGQVRDAILSDTAITER
FT                   QKQVLLDIYTSFCQQNEVAGSEVDEEPTTAHTPISGDPIQRALETTPEDSRKDIHHG"
FT   gene            706565..707176
FT                   /locus_tag="Mmcs_0643"
FT   CDS_pept        706565..707176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT0493 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06764"
FT                   /protein_id="ABG06764.1"
FT                   /translation="MAEKNPQVDIEDLKAPLLAAVGAADLALATVNEIVASLRDRAEEA
FT                   RTDANSRVEESRARINKLQEELPTQVTELRERLTADELRRAAEGYAEAAQSTYAKLVER
FT                   GEAALERLRSQPGFTDAANRVETYTDQAVELTEQALGNVATQTRAVGERAAKLVGVELP
FT                   KKTEETAEPVKAAAKKAPAKKAPAKKAPAKKAPAKKVTQK"
FT   gene            707219..707503
FT                   /locus_tag="Mmcs_0644"
FT   CDS_pept        707219..707503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0644"
FT                   /product="conserved membrane protein"
FT                   /note="KEGG: mle:ML2453 conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06765"
FT                   /protein_id="ABG06765.1"
FT                   /translation="MILADLAGVIVLGLVLIVLVVGVYSFVHAAIQRPDAYTAAGKLTK
FT                   PVWLAILGGGVLILLLFRDAFGAAVCACAAGVYLVDVRPKILEIQGKSR"
FT   sig_peptide     707219..707308
FT                   /locus_tag="Mmcs_0644"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.866 at
FT                   residue 30"
FT   gene            707508..707924
FT                   /locus_tag="Mmcs_0645"
FT   CDS_pept        707508..707924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06766"
FT                   /protein_id="ABG06766.1"
FT                   /translation="MRYFLAAVTAALVLPLSMSLSPVAAAQPAPPPPYIDHVTWAKWGD
FT                   LSSLRVYPTTAGRRAAGQVGTVAEAEHAWAEVLAASPDAAIPGMREQFDCHWQFAEFAA
FT                   PGKTSWNLEPWRPEVPVEQMVAAGCNPGGTEEPF"
FT   sig_peptide     707508..707588
FT                   /locus_tag="Mmcs_0645"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.755 at
FT                   residue 27"
FT   gene            707924..708604
FT                   /locus_tag="Mmcs_0646"
FT   CDS_pept        707924..708604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0646"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: mpa:MAP3971 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06767"
FT                   /protein_id="ABG06767.1"
FT                   /translation="MGGWTRERVAGLVDHTLLKPEAGEGDVEALVEEAEALGVYAACVS
FT                   PSMVPAAVRVRPFSTKIAAVVGFPSGKHLPAVKAHEAALAVAAGADEIDMVIDVGAALA
FT                   GDIDAVRADIAAVRAAIGERTLLKVIVESAALLELGGRDVLVDTCLAAKAVGAEYVKTS
FT                   TGFHPLGGASAGAVEIMVAAVGPQVEVKASGGIRTAADAIAMLDAGATRLGLSATRAVL
FT                   DDLD"
FT   gene            complement(708612..709484)
FT                   /locus_tag="Mmcs_0647"
FT   CDS_pept        complement(708612..709484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0647"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3972c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06768"
FT                   /protein_id="ABG06768.1"
FT                   /translation="MTDPWARPADQQPVPPPPPFPQGAPPSAPGPGAEPPKERGSLLAK
FT                   VKDMFSDPLSIVLAVVIVVALTAAGLLGGELYARNRADDVVSRVVSCVVEDEATASFGA
FT                   MPPFLLQHMTGHYTNIDIETAGNQIRDAKGMKVGIDIQDVRLEDTANSSGTIGSLAANI
FT                   TWSSEGITQTVQDAIPLFGSFLNGVSTNPSAGTIELEGALGSIVAKPQVSNGGITLQVQ
FT                   QLSGLGFTLPREAVQPALDAFTSGLTQNYPMDIKAQSVEVTDTGVTALFSTQNAEIPKS
FT                   GEDPCFNGL"
FT   gene            complement(709481..710308)
FT                   /locus_tag="Mmcs_0648"
FT   CDS_pept        complement(709481..710308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0648"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mpa:MAP3973c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06769"
FT                   /protein_id="ABG06769.1"
FT                   /translation="MSGAMRIACAQIAAGTDPAANLEVLEDHTGRAVDAGAQLVLFPEA
FT                   TMCRFGVPLAPVAEPLDGPWASAVRSIAERAGVTVVAGMFTPSGDGRVLNTLIATGGGV
FT                   DTHYHKIHLYDAFGFRESRTVAPGSEPATITVAGVEVGLTTCYDIRFPELYVELARRGA
FT                   QLITVHASWGAGPGKLDQWTLLARARALDTTGYLAAVDQAYPGDEVAASGPTGIGGSLV
FT                   ASATGEVVVSAGADPQLMVADLDLDAAREVRETIAVLNNRAEVDSPGRAESRA"
FT   gene            710396..711913
FT                   /locus_tag="Mmcs_0649"
FT   CDS_pept        710396..711913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0649"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: hma:pNG7065
FT                   probable sodium:solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06770"
FT                   /protein_id="ABG06770.1"
FT                   /translation="MVLFGVGVSIAVVVLVGFLVSRRIAGDSANFLVGGRTLPLILVGG
FT                   ALMGSAVDTNATLGNTDLASEFGFWAGACLPLGLALCLLFTGLFFAKPMNRMGLTSFPD
FT                   YYRLRFGRGVEVAASVMLMIGFCILVAGNLVAGGFLFNYFLGIPYWLGTVVIAALAVAY
FT                   TGTGGLLADAYTAIIQMAMILVGAMGLLIWMVLTHGLAIEEGMGPLDLGQMTDPAQGAT
FT                   VNWATLIALGIGDIVAIDFMQRVFAAKSPETARRACFGAAAGVVAICVPFGLVVLSARA
FT                   FLPDDLDGPILLVLLDGYAPLALTILVLCGLVGASMSTANGAILAISNVCVRNLGGVRR
FT                   THVPGQPDPLLRATRIAMVPVTLLAIAIAIYVKQTGILLTLAFDLLLACLVVPFILGLV
FT                   WRKGTSTAALASIVVGLSVRLVLFVMTPTMYGLDNTILYIPNGVFDATFDGWPTFIAFA
FT                   ASLATYVVVALVTPAAPIRGLDIQMAEDLDDALAAEPVTARPLTTAR"
FT   gene            complement(711882..712673)
FT                   /locus_tag="Mmcs_0650"
FT   CDS_pept        complement(711882..712673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa52000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06771"
FT                   /protein_id="ABG06771.1"
FT                   /translation="MTQSPNAPIGVLTRGTTGHNRLRRSDRWLVHSPRVRTALRSAADP
FT                   LVVDLGYGALPITTLELASRLRSVRPDARVVGLEIHPERVAAARAAAPSDVEFALGGFE
FT                   LAGLRPVLVRAFNVLRQYPVDAVAGAWEVMRGRLAPGGLIVDGTCDELGRRCAWVLLDA
FT                   VGPVSFTLACDPFAIERPSDLAERLPKVLIHHNVPGQPIHRLLAAADRAWASVAGHGVF
FT                   GPRIRWRAMLDLLAAEGFPVEPPRRRMRDGVLTVPWSTVAP"
FT   gene            complement(712680..713183)
FT                   /locus_tag="Mmcs_0651"
FT   CDS_pept        complement(712680..713183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa51990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06772"
FT                   /protein_id="ABG06772.1"
FT                   /translation="MEHTVAFDAPAAHVHAQFTSEDYWRELTDVYRALNPRTELTLFRS
FT                   DARGTDIALRQVMPRDDLPPVARKVMPVDLVITREQHFDPFDDGAACAHGGFAATMPRA
FT                   PGRLEGRYELSDTPAGSRLLVHSTCKVSIPLVGGTLEDLILTNMRTLFDGEQRFTAERV
FT                   SGRR"
FT   gene            complement(713219..713728)
FT                   /locus_tag="Mmcs_0652"
FT   CDS_pept        complement(713219..713728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0491c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06773"
FT                   /protein_id="ABG06773.1"
FT                   /translation="MPRSFDLAADYEGTVEDVHRAFSDQRYWLARLADSGADHATLDGM
FT                   TVGEDGSIDVTTTQTLRADRLPGVVAQFHRGDLEIQREETWTGVRDGRATATVTGSIPG
FT                   APVTLNGTAVLSPGASGGSRLELKATVEVRVPLVGGKIENFIGNGLVDLIIAEQRFTTV
FT                   WITENV"
FT   gene            713755..714807
FT                   /locus_tag="Mmcs_0653"
FT   CDS_pept        713755..714807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0653"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="PFAM: FAD linked oxidase-like
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase-like; KEGG:
FT                   mbo:Mb0492 UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06774"
FT                   /db_xref="GOA:Q1BEB0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEB0"
FT                   /protein_id="ABG06774.1"
FT                   /translation="MTGQELAGAEVEADVALAPLTTLRVGPVARRLITATSTEQLVAAL
FT                   RAPVGRDALILAGGSNVVLADDMSDLTVIRVANSEITVRDGIVRAEAGANWDDVVVTAL
FT                   AHGLGGLECLSGIPGSAGATPVQNVGAYGSEVADTIRRVRLFDRRTGRDDWVTPQDMAF
FT                   GYRTSVLKHSDHAVVLEVEFALDVGGRSAPLRYGELARALDVEPGGRADPVAVRDAVLA
FT                   LRRGKGMVLDEPDRDTWSVGSFFTNPVVTTAQHERLAAEVDGPVPSYPAPDGVKLAAGW
FT                   LVEHAGFGKGYPGDDAPARLSTKHALAVTNRGHATTADVIALARTVRDGVRTTFGIELT
FT                   PEPTLVGCTL"
FT   gene            714823..716115
FT                   /locus_tag="Mmcs_0654"
FT   CDS_pept        714823..716115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0654"
FT                   /product="ErfK/YbiS/YcfS/YnhG"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG; KEGG: mbo:Mb0493 probable
FT                   conserved lipoprotein LprQ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06775"
FT                   /protein_id="ABG06775.1"
FT                   /translation="MSAADKLPPMNRRRALTALAVGLVAPGALAACSRSISNPGEAAQA
FT                   PASASLAFEPATSATDVSPTEPVRVEVSGGWFQRVALMNAQGKPVAGALNQDRNVFTVS
FT                   EPLGYGVTYSWSGSAVGEDGKAVPVSGKFTTLDPATQVNGQFQLSDGQTVGVAAPVILQ
FT                   FDASIGDEDRATVEKALSVTTNPPTEGSWAWLPDESAGSRLHWRSKEYFAPGTTVRVDA
FT                   RFYGVKFGEDAYGAADSSLDFTIGRRQVVRAEASSHRIQVIDEVGAVIMDFPCSYGEGD
FT                   LDRNVTRSGIHVVTEKYEDFYMTNPAAGYANVRERFAVRISNNGEFIHANPASLGSQGN
FT                   SNVTNGCINLSESDAEQYFRTALYGDPVEVTGTRIQLSYADGDIWDWAVPWEEWKSMSA
FT                   LSDQASPAGIPSTAPVTPTGAPQPVNGRPGG"
FT   sig_peptide     714823..714915
FT                   /locus_tag="Mmcs_0654"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.697 at
FT                   residue 31"
FT   gene            complement(716124..716879)
FT                   /locus_tag="Mmcs_0655"
FT   CDS_pept        complement(716124..716879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0655"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP3977c putative short-chain type oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06776"
FT                   /protein_id="ABG06776.1"
FT                   /translation="MTTSRGDQRVAVVTGASAGIGEATARTLAAQGFHVVCVARREEPI
FT                   KALADEIGGTAVVADVTSTEAVDALAAALDRVDVLVNNAGGARGLDPIAEADIEHWRWM
FT                   WESNVLGTLLVTRALLPKLIDSGDGLIVTVTSIAAVEIYDNGGGYTSAKHAQGVLHRTL
FT                   RSELLGKPVRLTEVAPGMVKTDFSLNRFEGDEERAEKVYEGVTPLVAEDIAEVIGFVAS
FT                   RPSHVDLDLIVIRPRDQVSGASGSRFNRR"
FT   gene            717062..718372
FT                   /locus_tag="Mmcs_0656"
FT   CDS_pept        717062..718372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0656"
FT                   /product="ROK domain containing protein"
FT                   /note="PFAM: ROK; KEGG: mpa:MAP3978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06777"
FT                   /protein_id="ABG06777.1"
FT                   /translation="MRATLDSAPAASVAVRRLPASKRPLAAAPPRITHQRHVVAPALKV
FT                   ADAAASSVFAAARMRGPIARDAIARVTGLSIATVNRQVSALLDAAILRERADLAVSGAI
FT                   GRPRVPVEVNHEPFLTLGIHIGAKTTSIVATDLFGRTLDVVETPTPRGPQDAALAVLSA
FT                   SARKYLSRWHRRRALWVGVAAGGVVDGVTGHLDHPRLGWSHAPVGPVLAESLGLPVSVA
FT                   SHVDAMAGAELLLGARRPTVAPSSTSLYVYARETVGFALSIDGRVHSPTSGPGTIAALP
FT                   AQSELLGGSGQLESTVSDEAVLTAARRQRIIAADGPTSTMAAVLRAARQGNDAAQALLA
FT                   ERARVLGEAVALLRDMLNPDDLVVGGQAFTEYPEAMPLVEAAFTARSVLPGRDIRLTTF
FT                   GNRVQEAGAGVVSLGGLYADPIAAMRRSGARRPEAAS"
FT   gene            718408..719727
FT                   /locus_tag="Mmcs_0657"
FT   CDS_pept        718408..719727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0657"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mbo:Mb0496 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06778"
FT                   /db_xref="GOA:Q1BEA6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BEA6"
FT                   /protein_id="ABG06778.1"
FT                   /translation="MRLATDQLGRPPQRVAVLSVHTSPLAQPGTGDAGGMNVYVLQSAL
FT                   HMARRGVEVEIFTRATTSADPPVVRVAPGVLVRNVVAGPFEGLDKYDLPTQLCAFTAGV
FT                   LRAEATHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALAEGDSPE
FT                   PPLRAVGEQQVVDEADRLIVNTELEAEQLVSLHNADPSRIDVVHPGVDLDTFTPGDRAA
FT                   ARAALGLDPRETVVAFVGRIQPLKAPDILLRAAAKLPDVRVLVAGGPSGSGLAAPDNLV
FT                   ALADELGISERVTFLPPQSREDLVRVYRAADLVAVPSYSESFGLVAVEAQACGTPVVAA
FT                   AVGGLPVAVRDGVTGALVDGHDVGDWAHTIDSLLSRGPATMRRAAVEHAATFSWAHTVD
FT                   DLLASYGRAISDYRDRHPHADETLSRRTARRFSRRRGVRA"
FT   gene            719724..720257
FT                   /locus_tag="Mmcs_0658"
FT   CDS_pept        719724..720257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06779"
FT                   /protein_id="ABG06779.1"
FT                   /translation="MSDDGPLGQRTDDTVQRTIVDTLEEHDLAYTFHEGAHGGLPGIIV
FT                   ELPGERRLKTNTILSIGEHSVRIEAFVCRKPDENHEGVYRFLLKRNRRLYGVAYTLDNV
FT                   GDIYLVGRMALHSVTADEIDRILGQVLEAVDNDFNTLLELGFKSSIQREWEWRVSRGES
FT                   LKNLRAFEHLIDDD"
FT   gene            720299..721045
FT                   /locus_tag="Mmcs_0659"
FT   CDS_pept        720299..721045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0659"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mpa:MAP3981 phosphoglycerate mutase; TIGRFAM:
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06780"
FT                   /protein_id="ABG06780.1"
FT                   /translation="MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEATRAGELI
FT                   ADLDRLPDVLYTSLLRRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETK
FT                   EKYGEEQFMAWRRSYDTPPPPIEAGSEYSQDRDPRYADIDGGPLTECLADVVARFVPYF
FT                   EQTIVPDLREGRTVLIAAHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDSDLKP
FT                   TVAGGTYLDPEAAAAGAAAVASQGAK"
FT   gene            721179..722357
FT                   /locus_tag="Mmcs_0660"
FT   CDS_pept        721179..722357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0660"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: mbo:Mb0500 putative two component
FT                   sensor histidine kinase SenX3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06781"
FT                   /protein_id="ABG06781.1"
FT                   /translation="MSVASALLMTAVVALLTLLVGVGVGVALTPRVAERRRRRAAETAG
FT                   ITVSQMLAHIVSSSPVGIVVVDKFRDVVYSNVRAEELGLVRDRLLDERAWEAAQHTLST
FT                   GEDVQVDLSPRKVAHPGRSGLSVRGAARLLTRADRRFAVVYVDDHSEYARMEATRRDFV
FT                   ANVSHELKTPVGAMGLLAEALLASADDPETVRRFAGKMVDEAHRLADMIGELIELSRLQ
FT                   GGERLPDLGVVDVDTVVSEALSRHKVAADNADIAITTDAPTGFKVLGDQTLLVAALANL
FT                   VSNAIAYSPRGTPVSVSRRRRGDNIEISVTDRGIGIDKDDQERVFERFFRVDKARSRAT
FT                   GGTGLGLAIVKHVAANHNGAIRLWSQPGTGSTFTLSIPAYPRPEEVDDEPSQ"
FT   sig_peptide     721179..721262
FT                   /locus_tag="Mmcs_0660"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.657 at
FT                   residue 28"
FT   gene            722373..723059
FT                   /locus_tag="Mmcs_0661"
FT   CDS_pept        722373..723059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0661"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: mbo:Mb0501 two component
FT                   sensory transduction protein RegX3 (transcriptional
FT                   regulatory protein) (probably LuxR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06782"
FT                   /protein_id="ABG06782.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFETTVVADGPSALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGTDVDDPGVPDGVLEAGPVRMDVERHVVSVNGQSITLPLKEFDLL
FT                   EYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGL
FT                   GYKLEG"
FT   gene            complement(723080..723367)
FT                   /locus_tag="Mmcs_0662"
FT   CDS_pept        complement(723080..723367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0662"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: mlo:mlr8183 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06783"
FT                   /protein_id="ABG06783.1"
FT                   /translation="MFLFKLVPPRADFAQTMTADEQQAMAGHQDYWRDLLAAGKVVVYG
FT                   PVADPEGVWGLGVLRAADRAEVLEIGRHDPSVLAWVNTFEVFEIMGGTTG"
FT   gene            complement(723379..724155)
FT                   /locus_tag="Mmcs_0663"
FT   CDS_pept        complement(723379..724155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3986c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06784"
FT                   /protein_id="ABG06784.1"
FT                   /translation="MMPAHPGEVELDFAREWVEFYDPDNPDHLIAADMTWLLSRWTCVF
FT                   GTPACQGTVEGRPDDGCCSHGAFLSDDDDRARLDAAVEQLTADDWQFRDKGLGKKGYLE
FT                   MDEYDDKPNLRTRKYKGACIFLNRPGFAGGIGCALHTKALKLGVEPLTMKPDVCWQLPI
FT                   RRTQDWVTRPDGSEILKTTITEYDRRGWGEGGADLHWYCTGDPAAHVGARQVYESYGPE
FT                   LTELLGEKAYAELAAMCRRRSGLGLVAVHPATRAAQ"
FT   gene            724250..725329
FT                   /locus_tag="Mmcs_0664"
FT   CDS_pept        724250..725329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0664"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: mpa:MAP3987
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06785"
FT                   /protein_id="ABG06785.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDARRGGHPTPMSSTKASLRLAEAIDDS
FT                   GKLTRKGADRLVATVDEFAKIATSSGCAEMMAFATSAVRDATNSDDVLARVLAETGVRL
FT                   RVLSGVDESRLTFLAVRRWYGWSAGRIINIDIGGGSLELSNGGDEEPEVALSLPLGAGR
FT                   LTREWLPDDPPGRRRVAMLREWLANELSDASTELLEAGSPDLAVATSKTFRSLARLTGA
FT                   APSGAGPRVKRTLTATGLRQLIAFISRMTAADRAELEGVSAERAPQIVAGALVAEASMR
FT                   ALGIESVDICPWALREGLILRKLDSEADGSAFVGGTEVGGADDLTRVSGMDDLAAVETP
FT                   VRDAGPKALSPTATKGNTR"
FT   gene            725326..726297
FT                   /locus_tag="Mmcs_0665"
FT   CDS_pept        725326..726297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0665"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06786"
FT                   /protein_id="ABG06786.1"
FT                   /translation="MTEPDNSSSTRPISVAELLAKNGTIGAPPVGGRRRRRRGNADAVT
FT                   VAELTGEIPIVTDRASDTREERADETARIPVNGATQEQETVTEPAPEDVVEPEVTEVAE
FT                   FETEEPDDVDVDEDIPLEQDTVEQDTVGAEDMSPDPLLDDDEEPADLLDSDLDEPARER
FT                   SQTDDDELPSYLRSSAGPLFGGGTVADDLARRGKDADTATIDEHDDEDELDEHDLRDDT
FT                   RDDLRDDDVEAGGRMSAFLRGAWIVGQCIIAVAFGAGLFIAFDQLWKWNNIVALVLSVL
FT                   VILGLVVGVRVVRKTEDIGSTLIAVAVGALVTLGPLALLQSG"
FT   gene            726305..727150
FT                   /locus_tag="Mmcs_0666"
FT   CDS_pept        726305..727150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0666"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /note="PFAM: Xylose isomerase-like TIM barrel; KEGG:
FT                   mpa:MAP3989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06787"
FT                   /protein_id="ABG06787.1"
FT                   /translation="MRPAIKVGLSTASVYPLRTEAAFEYAARLGYDGVELMVWAEAVSQ
FT                   DIDAVARLSAQYGVPVLSVHAPCLLISQRVWGANPIPKLDRSVRAAEQLGAQTVVVHPP
FT                   FRWQRRYAEGFSEQVAELEAGSDVMVAVENMFPFRADRFFGAGQTSIERMRKRGGRPGP
FT                   GISAFAPSYDPLDGDHAHYTLDLSHTATAGTDAIEMAQRMADGLVHLHLADGSGASADE
FT                   HLVPGRGTQPTAEVCQMLANGDFSGHVILEVTTSGARTANEREALLRESLQYARAHLLR
FT                   "
FT   gene            727182..728033
FT                   /locus_tag="Mmcs_0667"
FT   CDS_pept        727182..728033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0667"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06788"
FT                   /protein_id="ABG06788.1"
FT                   /translation="MSGSTLFTDAMALTALGEGRYRGELNEHWTIGPKVHGGAMLALCA
FT                   NAARLEHGTAGQERNDSGGGESGVEPIAVSANFLWAPDPGPMDVVTTVRKRGRRVSLID
FT                   VELQQGDRVAVRAAITLGEPEHHTPPLLSVNPVVPLMTPEPPPGLEPIGPGHHMADIVH
FT                   LAHGCDIRPSLTTMAPRSDGGAPVIEYWVRPRDAAPDVLFALLCGDVSAPVTFGVNRFG
FT                   WAPTVQLTAYLRARPADGWLRVICTTTQIGQEWFDEDHVVVDCEGRIVVQSRQLAMVPA
FT                   AQ"
FT   gene            728070..728954
FT                   /locus_tag="Mmcs_0668"
FT   CDS_pept        728070..728954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0668"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: mpa:MAP3991 pyrroline-5-carboxylate reductase;
FT                   TIGRFAM: pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase, coenzyme F420-dependent 6-phosphogluconate
FT                   dehydrogenase, NAD-binding Ketopantoate reductase
FT                   ApbA/PanE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06789"
FT                   /protein_id="ABG06789.1"
FT                   /translation="MLWRMARIAIIGGGSMGEALLSGLLRAGRQVKDLVVAEKHPDRAK
FT                   FLAEKHSVLVTSVVEAIDNAHYVIVAVKPADVEHVIDDIAEAAANADTDTAEQVFVTVA
FT                   AGVSTAYYENKLPAGAPVIRAMPNAPVVVGGGVSALAPGRFATPEHLKEVSAIFDSVGG
FT                   VLTVPESQLDAVTAVSGSGPAYFFLMVEALVDAAVASGLSRTVATDLVVQTMAGSAAML
FT                   LERLDEAQPVGDAAMGTAMDTTAAQLRATVTSPAGTTAAGLRELERGGLRSAVANAVEA
FT                   AKTRSEQLGITSE"
FT   gene            729093..729347
FT                   /locus_tag="Mmcs_0669"
FT   CDS_pept        729093..729347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0669"
FT                   /product="Excisionase/Xis, DNA-binding protein"
FT                   /note="TIGRFAM: Excisionase/Xis, DNA-binding; KEGG:
FT                   mpa:MAP3992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06790"
FT                   /protein_id="ABG06790.1"
FT                   /translation="MTSMNGPSARDSAGGKRESGADGQQPRAQFLTVAEVASLMRVSKM
FT                   TVYRLVHNGELPAVRVGRSFRVHAKAVHDMLESSYFDAG"
FT   gene            729498..729599
FT                   /locus_tag="Mmcs_0670"
FT   CDS_pept        729498..729599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0670"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713; KEGG:
FT                   cdi:DIP0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06791"
FT                   /protein_id="ABG06791.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK"
FT   gene            729649..730722
FT                   /locus_tag="Mmcs_0671"
FT   CDS_pept        729649..730722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0671"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase Male sterility-like;
FT                   KEGG: mpa:MAP3993 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06792"
FT                   /protein_id="ABG06792.1"
FT                   /translation="MVDSSTPGDVGSYPKVVLVTGACRFLGGYLIARLAQNPLINHVIA
FT                   VDAIAPSKDLLRRMGRAEFVRADIRNPFIAKVIRNGDVDTVVHAAAASYAPRAGGRAAL
FT                   KELNVMGAIQLFAACQKAPAVRRVILKSTSEVYGSSPRDPVMFTEDSDARRPPGEGFAR
FT                   DSIDIEGYARGLGRRRPDIGVTILRLANMIGPAMDTALSRYLAGPVVPTVLGQDPRLQL
FT                   LHEQDALGALERATTAGKSGTFNIGASGIIMMSQAIRRSGRVALPVPRSALSLVDSLRR
FT                   ATRYTELDREQLNYLSYGRVMDTTRMREVLEYHPKWTTAEAFDDYVRGRGLTPIVDPRW
FT                   VRSVEDRAVGVAQRWGR"
FT   gene            730756..731817
FT                   /locus_tag="Mmcs_0672"
FT   CDS_pept        730756..731817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0672"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mpa:MAP3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06793"
FT                   /protein_id="ABG06793.1"
FT                   /translation="MSGESKAKVIPLHGTSGRNAARRAAQRADSARRHPSLLSDPGSRA
FT                   SAEQIAAVVREIDQHRAGGLGAGVEETPTELAKRIAAVAEFVRKRMSGDYTVDEFGFDS
FT                   HLNSAVFLPILRVLFNSWFRVEVSGTENLPAEGAALVVANHAGVLPFDGMMLSVAVKDH
FT                   HPVHRDLRLLAADLVFDLPMVGQAARKAGHTMACTSDAHRLLAAGELTAVFPEGYKGLG
FT                   KQFKDRYKLQRFGRGGFVSAALRTKAPIVPCSIVGSEEIYPMMADVKLLARLLGLPYFP
FT                   VTPLFPVAGPLGLVPLPSKWHIQFGEPISTEDYDESAADDPMITFELTDQVRETIQHTL
FT                   YQLLAGRRNMFFG"
FT   gene            complement(731839..732372)
FT                   /locus_tag="Mmcs_0673"
FT   CDS_pept        complement(731839..732372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0673"
FT                   /product="MaoC-like dehydratase"
FT                   /note="PFAM: MaoC-like dehydratase; KEGG: mpa:MAP3996c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06794"
FT                   /protein_id="ABG06794.1"
FT                   /translation="MAIAEEIIGTHYRYPDYFEVDREKIREFARAVKDDHPAHHDEAAA
FT                   KESGYDALIASLTFLAVAGRKVQAEIFNQFDVPINMERVLHRDQKITFHRPIVAGDKLF
FT                   FDSYLDSVIEAHGTVVTEVRGEVSDEAGKPVLTSVVTVIGEAAHDNEADEISATIKARR
FT                   DAAIAKMVSGQNAK"
FT   gene            complement(732418..733320)
FT                   /locus_tag="Mmcs_0674"
FT   CDS_pept        complement(732418..733320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0674"
FT                   /product="HAD-superfamily subfamily IB, PSPase-like
FT                   protein"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase subfamily IB,
FT                   PSPase-like HAD-superfamily subfamily IB, PSPase-like;
FT                   PFAM: Haloacid dehalogenase-like hydrolase; KEGG:
FT                   mpa:MAP3997c phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06795"
FT                   /protein_id="ABG06795.1"
FT                   /translation="MSETGGTHAERQQIAGDASAAAAVTELETEPVPAPPAPPPDLTAA
FT                   AFFDVDNTLVHGSSLVHFARGLAARKYFTYGDVLGFVYAQAKFQLTGRENSDDVAAGRS
FT                   KALSFIEGRSTAELVALGEEIYDEIIASKIWPGTRALAQMHLDAGQQVWLVTATPYELA
FT                   ATIARKLGLTGALGTVAESVDGVFTGRLVGDILHGTGKAHAVRSLAIREGLNLRRCTAY
FT                   SDSYNDVPMLSLVGTAVAINPDAALRSLARERGWEIRDFRTARKAARIGVPSAVALGAL
FT                   GGALAAVVSRRQDGRTGWR"
FT   gene            733356..733610
FT                   /locus_tag="Mmcs_0675"
FT   CDS_pept        733356..733610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0675"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: mpa:MAP4001 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06796"
FT                   /protein_id="ABG06796.1"
FT                   /translation="MVDHAIELLTRAGCGLCEQAAARLAELSGELGFGLTITDVDAAAA
FT                   GGDAALRAEYGDRLPVVLLDGAEHSYWEIDEPRLRADLG"
FT   gene            733701..735044
FT                   /locus_tag="Mmcs_0676"
FT   CDS_pept        733701..735044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0676"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase Shikimate/quinate
FT                   5-dehydrogenase; KEGG: mpa:MAP4002 glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06797"
FT                   /db_xref="GOA:Q1BE87"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BE87"
FT                   /protein_id="ABG06797.1"
FT                   /translation="MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIVDQVLQSSLVTEAM
FT                   VLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHCGMSLNDLTKYAYVRYAEAAVEHLFAVA
FT                   SGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRALSVGKRVHSETGIDAAGA
FT                   SVVSVALDIAEAKLGSLAGRTAVVIGAGSMGALSAKHLVRAGIERVHVVNRSLPRARRL
FT                   AQSLLDQGVTADAHTLDDIAHALADADVVITSTGAVRPVVSLADAHRGLTGRPEHRRLV
FT                   ICDLGMPRDVEPAIAGLPGVNVIDMERIQREPSARAAASDADAARSIVAAEVANYLAGQ
FT                   RMAEVTPTVTALRQRAADVVEAELLRLDNRLPELDAAHRAEVAKTVRRVVDKLLHAPTV
FT                   RVKQLASAPGGDSYAEALRELFELDQQAVDAVAAGELPLLPIELDKSE"
FT   gene            735048..735992
FT                   /locus_tag="Mmcs_0677"
FT   CDS_pept        735048..735992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0677"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase; KEGG: mpa:MAP4003
FT                   porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06798"
FT                   /protein_id="ABG06798.1"
FT                   /translation="MSNADTPIRIGTRASLLATTQAGTIRDALIARGHAAELVLISTEG
FT                   DRNQGPIADIGVGVFTAALREAIHDGRVDAAVHSYKDLPTAADERFTIPAIPRREDPRD
FT                   ALVARDGLVLGELPAGSTVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNRVGNGELD
FT                   GIVVARAGLARIGRLGDVTETLEPVQMLPAPAQGALAVECRAGDTGLIALLAELDDADT
FT                   RAAVTAERVLLAELEAGCSAPVGAIAEVVESIDEDGRVFEEVSLRGCVAALDGSDVIRA
FT                   SGIGTPGRAADLGVSVAAELFELGARELIADHH"
FT   gene            736017..737681
FT                   /locus_tag="Mmcs_0678"
FT   CDS_pept        736017..737681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0678"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase Uroporphyrinogen III
FT                   synthase HEM4; KEGG: mpa:MAP4004 uroporphyrin-III
FT                   C-methyltransferase / uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06799"
FT                   /protein_id="ABG06799.1"
FT                   /translation="MTRQESGRGRKMKPGRITFVGSGPGDPGLLTARAHSVLVNAALVF
FT                   TDPDVPEAVLSLVGAHLPPPSGPEPAEPADAADEQAGSTIPGGPDIRPALGDPAEVAKV
FT                   LAGEAKHGVDVVRLVAGDPLSVDAVIAEVNALAKSHANFEIVPGLPNTTAVPTYAGLPL
FT                   GSTHTVADVRDPNVDWAALAAAPGPLILHATASHLPDAARTLIEYGLAETTPAVVTANG
FT                   TTCQQRSVESTLSGLLDKAALTAPDATGAPAAPLAGPLVVTLGRTVTNRARLNWWESRA
FT                   LYGWTVLVPRTKDQAGEMSDKLVGHGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQ
FT                   WVVFTSTNAVRAVWEKFNEFGLDARAFSGVKIACVGQATAERVRAFGINPELVPTGEQS
FT                   SLGLLDEFPPYDDIFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPP
FT                   ASTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETAAEFGLRVDV
FT                   QPEVAAVGPLVEALAEHAARLRAEGALPPPRKKSRRR"
FT   gene            737684..738655
FT                   /locus_tag="Mmcs_0679"
FT   CDS_pept        737684..738655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0679"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   mtc:MT0533 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06800"
FT                   /protein_id="ABG06800.1"
FT                   /translation="MRQRPRRLRSTPAMRRLVAETSLEPRHLVLPMFVADGIDEPRPIS
FT                   SMPGVVQHTRDSLRRAAADAVAAGVGGLMLFGVPRDEDKDPRGSIGMDPEGILNVALRD
FT                   LAKDLGEDTVIMADTCLDEFTDHGHCGVLDDRGRVDNDATNQQYVKLAVAQAQSGAHVV
FT                   APSGMMDGQVAAIRDGLDGAGHTDVAILAYAAKFASAFYGPFREAVGSSLQGDRRTYQQ
FT                   DSGNAREALREIELDLAEGADMVMVKPAMSYLDVVRACADISPVPVAAYQISGEYAMIS
FT                   AAAANGWIDLQASALEALTGIRRAGADIVLTYWAADVAGWLG"
FT   gene            738652..739065
FT                   /locus_tag="Mmcs_0680"
FT   CDS_pept        738652..739065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06801"
FT                   /protein_id="ABG06801.1"
FT                   /translation="MTGSAPTRPPDVDTGFWLWVAALPLLVIGYLIDNLMVPVAGASVF
FT                   LKGMAVMIVVVVSAIVVTFLVLLRQGYRWTRTLLTAGGFGSVAYTVTNLFTVERESPVA
FT                   AFGYAVTAIIGSVLIAGGIFLLHRKDANAFFTR"
FT   gene            739086..739532
FT                   /locus_tag="Mmcs_0681"
FT   CDS_pept        739086..739532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06802"
FT                   /protein_id="ABG06802.1"
FT                   /translation="MTASPRPSRPRVVEFGFWALVAGAALLVFGGLIATTVTFETARSA
FT                   VDPEMSNDQLRDYLTVYRGVGIGAAVAGGVLAFLASRARRGDPKFRRATIGLSLAIAVV
FT                   LVLLAAGAGLGQPVMLLALVPIAVGTVLLTRRSAAGWFDQGEAR"
FT   sig_peptide     739086..739190
FT                   /locus_tag="Mmcs_0681"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.705) with cleavage site probability 0.577 at
FT                   residue 35"
FT   gene            739529..740011
FT                   /locus_tag="Mmcs_0682"
FT   CDS_pept        739529..740011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0682"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mbo:Mb0526 possible conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06803"
FT                   /protein_id="ABG06803.1"
FT                   /translation="MTNPSGDPSTERLFYEPGASWAWLLAGPAAGGAMLAIQISAGYGL
FT                   QPLVPGLFLVLVSGFLAVQVKAARIHTSVELTPETLRQGAEITKLSEIVAVYPPATGSE
FT                   MQKWQSARALGELTGVPRGRTGIGLKLSGSRTAQAWARRHATLRAELTRLVEERVP"
FT   gene            740008..740244
FT                   /locus_tag="Mmcs_0683"
FT   CDS_pept        740008..740244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0683"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: mbo:Mb0527 possible transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06804"
FT                   /protein_id="ABG06804.1"
FT                   /translation="MSARSRALFELALAAAAAVGCVLSWAAAGRPATAAPVMPGEPETV
FT                   VTVYSAPLLVLALLLATVAGVLLVLGVARLRRR"
FT   sig_peptide     740008..740112
FT                   /locus_tag="Mmcs_0683"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.539 at
FT                   residue 35"
FT   gene            740266..740724
FT                   /locus_tag="Mmcs_0684"
FT   CDS_pept        740266..740724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06805"
FT                   /protein_id="ABG06805.1"
FT                   /translation="MRDRSPLSRQILVQSTLAGLINLLVNPAIDYLTSRHEPPQRVWGV
FT                   DGLVVGFVLTSLILSTLVGVFSARAARRLDADGMATPRWLRRLPRRGWSAGLALGAGAA
FT                   VFAIAGSWLLSVAGVTTMSLPALMAVKAVYCGTLGFWVARLVILRTLA"
FT   gene            740724..741635
FT                   /locus_tag="Mmcs_0685"
FT   CDS_pept        740724..741635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0685"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa43550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06806"
FT                   /protein_id="ABG06806.1"
FT                   /translation="MLVTELLVQSSESVTLLHMTELAENRTEIDALPLGPQSLVWRYFG
FT                   DNRMYLIGPRPAVLQNMLAELGQGVLDHSVFFSDTAARVKRSLPPIFMTVYGSDDRNEG
FT                   FNVRDFHHDIKGEMPDGSRYHALDPETYFWAHATFVEQVLYFADTFVKRLTRAEKEQIY
FT                   LESKTWYRRYGVSDRPMPATYAEFEQYWERMLDETVIAHQTARYGVGYVTKGFPCPKGV
FT                   HPTVWRVLSIAFDPLAAFLTTGGLPPQARRLLDLPWSEHQERRYQRFAAFWRSRPVNWV
FT                   WDRLPMSVRYNKYAQRGYAQAG"
FT   gene            741619..742212
FT                   /locus_tag="Mmcs_0686"
FT   CDS_pept        741619..742212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0686"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sco:SCO6792
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06807"
FT                   /protein_id="ABG06807.1"
FT                   /translation="MHKPDSATEAILDAAVVEFERHGFRRVALDDVARRAGVSRTTIYR
FT                   RFANRDELVAAVVERENVALFADIALELKEAGPQANYYVEAFTLSILKFRGHRILNGML
FT                   AEDPGFVLALAHQHWAAAVERMAEALRVIFPAGFAERIGPRAVNELADVILRYAATVLL
FT                   LPSMQPLDTADDLRAFATQHFLPSLPAALRAVPA"
FT   gene            742259..742624
FT                   /locus_tag="Mmcs_0687"
FT   CDS_pept        742259..742624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06808"
FT                   /protein_id="ABG06808.1"
FT                   /translation="MSSDDKDEEQTGAEANASQKVADDPDAKITEKPEVTDEHREVAKE
FT                   MRKEYEEERPTIVMPGTGGTVAGTAVNDWVDENGEPKFGKDEGGEGTGGQDGGQDKAKD
FT                   KAEDKAEDKAEASSESG"
FT   gene            742713..743204
FT                   /locus_tag="Mmcs_0688"
FT   CDS_pept        742713..743204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06809"
FT                   /protein_id="ABG06809.1"
FT                   /translation="MHTLDRTAPAFVEMAHTIVWASVATVDANSRPRSRVLHPIWEWDG
FT                   TDLFGWIATVPSPVKRAHLHANPYVSVNYWTPTQDTCSADCLVEWYTDDETRTAVWQKF
FT                   ADGPEPVGYDPYVIPQWSGGPTSDEFAALRLTPYRLRVMPGTVMTQGAGEVLTWHGRLP
FT                   "
FT   gene            743233..743622
FT                   /locus_tag="Mmcs_0689"
FT   CDS_pept        743233..743622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0689"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06810"
FT                   /protein_id="ABG06810.1"
FT                   /translation="MAYLEPPWFTRVVFNWIAKVTGVGGAETLTVSRRRTGGLQSVPVI
FT                   PVEVSGHRYVVSTRGEAQWVKNLRASGTATIGSTAYVAREVAESERPVVLAAYREKAGC
FT                   RRGVLPPAAGRRRPSGVRARAEIAV"
FT   gene            743680..744996
FT                   /locus_tag="Mmcs_0690"
FT   CDS_pept        743680..744996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0690"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase, class I and II aminotransferase
FT                   class-III; KEGG: mpa:MAP4020 glutamate-1-semialdehyde
FT                   2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06811"
FT                   /db_xref="GOA:Q1BE73"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1BE73"
FT                   /protein_id="ABG06811.1"
FT                   /translation="MGAHHTATEQSARLFADACAVIPGGVNSPVRAFNAVGGTPRFITS
FT                   ANGYWLTDADDNRYVDLVCSWGPMILGHAHPAVVEAVQRVAADGLSFGAPTPSETELAS
FT                   EIISRVAPVERLRMVNSGTEATMSAIRLARGFTGRPKIVKFSGCYHGHSDALLADAGSG
FT                   VATLGLPSSPGVTGAATADTIVLPYNDVDAVEEIFEQVGDQIAAVITEASPGNMGAVPP
FT                   EPGFNAALRRITEEHGALLILDEVMTGFRVSRSGWYGLDPVDGDLFTFGKVMSGGLPAA
FT                   AFGGRAEVMERLAPLGPVYQAGTLSGNPVAMAAGLATLRTADDAVYAALDKNADRLAGL
FT                   LTDALTDAGVTHRVQRGGNMLSVFFTAEPVGDFATARASETWRFPPFFHALLDAGVYPP
FT                   PSAFEAWFVSAALDDEAFDRIAAALPGAARAAAEASRPA"
FT   gene            744993..745601
FT                   /locus_tag="Mmcs_0691"
FT   CDS_pept        744993..745601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0691"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mpa:MAP4021
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06812"
FT                   /protein_id="ABG06812.1"
FT                   /translation="MTEKTIVHVMRHGEVHNPEGILYGRLPDYHLSERGRAQAEAVAAW
FT                   LAHRDVVYVVASPLERAQETAGPIAAAHGLSIDTDDELIESLNVFQGKRVSPGDGALRN
FT                   PANWRHLRNPRTPSWGEPYRDIAERMTAALHRAREKAAGHEAVCVSHQLPVETLRRAVT
FT                   GKPLHHFPTRRLCNLASVTSFYFHGDEYVGWGYAELSGQ"
FT   gene            745598..746209
FT                   /locus_tag="Mmcs_0692"
FT   CDS_pept        745598..746209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0692"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin; KEGG: mbo:Mb0539 possible thioredoxin
FT                   protein (thiol-disulfide interchange protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06813"
FT                   /protein_id="ABG06813.1"
FT                   /translation="MRRWWIVLASVAVVALAGCSTGDDAVAQGGTFEFVAPGGKTDIFY
FT                   DPPADRGRPGALSGPDLLDPAKTLSLDDFAGQVVVINVWGQWCAPCRTEIGELQQVYDA
FT                   TRAKGVAFLGIDVRDNNREAAVDFVRDRGITFPSIYDPPMRTMIAFGGKYPTTVIPSTV
FT                   VLDREHRVAAVFLRELLAEDLQPVVERLAAEPAADAGAQP"
FT   sig_peptide     745598..745666
FT                   /locus_tag="Mmcs_0692"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.894 at
FT                   residue 23"
FT   gene            746206..746985
FT                   /locus_tag="Mmcs_0693"
FT   CDS_pept        746206..746985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0693"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: mpa:MAP4023 cytochrome c-type biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06814"
FT                   /protein_id="ABG06814.1"
FT                   /translation="MTGFAEIAAAGPVALAMGLCVLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDTDETGSGAVAVRTRRLKVAGAAGLFVAGFTAVFLLGTVAVLGMTTTLITNQLL
FT                   LQRIGGVVTIIMGLVFIGLIPALQRQARFTPRQLSTVAGAPLLGAVFALGWTPCLGPTL
FT                   TGVITVASATDGASVARGVALVIAYCLGLGIPFVLLAFGSARAVQGLGWLRRHTRTIQI
FT                   FGGVLLLIVGAALVTGVWNDFVAWVRDGFVSDVRLPI"
FT   sig_peptide     746206..746295
FT                   /locus_tag="Mmcs_0693"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.609 at
FT                   residue 30"
FT   gene            746985..748595
FT                   /locus_tag="Mmcs_0694"
FT   CDS_pept        746985..748595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0694"
FT                   /product="ResB-like protein"
FT                   /note="PFAM: ResB-like; KEGG: mbo:Mb0541 probable conserved
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06815"
FT                   /protein_id="ABG06815.1"
FT                   /translation="MPRPFSKLLAYARNTWRTLTSMGTALVLLFLLALAAIPGALLPQR
FT                   SLNEAKVAEYIAERPTLGPWLDRVQAFDVFSSFWFTAIYVLLFISLVGCLTPRLVEHVK
FT                   SLRAVPVPAPRNLGRLPKHHTAEVAGDPQQVAAAMGEELKGWRKTTRTDGEVTEVSAEK
FT                   GYLREFGNIVFHFSLLGLLVAIAAGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGN
FT                   TVDGTSLYPICLKVNGFQADYLDNGQATSFSADIAYQAGEDLSTGTWRPYELKVNEPLR
FT                   VGGDRVYLQGHGYAPTFTVTFPDGQTRTQTLQWRPDDQTTFLSSGVMRFDPPAGTYPDA
FT                   DERRKNQIAIQGLFAPTQLLHGSLLSSSFPAMRDPGVAIDIYRGDTGLDSGRPQNIFSL
FT                   DERLVGQGRLTREARVNLDLGAETRLDDGTVVRFDGAVPFVNVQVSHDPAQIWVLVFAM
FT                   TMMAGLVVSLIIRRRRVWVRITPAGPGTVGVEFGGLARTDNSGWGEEFERLTVRLLAGH
FT                   PDAGHAGTQADAVSGERVT"
FT   sig_peptide     746985..747092
FT                   /locus_tag="Mmcs_0694"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 36"
FT   gene            748662..749666
FT                   /locus_tag="Mmcs_0695"
FT   CDS_pept        748662..749666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0695"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   mpa:MAP4025 CcsB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06816"
FT                   /protein_id="ABG06816.1"
FT                   /translation="MNTVEIDLGLARYSDWAFTSSVVVLVVALLLLAVELAYSRGRTVE
FT                   RRELVSAGAAPAATSGRGVGADSAGPGIVADTPRRPLGERIGSSGVALVYVGTALLLAC
FT                   IVLRGLSTSRVPWGNMYEFINLTSFCGLVAAAVVLRRPQYRALWVFVLVPVLILLTVSG
FT                   RWLYSHAAPVMPALQSYWLPIHVSVVSLGSGVFLVGGVASILFLLKMSRFGQPGHDGPV
FT                   ARIVQRLPDAQTLDRIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFIA
FT                   WVVYAAYLHARSTAGWRDRKAAWINVAGFIAMVFNLFFINLVTVGLHSYAGVG"
FT   gene            749666..750832
FT                   /locus_tag="Mmcs_0696"
FT   CDS_pept        749666..750832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0696"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP4026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06817"
FT                   /protein_id="ABG06817.1"
FT                   /translation="MGDHSAGGFRAQQRFRDPAADEPQAPPEWSVPTPPTGIPVVDPAA
FT                   VAPAPSVAEPQLDAQPVSHPVSQPLPVPPTPYLDLSTVALLGRPKEAPSHGWRKWLYLA
FT                   TFKLVNIGESPKAAQQDSLVTRVKQPLGGCYRIAVLSLKGGVGKTTITATLGATFASIR
FT                   GDRVVAVDANPDRGTLSQKVPLETTATVRHLLRDAEGIERYSDVRAYTSQGPSRLEVLA
FT                   SETDPAVSEAFSSDDYTRTLEVLERFYSLVLTDCGTGLMHSAMTSVLAHADVLVVISSG
FT                   SVDGARSASATLDWLDAHGHQAMVANAIAVINAVRPRSGKVDLQKVSDHFSRRCRAVQV
FT                   VPFDPHLEEGAEISLDRLKPATRQALLELAGVVADGFAGAARRDGDRG"
FT   gene            751062..751379
FT                   /locus_tag="Mmcs_0697"
FT   CDS_pept        751062..751379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0697"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbo:Mb0544 possible conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06818"
FT                   /protein_id="ABG06818.1"
FT                   /translation="MSEGRQGARLVADVLIYVGARLLLVAVLAAAILGVGHLLGLREFP
FT                   LVIAILFALVIALPLGIWMFAPLRQRATASIAAFDEQRRKDREQLQARLRGEESPGDPQ
FT                   A"
FT   gene            751376..752419
FT                   /locus_tag="Mmcs_0698"
FT   CDS_pept        751376..752419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0698"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: tfu:Tfu_0028
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06819"
FT                   /protein_id="ABG06819.1"
FT                   /translation="MTPRQVYGAEFAGAAGFLNSPTYGLPPDFLMRALHDCLAAWQAGT
FT                   LDAKSFDQPVRDARAAYAALVGVPYATVAMAGSTSAALGLVAAAIPDGSRGATLAGEFT
FT                   STTFPFAAQARRGVSLTELSADELVARAGDYDFVTVSLVQSATGAVLDAEALRTNVAGT
FT                   GTLTIVDVTQAAGWKLLNLDWADVTVASVYKWLLAPRGTAFLSVSERTADLMTPHAANW
FT                   YAGNQPWESIYGLPLRLASDARRFDVSPAWFSALGAGLTLPWLAGLDRAAVEAHTVGLA
FT                   DTLRAELDLPPHPSAIVTLPSDRHDDAAERLQRAGIHASVRAGAVRVGFHLYNTADDLN
FT                   GLLDALA"
FT   gene            752450..752794
FT                   /locus_tag="Mmcs_0699"
FT   CDS_pept        752450..752794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0699"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06820"
FT                   /protein_id="ABG06820.1"
FT                   /translation="MTTHKNLYEQWITRLWAGEPVAAELVTDDFVGHWPDREVHGPAEL
FT                   QAIIEQTHKMLSDLTFEIELGPFVDGDMVAGRWVGSGTGEQGPMRFTGNDILRVADGKF
FT                   AEYWTGTSTS"
FT   gene            752878..753135
FT                   /locus_tag="Mmcs_0700"
FT   CDS_pept        752878..753135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0700"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa51500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06821"
FT                   /protein_id="ABG06821.1"
FT                   /translation="MTPPELSSYLDTVTDIDELNAATKAVASADPAVGLRAVKALRRTV
FT                   EKLEAMHVADARRKGWSWQAIADALGVSRQAVHQKHNGRS"
FT   gene            753137..753688
FT                   /locus_tag="Mmcs_0701"
FT   CDS_pept        753137..753688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0701"
FT                   /product="Clp, N terminal"
FT                   /note="PFAM: Clp, N terminal; KEGG: nfa:nfa51490 putative
FT                   Clp protease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06822"
FT                   /protein_id="ABG06822.1"
FT                   /translation="MFERFSGPARTAVTLAHEEARAMRADDIRPEHLLVGVLRSAGPSL
FT                   SRVLNGHALTAEDVRERLAAASTGEFDDDASALREIGIDLYAVRDIADRRFGVGAFDSA
FT                   GRAPRRRRRLGTPLVKPAKKALELALREALAHRDSVIGCEHLLLGILRGGDEVAVGLIT
FT                   ERVDAAWLRADIVALLDRAA"
FT   gene            complement(753701..754570)
FT                   /locus_tag="Mmcs_0702"
FT   CDS_pept        complement(753701..754570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0702"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   mpa:MAP4029c 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06823"
FT                   /protein_id="ABG06823.1"
FT                   /translation="MATFAEWVEGARPRTLPNAVAPVIAGTGAAAWLDGAVWWKALLAF
FT                   VVAVALIIGVNYANDYSDGIRGTDDVRSGPLRLVGSRLASPRAVLTAAIASLAVGAVAG
FT                   LALAVASAPWLIAVGAVCIAGAWLYTGGSKPYGYLGLGEVAVFVFFGLVAVLGTQYTQA
FT                   LRVDWVGLALAVAMGALSSAVLVANNLRDIPTDRESGKITLAVRLGDARTRLLYQALLA
FT                   TAFALTLVLMLATPWCAVGLVALPLAVRAARPVRGGLGGKDLIPVLRDTGLTMLVWAVA
FT                   VALALALG"
FT   gene            754663..755439
FT                   /locus_tag="Mmcs_0703"
FT   CDS_pept        754663..755439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0703"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="KEGG: mpa:MAP4030 methylthioadenosine phosphorylase;
FT                   TIGRFAM: Methylthioadenosine phosphorylase; PFAM: purine
FT                   phosphorylase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06824"
FT                   /protein_id="ABG06824.1"
FT                   /translation="MLGVIGGSGFYSFFGPDARSVRLDTPFGAPSAAITVGTVGDHEVA
FT                   FLPRHGVDHEFSPHTVPYRANMWALRALGVRRIFGPCAVGSLTPDLGPGSMVVPDQLVD
FT                   RTSGRDDTYFDSGGIHVDFADPYCPTLRAAAAGLPGVVDGGTMVVIQGPRFSTRAESKW
FT                   FASQGFSLVNMTGYPEAVLARELEMCYAAIALVTDLDAGIDSETAVRAVNVFAEFQRNL
FT                   VPFKKVVHEAIDQVAVERTCDHCLPHDGVTLPIELP"
FT   gene            755436..756467
FT                   /locus_tag="Mmcs_0704"
FT   CDS_pept        755436..756467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0704"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: mbo:Mb0550 probable
FT                   UDP-glucose 4-epimerase GalE3 (galactowaldenase)
FT                   (UDP-galactose 4-epimerase) (uridine diphosphate galactose
FT                   4-epimerase) (uridine diphospho-galactose 4-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06825"
FT                   /protein_id="ABG06825.1"
FT                   /translation="MRVLLTGAAGFIGSRVRAALESAGHEVVAVDVMLPAAHGGAAPLP
FT                   EDTHRVDVRDADALAPLLEGVDAVCHQAAVVGAGVNAADAPSYGSHNDYGTTVLLAEMF
FT                   AAGVRKLVLASSMVVYGQGRFDCPAHGPVDPLPRTRADLDAGVFEHRCPVGGEELQWRL
FT                   VGEDEPVRPRSLYAASKAAQEHYALAWAEATGGSVVALRYHNVYGPHMPRDTPYSGVAA
FT                   IFRSELENGDVPRVFEDGGQMRDFVHVDDVAAANLAAIEADLPGFEAFNVCSGRPISII
FT                   EVASELCEIRGAAPPLVTGQYRSGDVRHIVASPRRAAEQLGFRAVVDPRDGLREFAFAP
FT                   LRA"
FT   sig_peptide     755436..755492
FT                   /locus_tag="Mmcs_0704"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.867) with cleavage site probability 0.626 at
FT                   residue 19"
FT   gene            756469..757296
FT                   /locus_tag="Mmcs_0705"
FT   CDS_pept        756469..757296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0705"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtu:Rv2307c hypothetical protein Rv2307c"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06826"
FT                   /protein_id="ABG06826.1"
FT                   /translation="MRRWARLVVIVVLVANGALALLWNQQRRLIYFPAPGPVPSATAVW
FT                   SGARDVVVRTADGVDLGAWFFAAADRGPAVLVCNGNGGDRSMRAALALALRRMGLSVLL
FT                   FDYRGYGGNPGRPTEDGLAADARAARDWLAAQPEVDPDRLAYFGESLGGAVAVGLAAAR
FT                   PPAALVLRSPFTSLADVGAVHYPWLPVRRLLLDRYPSIERIAGIHAPLLVIAGDRDDIV
FT                   PAGLSRRLYDAAAEPKEFVLVPGAGHNDPELLDGPQMLEAIERFLRHTAVLGP"
FT   sig_peptide     756469..756531
FT                   /locus_tag="Mmcs_0705"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.810 at
FT                   residue 21"
FT   gene            757317..758441
FT                   /locus_tag="Mmcs_0706"
FT   CDS_pept        757317..758441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0706"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   bja:bll2937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06827"
FT                   /protein_id="ABG06827.1"
FT                   /translation="MKTAICEQFGIDFPLFAFSHCRDVVAAVTNAGGFGVLGATAYTPE
FT                   QLDRELSWIDEQVGGKPYGADIIVPAKFEGKGENLTRTDLVDRIPAEYREFVTQLLADH
FT                   DIELDSAPKLGGSSLSGDTGRELLDVAMSHPIKLIANALGVPPDYMIEAGRERGVPVAA
FT                   LVGAREHAVKQVAAGVDLIVAQGTEAGGHCGEVTTLVLIPEVIAAVEETGTKVPVLAAG
FT                   GIVTGRQMAAAVAMGADGAWTGSVWLTTEEAETAPHTVQKMLAATSRDTVRSAGRTGKP
FT                   ARQLVSDWTQAWAPRGDRRPLPLPLQNMLAEPLLRRIDVLAAQGHPGAQQLATYFVGQG
FT                   VGLMNKVKPAREVVREFIEDYLSAAERLNNSLPD"
FT   gene            758483..759829
FT                   /locus_tag="Mmcs_0707"
FT   CDS_pept        758483..759829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0707"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase FAD dependent oxidoreductase; KEGG:
FT                   mpa:MAP1561c NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06828"
FT                   /protein_id="ABG06828.1"
FT                   /translation="MSHSRPGVLIIGGGFGGLFCARRLSRADVDVTVLDRAAGHLFQPL
FT                   LYQCATGKLSIGQISRPLREEFARHRNIRTLLGEAIELDPVARSVTALRPDETTFTVDY
FT                   DVLVVAAGMRQSYLGNEQFAEWAPGMKTLDDALDIRQRLFTAFEIAETLPPGPERTSWL
FT                   TFAVAGGGPTGVELAGQIREVATKTLAKEFHSIDPEEARVLLFDGGDRVLKTFAPALSL
FT                   KANDTLRELGVELHFGVHVTDVRRDGITVTPKQGGPDQQFGTRTVLWTAGVEAVRFARH
FT                   VAEVLGAETDRAGRITVGPDLTVAGHPEIFVIGDLAGREGLPGVAENAMQGGLHAASCI
FT                   RRDLAGRPRRPYRYRDLGSAAYISHGHALLQVGPLRVSGYAGWVAWGLLHIAFLTGVSN
FT                   RISTVATWLASIARTGRYHRAFMLGAGDRHDQRYTYSSWDLAEPAPEGN"
FT   gene            complement(759850..760884)
FT                   /locus_tag="Mmcs_0708"
FT   CDS_pept        complement(759850..760884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0708"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: sco:SCO3740 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06829"
FT                   /protein_id="ABG06829.1"
FT                   /translation="MPSTDLWEIGAWALACSIPVVLAGALVIRLARTWSLAVSMVVLVL
FT                   IPVIATFTGVLGASGFMITETFEPIAVVLVVVAVVTIPGAVMLGRYQARRTVWEQEIRD
FT                   SERAAEMSRRQLVAFVSHDLRTPLAGIRAVSEAIADGLVGGDEVRAHAKHIEQESIRLS
FT                   EMVDDLFEMSKINAGAVQPTFDRVALDEVVDDVLAAHRIAAERAGVQLRAELPDEPVRV
FT                   LGSDRALVRVLSNLVANAIAHTPEGGRVQLALGSDENVAWARVDDTGVGIDEADLPRVF
FT                   DVAYRGSNDRVPREDSSLPSGSGLGLAIAAGLVQAHRGTLSAHNLDTGARFEVRLPLAS
FT                   DVSD"
FT   gene            complement(760871..761584)
FT                   /locus_tag="Mmcs_0709"
FT   CDS_pept        complement(760871..761584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0709"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: sco:SCO3741 putative
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06830"
FT                   /protein_id="ABG06830.1"
FT                   /translation="MTRVLIADDDSVVRDVVRRYLERDGLEVAIARDGTEALRLLGTER
FT                   IDVAVLDVMMPGPDGVTLCRTLRQRGEHTVPVILLTALGEEDDRIAGLEAGADDYLTKP
FT                   FSPRELALRVRSVLRRSPTPVGVTPVDLTVGALTISAAARSVTVDGRPVSLTNREFDLL
FT                   LFFITHADTVFTREELLKQVWRWDFGDLSTVTVHVKRLRSKLGDQHRVQTVWGRGYMWS
FT                   DTAGALEGLASGAVN"
FT   gene            761623..762342
FT                   /locus_tag="Mmcs_0710"
FT   CDS_pept        761623..762342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0710"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mpa:MAP4035 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06831"
FT                   /protein_id="ABG06831.1"
FT                   /translation="MSEIRHCCPRWPPVGVVSLGAMPECPVTVVLPCLDEAESLPAVLA
FT                   ALPDGYRALVVDNNSTDGTAEVARRHGAEVVHEARPGYGAAVHAGVVAAGTPVVAVLDA
FT                   DGSLDPRELPALVAELDRGAHLVVGRRRAVPGLRWPWHARLGTAAVCWRLRRRHGLPVH
FT                   DIAPMRVARRDDLLALGVRDRRSGYPLELLVRAAAADWRVVEFDVTYGPRTGGRSKVSG
FT                   SLRGSVVAALDFWRVIE"
FT   gene            762339..763010
FT                   /locus_tag="Mmcs_0711"
FT   CDS_pept        762339..763010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0711"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP4036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06832"
FT                   /protein_id="ABG06832.1"
FT                   /translation="MTQLPVTVLVVAKAPVPGLAKTRLAVTVGFEMAAVIASAALLDTL
FT                   DAVLATPVQARVVALTGDLDDVHNGAVLRAKLAGFTVVDQHGDSFAERLAYAHVDAAAA
FT                   VGDRPILQIGMDTPQVTADLLARCAQTLLGADAVLGPAVDGGWWLLGVRTAAMADCLRE
FT                   VPMSRDDTGELTRKALQDRGFDVVIVDELADVDTAADVEPVRRACPPGGRFPFATAAAG
FT                   L"
FT   gene            763015..763644
FT                   /locus_tag="Mmcs_0712"
FT   CDS_pept        763015..763644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0712"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: fra:Francci3_0981 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06833"
FT                   /protein_id="ABG06833.1"
FT                   /translation="MLGNLYDRALDGERCWIRSGDGEVKTLPVRSWLGGRHADRLFDRA
FT                   VVRLCEGPTIDLGCGPGRLVADLVRRGVPALGVDQSATAVELARRNGAPALRRDVFGAL
FT                   PGLGRWQTALLADGNIGLGGDPRRVLRRAAELLRPGGRCVVEFDSETQGVQKNLVRLES
FT                   SNTVGPWFRWASVGVDCAAALAEEAGLVMTGLHPAGRRILATLATP"
FT   gene            complement(763664..764092)
FT                   /pseudo
FT                   /locus_tag="Mmcs_0713"
FT   gene            complement(764110..765354)
FT                   /locus_tag="Mmcs_0714"
FT   CDS_pept        complement(764110..765354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0714"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   mtc:MT0228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06834"
FT                   /protein_id="ABG06834.1"
FT                   /translation="MGPRKFPWRSPLRGRWLTSVLGAVLLVTLPIVTVTGLLSYIAYGP
FT                   QFGQAIPADVGWLKLPTFDWPTDPAWLYRLTQGLHVGLGLILIPVVLAKLWSVIPRLFV
FT                   WPPARSIAQLLERVSLLMLVGGILFEIVTGVLNIQYDYIFGFSFYTAHYFGAWVFIAGF
FT                   LVHIAIKIPRMRAGLRSMPLRAVLRTDRAGTRPEAFEPDGLAPADPAEPTVSRRGALAL
FT                   VGGGALLMAVLTAGQTLGGVTRQAALLLPRGRSYGDGANDFQVNRTARAAGITPAATGA
FT                   AWALTLRGGPRPIVLDRAALAALPQHTARLPIACVEGWSTTQTWSGVRLRDLAALAGVP
FT                   EPASAVVSSVERRGAFNRARLQANQIAHGDALLALRVNGADLSPDHGFPARVIVPALPG
FT                   VHNTKWVSAIEFEAP"
FT   sig_peptide     complement(765253..765354)
FT                   /locus_tag="Mmcs_0714"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.621) with cleavage site probability 0.248 at
FT                   residue 34"
FT   gene            complement(765416..766771)
FT                   /locus_tag="Mmcs_0715"
FT   CDS_pept        complement(765416..766771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0715"
FT                   /product="putative conserved integral membrane protein"
FT                   /note="KEGG: mbo:Mb0555c probable conserved integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06835"
FT                   /protein_id="ABG06835.1"
FT                   /translation="MRAHRRETIAAAVGLLLVVTAFIVPHLDLGVVTPLINATPERFRS
FT                   FAGTAPVFGWWNAHVGWGTVPAVFLGVAAVVWGRTLSERLSWRTLVPATWATSAAWAFS
FT                   LAMVDGWQRGFAGRLTARHEYLRQVPTVTDIPDAVRTFADRILDYQPDSWITHVSGHPP
FT                   GALLTFVWLDRIGLGGGAWAGLLCLLAGSSVAAAILVAVRALADERAARLAAPFLAVAP
FT                   TAIWVAVSADGYFAGVAAWGIALLALAVRRVGRRPELFAVGAGLLLGWAVFLNYGLVLM
FT                   ALPALAVLICSADWRSALRALLPAIGAAVVIVVVFVIAGFWWFDGYQLVQERYWQGIAV
FT                   DRPFQYWGWANLASVVCAIGLGSVAGLGRVFDIAAIRARSGLHLLMLGALAAILCADLS
FT                   MLSKAETERIWLPFTMWLVAAGALLPVRAQRWWLALNVLGALLINHLILTNW"
FT   sig_peptide     complement(766706..766771)
FT                   /locus_tag="Mmcs_0715"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.674) with cleavage site probability 0.335 at
FT                   residue 22"
FT   gene            766980..767834
FT                   /locus_tag="Mmcs_0716"
FT   CDS_pept        766980..767834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0716"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   tbd:Tbd_1943 putativel formate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06836"
FT                   /protein_id="ABG06836.1"
FT                   /translation="MSYVNPAQFVTKMIDAGETKAFMSTRDTVIRAYMAGAILALAAAF
FT                   AVTITVQTGNALAGAVLFPVGFCLLYLLGFDLLTGVFTLVPLALLDKRRGVTVGSVMRN
FT                   WGLVFLGNFAGALTVAFMMAIVFTYGFSVDPNEVGQKLGEIGHSRTVGYAEHGAAGMLT
FT                   LFIRGVLCNWMVSTGVVAAMMSTSVSGKVIGMWMPIMLFFYMGFEHSVVNMFLFPSGLM
FT                   LGGDFSIMDYLVWNEIPTVVGNLVGGLAFVGLTLYATHARTGTEWNRPVDPEQFTLPVE
FT                   ARA"
FT   gene            767831..768286
FT                   /locus_tag="Mmcs_0717"
FT   CDS_pept        767831..768286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0717"
FT                   /product="cyanate lyase"
FT                   /EC_number="4.2.1.104"
FT                   /note="KEGG: mpa:MAP4098 cyanate lyase; TIGRFAM: cyanate
FT                   lyase; PFAM: Cyanate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06837"
FT                   /protein_id="ABG06837.1"
FT                   /translation="MTREQLTAEIQAARLAKQLTWQQLADAIDRPVMWTIAALLGQHPI
FT                   PVDSGKVLVDMLGLDEAAIPVLAAVPMRGGLPTAVPTDPTIYRFYEVLQVYGGAIKELI
FT                   HEEFGDGIMSAINFSIDVQRKPHPAGDRVVVMLDGKFLPYDWTAAEV"
FT   gene            complement(768300..770624)
FT                   /locus_tag="Mmcs_0718"
FT   CDS_pept        complement(768300..770624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0718"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: Oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase molydopterin
FT                   dinucleotide-binding region; KEGG: mbo:Mb2924c possible
FT                   formate dehydrogenase H FdhF
FT                   (formate-hydrogen-lyase-linked, selenocysteine-containing
FT                   polypeptide) (formate dehydrogenase-H alpha subunit)
FT                   (FDH-H)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06838"
FT                   /protein_id="ABG06838.1"
FT                   /translation="MNSRRRPHHDYDASFDEHAIVTSEPKTEAAGVKAVMVSLKRGVEQ
FT                   MGAVRTATALTRLNQRHGFDCPGCAWPEDAGGRKLAEFCENGAKAVAEEATRRVVTPEF
FT                   FARHSVAELGGRPEYWLSQQGRLTHPVVLRPGATHYEPIAWDDAYRLIADELRALADPD
FT                   EAVFYTSGRTSNEAAFLYQLLVRSFGTNNLPDCSNMCHESSGAALTESIGIGKGSVTVA
FT                   DVEHADLIVIAGQNPGTNHPRMLSVLEKAKANGAIVVAINPLPEAGLMRFKDPQKVHGV
FT                   IGHGVAIADEFVQIRLGGDMALFAGLGRLLLEAEDAAPGTVLDRAFVDGHCAGFADYEA
FT                   QARAVDLDTVTEATGVGREQLQRIARLLIDSERTVLCWAMGLTQHRHAVATIGEATNLL
FT                   LMRGMIGKPGAGLCPVRGHSNVQGDRTMGIWEKMPETFLAALDERFGITSPRKHGMDTV
FT                   DAIRAMRDGRAKVFIGMGGNFSSATPDTGVTEAALRNCTLTVQISTKLNRSHLVHGRTA
FT                   IILPTLGRTDRDVQAGGKQVVSVEDSMSMVHLSRGSLHPPSDQVRSEVAIVCQLARTLF
FT                   GADHPVPWDWFVADYDRIRDAIAAVVPGCADYNARVRRLDGFQLPHPPRDAREFHTHTG
FT                   KANFAVNPLEWVPVPPGRLVLQTLRSHDQYNTTIYGLDDRYRGVKGGRRVVFVNPADIE
FT                   SLGLRDGQRVSLISEFPDADGSIVERRVDDFLVVPYSTPVGNAAAYYPETNPLVPLDHT
FT                   AAKSNTPVSKAVVVRLEAAQP"
FT   gene            770812..771696
FT                   /locus_tag="Mmcs_0719"
FT   CDS_pept        770812..771696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0719"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: mbo:Mb2656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06839"
FT                   /protein_id="ABG06839.1"
FT                   /translation="MSSSVTTHGIVVGVDGSAAGKVAADWAARDAARRGVPLTLVHVIA
FT                   PKDLQMWIEVPAPQEYLRWQSERSERVMAEATAIAERAAENRQLTVVRQVVPGEAKATL
FT                   IDMSKDADMVVVGSRGLGAWGRRLLGSVSTAVVHHAQCPVAVIHDEDPLMDHPDQAPVV
FT                   VGVDGSKAAEQAIAIAFEEASLRGVDLVAVHAWNDVDYEFPDIKWVDYTARGERIVAEC
FT                   LAGYCETYPDVTVRKVLVRDRPAHQLLQQSEAAQLLVVGSHGRGGFPGMLLGSVSSEVV
FT                   QSARMPVIVARSN"
FT   gene            complement(771697..772005)
FT                   /locus_tag="Mmcs_0720"
FT   CDS_pept        complement(771697..772005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0720"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   nfa:nfa37430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06840"
FT                   /protein_id="ABG06840.1"
FT                   /translation="MTVYAVAQLRFTDRTAYDRYQAAFMEVFARYSGTLLAADDAPRVI
FT                   EGEWTGDKVVLMSFPDEAEFRRWADSPEYQQISVDRRAGADTVVLLVHGIAASIRNR"
FT   gene            complement(772025..772729)
FT                   /locus_tag="Mmcs_0721"
FT   CDS_pept        complement(772025..772729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0721"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: nfa:nfa31500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06841"
FT                   /protein_id="ABG06841.1"
FT                   /translation="MEDDRPSTHTGSIRAIAALGDDLRRRLYEYARDERRPVSRDEAAS
FT                   AVGISRKLAAFHLDKLVDVGLLRFRFLQPAEARVGRPPKVYAPADAEFAVSIPARRPDL
FT                   LADILAHAVLDDGDRTSARAAAVRVAHQRGVDATTAVKRPRGGRIGAERALRLAEELLV
FT                   DYGFEPYRARAGCIRLRNCPFHPLARELPELVCRLNHAFLAGALDGLGADTVEAVLSPV
FT                   AGECCVELLPTR"
FT   gene            772821..773378
FT                   /locus_tag="Mmcs_0722"
FT   CDS_pept        772821..773378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0722"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa31490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06842"
FT                   /protein_id="ABG06842.1"
FT                   /translation="MWEVVVNAPLEQAKRPVSALLAGPYGHPFHPILVTVPIGAWASSL
FT                   VFDVASHLVDGPGFLAQGAEWLIAIGVLGALVAATVGFLDLIATPSRTRAHRIGLLHMA
FT                   LNLTVTALYIAGFAWRHADYPQQAAVGFGPLALSVVSFAVLAVSGYLGGMLSYRYGVRV
FT                   AEESTQAEGFGRVEQPAQGGKP"
FT   gene            773375..773809
FT                   /locus_tag="Mmcs_0723"
FT   CDS_pept        773375..773809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0723"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa31480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06843"
FT                   /protein_id="ABG06843.1"
FT                   /translation="MSIASLIAWILTAGGGAFMLAKWVGGGGHRDRTRTHLPPAVVFGH
FT                   FALAALGLVLWIVYVFTDNHPIGWVALALLVPVAALGVVMVLRWLPVHRAQAQSVGGGS
FT                   QAALHDAPERSFPVAVVAAHGVLAVATVVLGLLAILGIGG"
FT   gene            complement(773810..774460)
FT                   /locus_tag="Mmcs_0724"
FT   CDS_pept        complement(773810..774460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0724"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: nfa:nfa3030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06844"
FT                   /protein_id="ABG06844.1"
FT                   /translation="MAALRKPGMMGPMRREVTTVEELRAIVGHPNSYVANKVGPRLSSV
FT                   QQEWLRAASLGFVATVDAQGHLDVSPKGDPAGFVHIIDDRTIAIPERPGNKRVDGYLNV
FT                   LQRPRVGTVFVIPGRGDTLRINGSATVLADADYFDGMAVRGKRPVLALEIRVEEVFFHC
FT                   AKAFLRSGAWNPESWTPDAVPSVAQLAKTFKPDLTQAELDEYYSPDNMDKQLY"
FT   gene            774511..774852
FT                   /locus_tag="Mmcs_0725"
FT   CDS_pept        774511..774852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0725"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa35360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06845"
FT                   /protein_id="ABG06845.1"
FT                   /translation="MSRHVEVDDDLWDEFHRVVNMTSRELLDWLRTRSAGEGSEELPDQ
FT                   AGTQTGRHVLDILGKRRGDLTADDEHVMRRVVERVHAERRDDLEPTAGQENWRHRLMTI
FT                   GHDPLKPPR"
FT   gene            complement(774876..775940)
FT                   /locus_tag="Mmcs_0726"
FT   CDS_pept        complement(774876..775940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0726"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpa:MAP4038c O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06846"
FT                   /protein_id="ABG06846.1"
FT                   /translation="MAGRGPALLPTPADDADHAARLSGALRAGAAIDEDVAVVVPTSGT
FT                   TGTPKGAMLTAAALTASAHATHARLGGPGRWLLALPAHHIAGLQVLVRSVVAGERPVAI
FT                   PASFEPPDLVSAVAGMGAGRRYVSLVSVQLDKALRDPAATAALATFDAVLIGGGPMPAG
FT                   LAEKASAAAVPVVRTYGMSETAGGCVYDGVPLDGVRVRLEGSRVLLGGPTLAKGYRNTV
FT                   QPDPFAEPGWFRTDDVGALDDGVLRVLGRVDDAVSTGGLTVMPPVVEAVLSRHPAVADC
FT                   AVFGVADERLGQRVVAAIVLAAGAPAPTVADLRAHVARELDATAAPREVHVVDEVPRRG
FT                   IGKVDRRALSAQFS"
FT   gene            complement(776012..776236)
FT                   /locus_tag="Mmcs_0727"
FT   CDS_pept        complement(776012..776236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0727"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP4039c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06847"
FT                   /protein_id="ABG06847.1"
FT                   /translation="MPLLALLRRRLTDEEVTAVAQTLAERGQWDHVDIAVMITSITDDM
FT                   PTPADIERVRTRLAGRSWPIDDREPREDT"
FT   gene            776528..777778
FT                   /locus_tag="Mmcs_0728"
FT   CDS_pept        776528..777778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0728"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: cef:CE0474
FT                   putative phosphate transport protein PitA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06848"
FT                   /protein_id="ABG06848.1"
FT                   /translation="MSSEWIILVLLIATALAFDFTNGFHDTGNAMATSIATGALKPKTA
FT                   VTLAGVLNLVGAFLSVEVAVTVTTSVLKIQDSKTGSLLPNIDASTGLTIIFAGLVGGIL
FT                   WNLLTWLFGIPSSSSHALFGGLMGAGLAAIGLAGVNWSGVTQKVLIPAIAAPVIAGLVA
FT                   GCGTWLIYRITRRVGRKQRESGFRWGQIATASLVALSHGTNDAQKTMGVIALALITTGH
FT                   LTGDVAEDGLPFWIIASCALAIGLGTYLGGWRVIRTLGKGLVEIESPQGLAAEASSAAI
FT                   ILSSSAAGMALSTTHVATGSILGSGVGKPGAHVRWAVAGRMAVAWLITLPAAGLVGALA
FT                   FWVSHSVAGMTTQLVGDGLIFLILVGTSFGLWWRAQQQKVDHRNVNADWDASTNSVVPV
FT                   EVREPVPVAKAKDVAAV"
FT   sig_peptide     776528..776581
FT                   /locus_tag="Mmcs_0728"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.905) with cleavage site probability 0.703 at
FT                   residue 18"
FT   gene            777808..778086
FT                   /locus_tag="Mmcs_0729"
FT   CDS_pept        777808..778086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0729"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06849"
FT                   /protein_id="ABG06849.1"
FT                   /translation="MVNLESILRVLVVGLILGAGLPALFACGLVAYSSGAGTPDADGVT
FT                   RAPNPALKYLGVALFTIVAAVILVGLLWITRSTIEHQFGLDLFPFAK"
FT   sig_peptide     777808..777915
FT                   /locus_tag="Mmcs_0729"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.321 at
FT                   residue 36"
FT   gene            778094..778402
FT                   /locus_tag="Mmcs_0730"
FT   CDS_pept        778094..778402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0730"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa52490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06850"
FT                   /protein_id="ABG06850.1"
FT                   /translation="MTTDNAGVMDKVLTWLRDGYPQGVPPKDYFPLLALLKRSLTEEEV
FT                   VRAAQSILRSTDSDVVTEDEIRTAVHEVIAKEPNPEEVHQVAARLASVGWPLAAPVR"
FT   gene            complement(778408..778779)
FT                   /locus_tag="Mmcs_0731"
FT   CDS_pept        complement(778408..778779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0731"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpa:MAP4042c hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmcs_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABG06851"
FT                   /protein_id="ABG06851.1"
FT                   /translation="MEILASRMLLRPADYQRSLRFYRDGLGLAIAREYGGGTVFYAGQS
FT                   LIELAAHGGPDAGGTLWLQVRDIHTAQDELRDRGVEIAREARQEPWGLYEMHVTDPDGV
FT                   TLIFVQVPDDHPLRRDTRG"
FT   gene            complement(778801..779676)
FT                   /locus_tag="Mmcs_0732"
FT   CDS_pept        complement(778801..779676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmcs_0732"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP4043c possible oxidoreductase"
FT